pengaruh motivasi terhadap disiplin kerja pegawai dinas kesehatan kabupaten bintan

Download Pengaruh Motivasi Terhadap Disiplin Kerja Pegawai Dinas Kesehatan Kabupaten Bintan

If you can't read please download the document

Post on 17-Aug-2015

255 views

Category:

Documents

19 download

Embed Size (px)

DESCRIPTION

m

TRANSCRIPT

TUGAS AKHIR PROGRAM MAGISTER (TAPM) PENGARUH MOTIVASI TERHADAP DISIPLIN KERJAPEGAWAI DINAS KESEHATAN KABUPATEN BINTAN TAPM diajukan sebagai salah satu syarat untuk memperoleh gelar Magister Sain dalam Administrasi Bidang Minat Administrasi Publik Disusun Oleh: MURNILAWATI NIM : 015583477 PROGRAM PASCASARJANA UNIVERSITAS TERBUKA JAKARTA 2012 UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaABSTRAK Pengaruh motivasi terhadap disiplin kerja pegawai Dinas KesehatanKabupaten Bintan Murnilawati Universtas Terbuka [email protected] KataKunci:Motivasi,KebutuhanPrestasi,KebutuhanKekuasaan,Kebutuhan Afiliasi, dan Disiplin Penelitianinidimaksudkanuntukmengetahuiseberapabesarpengaruhmotivasiyang meliputikebutuhanprestasi,kebutuhankekuasaandankebutuhanAfiliasidalam mempengaruhidisiplinpegawaipadaDinasKesehatanKabupatenBintan.Variabelyang diteliti yaitu: variable Motivasi (X) yang meliputi dimensi : kebutuhan prestasi, kebutuhan kekuasaan, dan kebutuhan afiliasi, sedangkan Variabel Y adalah disiplin. Metode pengambilan sampel yang digunakan dalam penelitian ini adalah metode sensus yaitumetodepengambilansampeldimanaseluruhanggotapopulasidijadikansebagai sampel. Alasan pengambilan sampel dengan metode ini adalah karenajumlah populasi yang sedikit yaitu 93 responden yang berstatus sebagai pegawai pada Dinas Kesehatan Kabupaten Bintan. Adapun tujuan dalam penelitian ini adalah: (1) Untuk mengetahui seberapa besar variabel X (kebutuhan prestasi, kebutuhan kekuasaan, dan kebutuhan afiliasi) secara individu maupun secara parsial (bersama-sama) dalam meningkatkan disiplin pegawai, (2) Untuk mengetahui variabel apa yang mempunyai pengaruh paling dominan terhadap disiplin. Dari hasil uji regresi didapatkan hasil perhitungan nilai thitung dan Fhitung lebih besar dari nilai ttabel danFtabel. untuk nilaiFhitungyaitu 164,093>Ftabel sebesar 2,170. Maka dapat disimpulkanbahwavariabelmotivasidengandimensikebutuhanprestasi,kebutuhan kekuasaan, dan kebutuhan afiliasi secara serentak berpengaruh signifikan terhadap disiplin kerja pegawai pada Dinas Kesehatan Kabupaten Bintan. HasilperhitunganuntuknilaiR2dalamanalisisregresiberganda,dalampenelitianini diperoleh angka koefisien determinasi atau R2 sebesar 0,847 artinya84,7% variasi variabel motivasi dapatmenerangkanvariasivariabel disiplinkerja. Sedangkan sisanya 15,3%lagidijelaskan oleh variabel residualnya atau variabel lain yang tidak diteliti dalam penelitian ini. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaABSTRACT The influence of motivation on labor discipline in theDistrict Health Murnilawati Open University [email protected] Keywords:Motivation,PerformanceRequirements,PowerRequirements,NeedFor Affiliation, And Discipline Thisstudyaimedtofindouthowmuchinfluencemotivationincludingachievement requirements, power requirements and needs of Affiliates in affecting employee discipline in the District Health Office Bintan. The variables studied are: Motivation variable (X) which includes the dimensions: need for achievement, power requirements, and need for affiliation, whereas the variable Y is a discipline. The sampling method used in this study is that census methods of sampling methods in which all members of the population used as the sample. Reason sampling with this method is that the amount of population that is 93 fewer respondents status as civil servants in Bintan District Health Office. Thepurposeofthisstudyare:(1)TofindouthowmuchthevariableX(need achievement,needforpowerandaffiliationneeds)individuallyorpartially(jointly)in improvingemployeediscipline,(2)TodeterminewhatvariablesThemostdominant influence on the discipline. From the results of t regration test results obtained and Fcount tcount value calculation is greater than the value of a ttable and Ftabel. for the value of 164.093 Fcount >Ftable of 2.170. It canbeconcludedthatthemotivationvariableswiththedimensionsofperformance requirements, power requirements, and the simultaneous need for affiliation and significant effect on the discipline of an employee working at the District Health Office Bintan. Theresultsofcalculationsfor thevalueofR2inmultipleregressionanalysis,inthis study were obtained coefficient of determination or R2 of 0.847means that 84.7% of the variation may explain the motivation variable variables variation of work discipline. While the remaining 15.3% is explained by another variable or variables other residualnya is not examined in this study. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaKATAPENGANTAR DenganmemanjatkanpujidansyukurkehadiratAllahSWT,karenaatas bimbingandanperkenaan-Nya,penulisdapatmenyelesaikanTugasAkhir Program Magister (TAPM) tepat pada waktunya. Terwujudnya penulisan tesis ini tidak lepas dari bantuan dan dorongan berbagai pihak yang selalu membantu dan mendukungpenulissehinggapenulislebihmantapdangigihdalamupaya melanjutkan tahap demi tahap penulisan tesis ini. Untuk itu, penulis dengan segala ketulusan dan kerendahan hati menghaturkan banyak terima kasih dan apresiasi setinggi-tinginya kepada berbagai pihak antara lain sebagai beriku : 1.Bapak Paken Pandiangan, S.E., M.Si selaku kepala unit program belajar jarak jauh (UPBJ J-Batam) 2.Ibu Dra. Susanti, M.Si selaku ketua prodi Manajemen Administrasi Publik Universitas Terbuka UPBJJ UT Batam 3.Bapak Prof. Dr. Monang Sitorus, M.Si selakuPembimbingI, yang telah banyakmembantudanmemberikanmasukansertamotivasikepada penulis dalam menyelesaikan tesis ini. 4. Bapak Dr. Sudirah, M.Si selaku Pembimbing II, yang telah menyediakan banyak waktunya untuk memberikan arahan dan petunjuk kepada penulis. 5.Seluruh Staf dan Dosen Pengajar Universitas Terbuka 6.BapakPudjiBasuki,SKMselakukepalaDinasKesehatanKabupaten Bintanyangtelahmemberikanizindanberbagaikemudahanuntuk mengadakan penelitian pada lembaga yang dipimpin. 7.Rekan-rekan sekerjayangbersediamemberikanwaktu dalammenjawab kuisioner dan semua pihak yang tidak dapat penulis sebutkan satu persatu. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka8.Ayah dan Ibuyangtelahmendoakan danmemberikan semangat kepada penulis dalam menyelesaikan TAPM ini. 9.Suami tercinta Rioza Susanta, ST serta anak-anak : Iqlima Azzahra, Alif Ghaza Alfatih yang telah memberikan dukungan dengan penuh perhatian selama penulis menimba ilmu. 10. Berbagaipihakyangsecaralangsungmaupuntidaklangsungturut membantu dalam perampungan Tesis ini Akhirnya berbagai saran dan kritik untuk penyempurnaan tesis ini menjadi dambaan dan harapan penulis dalam rangka memperluas wawasan. Tanjungpinang, 12 Juni 2012 Penulis, Murnilawati UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaDAFTARISI Keterangan Halaman ABSTRAK........... i ABSTRACT ....................................................................................ii LEMBAR PERSETUJUAN ............................................................iii LEMBAR PENGESAHAN ............................................................iV KATA PENGANTAR .....................................................................v DAFTAR ISI ...................................................................................vii DAFTAR TABEL ...........................................................................ix DAFTAR GAMBAR ......................................................................x DAFTAR LAMPIRAN ...................................................................xi BABIPENDAHULUAN A. Latar BelakangMasalah...........1 B. Perumusan Masalah.................4 C.Tujuan Penelitian.........................................................5 D.Manfaat Penelitian...........................................................5 BAB IITINJAUAN PUSTAKA A.Kajian Teori .........................................................................7 1. Kebijakan Publik.................................................7 2. Hubungan Motivasi Kerja Dengan Disiplin Pegawai ....... 10 3. Motivasi.....................................12 4. Disiplin Kerja ...................................................................29 5. Penelitian Sebelumnya 38 B.Kerangka Berpikir............................................................40 C.Definisi Operasional.40 D.Hipotesis..42 BAB III METODE PENELITIAN A.DesainPenelitian ...............................................................43 B.Populasi dan Sampel ...........................................................43 C.Variabel Penelitian ..............................................................44 D.Instrumen Penelitian ............................................................44 UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaE.Prosedur Pengumpulan Data ...48 1.Jenis dan Sumber Data ...............................................48 2.Teknik/Cara Pengumpulan Data ................................48 F.Teknik/Metode Analisis Data ..........................................49 1.Uji Validitas ...............................................................50 2.Uji Reliabilitas ............................................................53 3.Analisa Regresi Berganda ...........................................55 4.Uji R2 5.Uji F ............................................................................57 ..........................................................................55 6.Uji Asumsi Kelasik .....................................................58 G.Lokasi Penelitian ..............................................................59 BAB IVTEMUAN DAN PEMBAHASAN A.Hasil Penelitian ...................................................60 1.Gambaran Umum Objek Penelitian.....................60 2.Visi, Misi dan Tujuan...61 3.Gambaran Umum Responden Penelitian .............66 4.Analisis Deskriptif Penelitian..70 5.Uji Asumsi Klasik..83 6.Uji Regresi Linier Berganda...............................88 7.Uji Koefisien Determinasi (R28.Pengujian Hipotesis .........................................91 ) .. 90 B.Pembahasan Hasil Analisis data ............................97 BAB V KESIMPULAN DAN SARAN A.Kesimpulan .........................................................105 B.Saran......106 DAFTAR PUSTAKA.108 UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaDAFTARTABEL No. Tabel Keterangan Halaman Tabel 3.1 Kisi-kisi Instrumen Penelitian ......................................46 Tabel 3.2Hasil Pengujian Validitas Instrumen ............................51 Tabel 3.3Hasil Uji Reliabilitas Instrumen ...................................54 Tabel 4.1Distribusi frekuensi responden berdasarkan gender ........67 Tabel 4.2Distribusi Frekuensi berdasarkan Usia...........................68 Tabel 4.3Distribusi frekuensi responden berdasarkan jenjang Pendidikan .................................................................69 Tabel 4.4Distribusi frekuensi responden berdasarkan lama bekerja70 Tabel 4.5Kriteria Penilaian Berdasarkan Rentang Skor..............71 Tabel 4.6 Skor Variabel Motivasi .............................................72 Tabel 4.7 Skor Indikator Dimensi Kebutuhan Prestasi (Xa) .........73 Tabel 4.8Skor Indikator Dimensi Kebutuhan Kekuasaan (Xb) ....75 Tabel 4.9 Skor Indikator Dimensi Kebutuhan Afiliasi (Xc) .........77 Tabel 4.10 Skor Variabel Disiplin ..............................................78 Tabel 4.11Skor Indikator Dimensi Disiplin Waktu (Ya) ..............79 Tabel 4.12Skor Indikator Dimensi Disiplin Kekuasaan (Yb).........81 Tabel 4.13Skor Indikator Dimensi Disiplin Afiliasi (Yc) .............82 Tabel 4.14 Tabel 4.15Uji Autokorelasi ......................................................88 Hasil Uji Multikolinieritas ........................................87 Tabel 4.16Analisis Regresi Linier Berganda .................................89 Tabel 4.17 Uji Koefisien Determinasi (R2Tabel 4.18Uji t ................................................................................92 ) ....................................90 Tabel 4.19Uji F ..............................................................................97 UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka DAFTARGAMBAR No. Gambar KeteranganHalaman Gambar 2.1Hierarchi of Needs dari A.H. Maslow .........................16 Gambar 2.3Kerangka Pemikiran .................................................... 40 Gambar 4.1Struktur Organisasi Dinas Kesehatan Kabupaten Bintan75 Gambar 4.2Normal Probability Plot Uji Normalitas Data ............. 84 Gambar 4.3Histogram Uji Normalitas Data ....................................85 Gambar 4.4Scatterplot Uji Heteroskedastisitas ...............................86 UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaDAFTAR LAMPIRAN No. Lampiran KeteranganHalaman Lampiran 1Pertanyaan/pernyataan Kuisioner.............................111 Lampiran 2Tabulasi Data Ordinal...............................................116 Lampiran 3Tabulasi Data Interval..122 Lampiran 4Hasil Analisis Data .................................................... 128 UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaUNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaBAB II TINJAUAN PUSTAKA A.Kajian Teoritis 1.Kebijakan Publik SumberDayaManusiamerupakanbagiandaridalamsuatukemajuanilmu pembangunan, dan teknologi. Oleh karena itu dalam era sekarang ini dimana teknologi danperadabansudahsangatmaju,menuntutSumberDayaManusiayangkompeten yangmemilikisemangatdankedisiplinanyangtinggidalammenjalankanperandan fungsinya baik untuk individual maupun tujuan organisasial. SumberDayaManusiayangdisebutdisinisalahsatunyaadalahPegawaiWarga Negara Republik Indonesia yang telah memenuhi syarat yang ditentukan, diangkat oleh pejabat yang berwenang, diserahi tugas dalam suatu jabatan negeri atau diserahi tugas lainnya,digajiberdasarkanperaturanperundangundanganyangberlakudanjuga merupakan unsur pelaksana pemerintah, perekat, pemersatu bangsa dan negara dan juga dipercayapemerintahuntukmencapaitujuannasional.Karenaituseorangdisebut sebagai unsur aparatur Negara yangmempunyaitugas menyelenggarakan tugas-tugas umum pemerintah dan pembangunan. Aturanatauperaturantersebutsecarasederhanakitapahamisebagaikebijakan publik, jadi kebijakan publik ini dapat kita artikan suatu hukum. Akan tetapi tidak hanya sekedar hukum namun kita harus memahaminya secara utuh dan benar. Ketika suatu isu yangmenyangkut kepentingan bersama dipandang perlu untuk diatur makaformulasi isu tersebut menjadi kebijakan publik yang harus dilakukan dan disusun serta disepakati oleh para pejabat yang berwenang. Ketika kebijakan publik tersebut ditetapkan menjadi suatukebijakanpublik:apakahmenjadiUndang-Undang,apakahmenjadiPeraturan Pemerintah atau Peraturan Presiden termasuk Peraturan Daerah maka kebijakan publik tersebut berubah menjadi hukum yang harus ditaati.UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka Sementara itu pakar kebijakan publik mendefinisikan bahwa kebijakan publik adalah segala sesuatu yang dikerjakan atau tidak dikerjakan oleh pemerintah, mengapa suatu kebijakan harus dilakukan dan apakah manfaat bagi kehidupan bersama harus menjadi pertimbanganyangholistikagarkebijakantersebutmengandungmanfaatyangbesar bagi warganya dan berdampak kecil dan sebaiknya tidak menimbulkan persoalan yang merugikan,walaupundemikianpastiadayangdiuntungkandanadayangdirugikan, disinilahletaknyapemerintahharusbijaksanadalammenetapkansuatukebijakan:(Thomas Dye dalam T Handoko, 1992; 2-4). Untukmemahamikedudukandanperanyangstrategisdaripemerintahsebagai publik aktor, terkait dengan kebijakan publik maka diperlukan pemahaman bahwa untuk mengaktualisasinyadiperlukansuatukebijakanyangberorientasikepadakepentingan rakyat.Seorangpakarmengatakan:(AminullahdalamMuhammadi,2001:371-372): bahwakebijakanadalahsuatuupayaatautindakanuntukmempengaruhisistem pencapaiantujuanyangdiinginkan,upayadantindakandimaksudbersifatstrategis yaitu berjangka panjang dan menyeluruh. Dengan demikian kebijakan publik sangat berkait dengan administasi negara ketika publikaktormengkoordinasiseluruhkegiatanberkaitandengantugasdalamrangka memenuhiberbagaikebutuhanmasyarakatmelaluiberbagaikebijakanpublik/umum untukmemenuhikebutuhanmasyarakatdannegara.Untukitudiperlukansuatu administrasiyangdikenaldengan"administrasinegara."MenurutNigrodanNigro dalambukuM.IrfanIslamy"Prinsip-prinsipKebijakanNegara(Islamy,2001:1), administrasi negara mempunyai peranan penting dalam merumuskan kebijakan negara daninimerupakanbagiandariprosespolitik.Administrasinegaradalammencapai tujuan dengan membuat program dan melaksanakan berbagai kegiatan untuk mencapai tujuan dalam bentuk kebijakan. Oleh karena itu kebijakan dalam pandangan Lasswell dan Kaplan yang dikutip oleh Said Zainal Abidin (Abidin, 2004:21) adalah sarana untuk UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukamencapaitujuanatausebagaiprogramyangdiproyeksikanberkenaandengantujuan, nilai, dan praktik. Apayangkemudianmenjadibidangadministrasipublikadalahbagaimanaorang-orangmengorganisasikan diri mereka sebagai publik secara kolektif dan dengan tugas dankewajibanmasing-masingmemecahkanmasalah-masalahpublikuntukmencapai tujuanbersamamereka(Caiden,1982:3).Negaramerupakanlembagaformalyang memilikimandate(denganasumsibahwamekanismedemokratisberlangsung)dari rakyat melalui cara-cara tertentu yang dapat dibenarkan oleh hukum yang berlaku untuk memenuhikepentinganpublik.Olehkarenaituadministrasipubliksecaralebihluas dapatdijelaskansebagaiapayangdilakukanolehpemerintah,terutamalembaga eksekutifnyadidalammemecahkanmasalah-masalahkemasyarakatan(Nigrodalam Darwin:5) Pelaku utama dalam proses administrasi publik adalah mereka yang disebut sebagai administrator Negara atau pegawai negeri. Merekalah yang di bebani tanggung jawab untukmengerjakantugas-tugaspemerintahanataupelayananpublik,tetapiproses administrasi sesungguhnya melibatkan juga banyak pihak diluar pegawai negeri, seperti pekerja-pekerjasocial,LembagaSwadayaMasyarakat(LSM),terutamadalamiklim deregulasidanprivatisasi,sektorswastacenderungmemainkanperananyangsangat penting dalam proses pelayanan publik. Sektor-sektornonpemerintahtersebutmelakukantindakandengan mengatasnamakankepentinganpublikdantindakan-tindakanmerekadapat menimbulkanakibat-akibattertentukepadamasyarakatluas.Walaupunproses administrasi publik meletakkan pemerintah sebagi aktor dan lembaga utamanya, proses tersebut juga melibatkan unsur-unsur lain dalam masyarakat seperti LSM dan organisasi sosial. Selain itu publik atau masyarakat luas merupakan sumber legitimasi dan tujuan darimana dan kepada siapa proses administrasidiselenggarakan. Dalamnegarayang UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukademokratisprosesadministrasipublikdilakukanatasmandatyangdiberikanoleh publik melalui proses yang melibatkan publik dan untuk sebesar-besarnya manfaat yang dapat diterima publik oleh karena itu faktor kedisiplinan memegang peranan yang amat penting dalam pelaksanaan kerja pegawai. Seorang pegawaiyangmempunyai tingkat kedisiplinan yang tinggi akan tetap bekerja dengan baik walaupun tanpa diawasi oleh atasan. Seorang pegawai yang disiplin tidak akan mencuri waktu kerja untuk melakukan hal-halyangtidakadakaitannyadenganpekerjaan.Demikianjugapegawaiyang mempunyaikedisiplinanakanmentaatiperaturanyangadadalamlingkungankerja dengankesadaranyangtinggitanpaadarasapaksaan.Padaakhirnyapegawaiyang mempunyai kedisiplinan kerjayang tinggi akanmempunyai kinerjayangbaik karena waktu kerja dimanfaatkan sebaik mungkin untuk melaksanakan pekerjaan sesuai dengan target yang telah ditetapkan. FaktorMotivasijugatidakkalahpentinguntukmeningkatkandisiplinkerja pegawai.Motivasimenjadipendorongseseorangmelaksanakansuatukegiatanguna mendapatkanhasilyangbaik.Olehkarenaitulahtidakheranjikapegawaiyang mempunyai motivasi kerja yang tinggi biasanya mempunyai disiplin kerja yang tinggi pula.Untukitumotivasikejapegawaiperludibangkitkanagarpegawaidapat menghasilkan disiplin kerja yang baik.1.Hubungan Motivasi Kerja Dengan Dispilin Pegawai Dapatdiketahuisumberdayamanusiamerupakanfaktorutamayangtidakdapat digantikan oleh teknologi apapun, dalam setiap organisasi. Tetapi agar mereka bekerja dengan baik harus ada yang mengelola seperti misalnya diangkatnya seorang pimpinan. Pimpinan adalah orang yang bekerja dengan bantuan orang lain. Ia tidak menjalankan semuapekerjaansendirisaja,tetapimemintabantuanoranglainmenjalankannya, memberikan tugas-tugas kepada bawahannya. Seorang pegawai mungkin menjalankan pekerjaanyangdibebankankepadanyadenganbaik,mungkinpulatidakbahkan UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukamelaksanakanpemogokankerja.J ikapegawaitidakmelaksanakannyadenganbaik, maka perlu diketahui sebab-sebabnya. Beberapaorganisasimemilkiprosedurpendisiplinanpegawaidanprosedur menangani keluhan pegawai yang sangat formal, sedangkan yang lain kurang formal bahkan ada yang tidak memilki prosedur sama sekali. Agar dapat berkompetensi secara efektiforganisasiharusmengambillangkah-langkahuntukmenjaminmerekayang berkinerjabagusdiberimotivasiagartetapbertahanbekerjabersama-samadengan organisasi,sedangkanmerekayangmemilikikinerjarendahdidoronguntukdapat meningkatkan kinerjanya. Salahsatuupayayangperluditelusuripimpinanadalah`motivasipegawaiitu sendiri, denganmaksud agar bisa bekerja dengan tugas yang diembankan kepadanya. Agarmotivatorberhasilmendorongpegawaimakaperludiketahuiapayangmenjadi kebutuhanpegawaiitusendiri.Siagian(1987:11)mengatakankebutuhanitusendiri adalah keperluan hidup seseorang yang harus dipenuhi. Proses pemenuhan kebutuhan iniyaknimelaluipimpinanlewatorganisasiyangdimasuki.Sedangkanmotivasiitu sendirimenurutVroom(dalamGibson,1990:102)adalahsuatuprosesyang menentukan pilihan antara alternatif dari kegiatan suka rela.SelanjutnyaWahyusumidjo(1980:128)mengatakanbahwamotivasikeseluruhan proses pemberian motif bekerja kepada para bawahan sedemikian rupa sehingga mereka maubekerjadengandispilinyangtinggidemitercapainyatujuanorganisasidengan efisien dan ekonomis. Dari pendapat itu dapat ditarik kesimpulan bahwa motivasi berhubungan erat dengan disipilin pegawai. Sehingga apa yang dikemukakan Ingle (terjemahan 1993:251): "Bilaseseorangdimotifkansecaratepatmakaiaakanmenggunakankemampuan, ketrampilandanpengetahuannyasehinggamerekaberdisipilin.Karenaitu,motivasi adalah faktor utama di dalam organisasi agar pegawai berdisipilin dalam bekerja". UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka J ika mengacu kepada pendapat para pakar itu untuk memotivsi kerja pegawai dalam meningkatkandisipilinkerjaorganisasiternyatamotivasikerjapegawaisangaterat hubungannya dalam upaya peningkatan disiplin pegawai dan tidak dapat dipisahkan.3.Motivasi Motivasidapatdidefinisikansebagaikeadaaninternalindividuyangmelahirkan kekuatan,kegairahandandinamikasertamengarahkantingkahlakupadatujuan (Mursi,1997:91).Dalampengertianlain,motivasimerupakanistilahyangdigunakan untukmenunjukkanadanyasejumlahdorongan,keinginan,kebutuhandankekuatan. Perusahaan yang sedangmembangkitkan motivasi para karyawan, berarti perusahaan sedangmelakukansesuatuuntukmemberikankepuasanpadamotif,kebutuhan,dan keinginanparakaryawansehinggakaryawanakanmelakukansesuatuyangmenjadi keinginan dan tujuan perusahaan. MenurutRobbins(1996:198)motivasiadalahkesediaanuntukmengeluarkan tingkatupayayangtinggikearahtujuanorganisasi,yangdikondisikanoleh kemampuan upaya itu untuk memenuhi sesuatu kebutuhan individual. DefinisilaintentangmotivasidiungkapkanNajati(2001:14)yanglebihmelihat dari unsur kejiwaan. Menurutnyamotivasiyangtidakbersifat fisiologis untuk tubuh yangtumbuh,karenaadanyakekuranganataukebutuhan-kebutuhanyangbersifat jasmaniah;sebagiamanahalyangadadalammotivasifisiologis,yaknisepertirasa lapar, haus dan lelah. Kebutuhan tersebut timbul akibat dari hubungan antar manusia yang dalam hal ini lebih ditekankan padahubunganyang terjadi dalam proses produksiyaitu hubungan industrial.Motivasimemberikanrangsanganuntukmemenuhikebutuhanprimer, kebutuhansekunder,kebutuhanuntukbekerjadanberproduksiuntukmeningkatkan kinerja.Konsepmotivasiberkaitaneratdenganmotivasikerja,moralspiritualdan motivasi spiritual. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaMotivasikerjaadalahsuatudorongankehendakyangmempengaruhiperilaku tenagakerja,untukberusahameningkatkankinerjakarenaadanyasuatukeyakinan bahwapeningkatankinerjamempunyaimanfaatbagidirinya.Moralspiritualdapat diartikan sebagai pengamalan nilai-nilai moral yang didasarkan pada tujuan hidupnya adalah untuk mengembangkan semua kecakapan secara terkoordinasi dan bermanfaat (Mannan, 1992:358).Apapun yang telah dilimpahkan Tuhan atas manusia baik kecakapan batin dan lain-lain agar digunakan sebaik-baiknya. Penggunaan itu harus disesuaikan dan diatur, kalau tidakkecakapanbatintidaklagimerupakankegiatanmoral.Manusiabertanggung jawab atas perbuatan yang dilakukan, sesuatu yang direnungkan dan direncanakannya. Setiaporangwajibuntukmenyelamatkandanmeningkatkankesejahteraanjiwanya sendiri maupun kesejahteraan sesama manusia. Belajardaripengalamanhidupmanusiadalampemenuhankebutuhanprimer, setidaknya teori (Chapra dalam Cabullah Wibisono 2009:28) mengenai perlunya filter moral dalam motivasi layak dipertimbangkan. Ia mengungkapkan masalah kedua yang dihadapiolehsetiapmasyarakatadalahbagaimanamemotivasiindividuuntuk melayanikepentingansosialseiringdenganfiltermoralmeskipunketikaberbuat demikian merugikan kepentingannya sendiri. Ini disebabkan oleh semua individu selalu inginmelayanikepentingannyasendiri,danbilamerekatidakberbuatdemikian, perilaku mereka tidak kondusif bagi realisasi efisiensi yang optimal dalam penggunaan sumber-sumber daya. Setiap upaya dalam mencegah individu melayani kepentingannya sendiri,sepertiyangtelahdicobaolehsosialisme,akanmenemuikegagalanChapra, dalam Cabullah Wibisono 2009:32). Konsepmotivasi spiritual menurut Chapra tersebut sejiwa dengan perspektif yang dikemukakan Max Weber bahwa dunia Barat berkembang tidak didorong oleh motivasi darinilai konsumtif,melainkan olehmotivasi dari nilai kreatifyangdisebut sebagai UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukaetos karya. Motivasiatau"motivation"berarti:pemberianmotif,penimbulanmotifatauhal yang menimbulkan dorongan atau keadaan yang menimbulkan dorongan. Dapat juga dikatakanbahwamotivasiadalahfaktoryangmendorongoranguntukbertindak dengancaratertentu.Dalammelakukanpekerjaanpegawaiselaludihadapkanoleh motif, harapan, dan insentif.Sedamayanti(2000:104)mengatakanbahwa:"Motivasisebagaikeseluruhanpros pemberian motif kerja kepada parabawahan sedemikian rupa sehingga mereka mau bekerja dengan ikhlas demi tercapainya tujuan organisasi dengan efektif dan efesien". Juga dalam buku yang sama dikemukakan oleh George R.Terry mengemukakan bahwa :"Motivasiadalahkeinginanyangterdapatpadadiriseseorangindividuyang merangsangnya untuk melakukan tindakan-tindakan".Lebih spesifik lagi dikemukakan oleh hasibuan (2000:163) mengatakan bahwa: " Teori motivasi mempunyai sub variabel yaitu motif, Harapan, dan Insentif, adapun pengertiannya adalah: (a) Motif (Motif) adalah sesuatu perangsang keinginan (want) dandayapenggerakkemauanbekerjaseseorang.Setiapmotifmempunyaitujuan tertentu yang ingin dicapai. (b) Harapan (Expectancy) adalah suatu kesempatan yang diberikan karena perilaku untuk tercapainya tujuan. (c) (incentive) yaitu memotivasi (merangsang) bawahan denganmemberikan hadiah (imbalan) kepada merekayang berprestasi di atas prestasi standar. Dengan demikian semangat kerja bawahan akan meningkat karena umumnya manusia senang menerima yang baik-baik saja". Gie, cs (Martoyo,2000:164)memberikanperumusanmotivasiadalahsebagai pekerjaan yang dilakukan oleh seorang manajer dalam memberikan inspirasi, semangat dandorongankepadaoranglain,dalamhalinikaryawannya,untukmengambil tindakan-tindakan. Pemberian dorongan ini bertujuan untuk menggiatkan orang-orang ataukaryawanagarmerekabersemangatdandapatmencapaihasilsebagaimana dikehendakidariorang-orangtersebut.Karenaituagarmotivasibisa diimplementasikan padasetiap pegawai perlumemahamimodel-modelimplementasi itusendiri,sebagaisuatukerangkapemikirantertentu. Adapunpemahamantentang model motivasi akan diuraikan lebih lanjut. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaAda beberapa model motivasi yang dirancang para ahli, model motivasi yang dapat dipergunakanolehparapegawaidalammeningkatkanmotivasinyadalambekerja. Modelmotivasiinitidakhanyasatu,adaberbagaimacamsesuaidengankerangka berfikirpembuatdanpemakaimodeltersebut.Paraperancangmodeltersebut diantaranya: 1) Abraham H.Maslow, 2) Frederick Herzberg, 3) David McCLelland, 4) Victor Vroom, 5) B.F Skinner, 6) Porter-Lawler.J ika diamati para perancang model motivasi diatas menurut Abraham Maslow (T. HaniHandoko2003:258)terdiriatas5macamkebutuhanyangtersusunsecara hierarkis. Lima (5) macam kebutuhan tersebut dapat dijelaskansebagai berikut ini: a)Kebutuhan fisiologis dasar. Kebutuhanfisiologisdasaradalahkebutuhanfaali,kebutuhanbiologis,seperti: istirahat, tidur, makan, minum, buang air, tempat berteduh, sex dan sebagainya.b)Kebutuhan keselamatan dan keamanan. Adalah kebutuhan akan keselamatan jasmani dan rohani, keamanan pribadi maupun keluarga, rasa tentram, bebas dari rasa takut, kebutuhan memperoleh pekerjaan, dan adanya peraturan yang memberikan bimbingan serta pengarahan untuk bertindak. c)Kebutuhan sosial Adalahkebutuhanakanrasadiakui,diterimaolehmasyarakatlingkungannya, cinta-mencintai, rasa memiliki dan kebutuhan sosial lainnya. d)Kebutuhan akan penghargaan Adalahkebutuhanakanpengakuanatasstatusdanprestasiyangadadantelah dicapainya. e)Kebutuhan aktualisasi diri ( Self Actualisation ) Adalahkebutuhanakanperwujudandiri,pencapaiancita-citadiri,pembawaan sikap dirinya terhadap tugas dan kerja yang menjadi tanggung jawabnya. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaMaslowmemisahkankelimakebutuhanitusebagaitingkattinggidantingkat rendah.Kebutuhanpsikilogisdankebutuhanakankeamanandigambarkansebagai kebutuhantingkatrendahdankebutuhansosial,kebutuhanakanpenghargaan,dan aktualisasi-dirisebagai kebutuhan tingkat-tinggi. Pembedaan antara kedua tingkat itu berdasarkan alasan bahwa kebutuhan tingkat-tinggi dipenuhi secara internal (didalam diri orang itu), sedangkan kebutuhan tingkat-rendah terutama dipenuhi secara eksternal (dengan upah, kontrak serikat buruh, dan masa kerja, misalnya). Teori kebutuhan Maslow dapat digambarkan dalam piramida berikut ini : Gambar 2.1 Hierarchi of Needs dari A.H. Maslow Self Actualisation Fulfillment of (individual potentialities) Esteem (Self respect: esteem of others) Social (Love, affection, belongingness) Security (Freedom from fear, need for order and rules to guide action) Physiological (Water, food, sleep, sex) Sumber : T. Hani Handoko (2003:258) Teorihierarkikebutuhanmenyatakanbahwakebutuhandankepuasanpekerja identik dengan kebutuhan biologis dan psikologis. Teori ini menggunakan dasar bahwa manusiamerupakanmakhlukyangkeinginannyatakterbatasatautanpahenti,alat motivasi nya adalah kepuasan yang belum terpenuhi serta kebutuhannyaberjenjang. Jenjangtersebutdapatdigambarkandariyangpalingrendahsampaiyangpaling tinggi. Keberadaan jenjang kebutuhan ini merupakan ciri khas teori Maslow tetapi juga UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukamenimbulkankritikkarenadalamkehidupannyatapemuasankebutuhanmanusia seringkali simultan dan tidak selalu berurutan satu demi satu. HalsenadajugadiungkapkanolehHerzberg(T.HaniHandoko;259)mengenai motivasi pada umumnya, para pegawai baru cenderung memusatkan perhatiannya pada pemuasan tingkat kebutuhan lebih rendah dalam pekerjaan pertama mereka, terutama keamanan. Tetapi setelah halitu terpuaskan, mereka akan berusaha untukmemenuhi tingkatan-tingkatan kebutuhan yang lebih tinggi, seperti kebutuhan inisiatif, kreatifitas dan tanggung jawab.Diantara model-model motivasi yang dikemukakan oleh para ahli diatas, maka teori motivasi yang akan dipakai dalam penelitian ini adalah tiori yang dikemukakan oleh DavidMclelland(1987).Pertimbanganmenggunakantioriiniada kecocokan/kesesuaiandilapangan.Dimanakebutuhanakanprestasidankebutuhan akan kekuasaan merupakan salah satu demensi dari motivasi seperti yang dikemukakan olehDavidMclelland.Mclelland(1987:261)menguraikansecararingkasdemensi-demensi yang melatar belakangi motivasi seseorang : 1)The Need for Achievement (n-ach) atau Kebutuhan akan prestasi/pencapaian. Kebutuhanakanprestasiadalahkebutuhanseseoranguntukmemilikipencapian signifikan, menguasai berbagai keahlian, atau memilki standar yang tinggi. Orang memiliki n-ach yang tinggi biasanya selalu ingin menghadapi tantangan baru dan mencari tingkat kebebasan yang tinggi. 2)The Need for Authority and Power (n-pow) atau Kebutuhan akan kekuasaan. Kebutuhanini didasari oleh keinginan seseorang untuk mengatur danmemimpin oranglain.MenurutMclelland,adaduajeniskebutuhanakankekuasaan,yaitu pribadi dan sosial. 3)The Need for Affiliation (n-affil) atau Kebutuhan akan Afiliasi/keanggotaan. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaKebutuhan ini adalah kebutuhan yang didasari oleh keinginan untuk mendapatkan ataumenjalankanhubunganyangbaikdenganoranglainorangmerasaingin disukai dan diterima oleh orang lain. Lebihjelasnyaketigademensi-demensimotivasiyangdirumuskanMcCLelland (1987:261) akan diuraikan lebih lanjut: 1.The Need For achevement (n-ach) Kebutuhan akan prestasi/pencapaian Keberhasilan suatu motivasi menurut McCLelland harus didasari oleh kebutuahan akan prestasi sebagaimana riset empirik yang dilakukan oleh beliau menemukan bahwa parausahawan,ilmuandanprofesionalmempunyaitingkatmotivasiprestasidiatas rata-rata. Motivasi seorang pengusaha tidak semata-mata inginmencapai keuntungan demi keuntungan itu sendiri, tetapi karena dia mempunyai keinginan yang kuat untuk berprestasi.Keuntunganlabahanyalahsuatuukuransederhanayangmenunjukkan seberapa baik pekerjaan telah dilakukan, tetapi tidak sepenting tujuan itu sendiri. McCLellandjugamengemukakanbahwakebutuhanprestasitersebutdapat dikembangkanpadaorangdewasa.Orang-orangberorientasiprestasimempunyai karakteristik tertentu yang dapat dikembangkan, yaitu: 1.Menyukaipengambilanresikoyanglayak(moderat)sebagaifungsiketrampilan, bukan kesempatan, menyukai suatu tantangan, dan menginginkan tanggung jawab pribadi bagi hasil-hasil yang dicapai. 2.Menpunyai kecendrungan untuk menetapkan tujuan-tujuan prestasi yang layak dan menghadapi risiko yang sudah diperhitungkan. Salah satu alasan mengapa banyak perusahaan berpindah keprogram management by objective (MBO) adalah karena adanya korelasi positif antara penetapan tujuan dan tingkat prestasi. 3.Menpunyaikebutuhanyangkuatakanumpanbaliktentangapayangtelah dikerjakan. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka4.Mempunyaiketerampilandalamperencanaanjangkapanjangdanmemiliki kemampuan-kemampuan organisasional. KemudianHasibuan(2003:89)menambahkan,dariketigakebutuhantersebut, kebutuhan akan prestasiyang kemudianmendorong munculnyamotivasiberprestasi. Kebutuhan akan prestasi merupakan daya penggerak yang memotivasi semangat kerja seseorang.Karenaitukebutuhanberprestasiiniakanmendorongsesoranguntuk mengembangkankreativitasdanmengarahkansemuakemampuansertaenergiyang dimilikinyademimencapaiprestasikerjayangoptimal.Namunmotivasikeinginan pencapaian ini diimbangi dengan keinginan menghindari kegagalan, sehingga perilaku mungkindiarahkanketujuandengankesukaranmenengahdanbukannyakebutuhan dengan kesukaran tinggi (Atkitson & Feather dalam Jewell & Siegeall,1998). Sejalan dengan teori McClelland, Sabur (dalam Dahlani, 2009) menyatakan bahwa motivasiberprestasididefinisikansebagaisuatudayadalammentalmanusiauntuk melakukan suatu kegiatan yang lebih baik, lebih cepat, lebih efektif, dan lebih efisien daripada kegiatan yang dilaksanakan sebelumnya. Ini disebabkan oleh virus mental.Daripendapattersebut,Sabur(dalamDahlani,2009)mengartikanbahwadalam psikismanusia,adadayayangmampumendorongnyakearahsuatukegiatanyang hebat sehingga dengan daya tersebut, ia dapat mencapai kemajuan yang teramat cepat. Daya pendorong tersebut dinamakan virus mental, karena apabila berjangkit di dalam jiwamanusia,dayatersebutakanberkembangbiakdengancepat.Dengankatalain, daya tersebut akan meluas dan menimbulkan dampak dalam kehidupan.AhlilainyakniGellerman(dalamDahlani,2009)menyatakan,bahwamotivasi berprestasi ditandai dengan adanya perasaan senang saat berhasil memenangkan suatu persaingan dan keberanian menanggung segala resiko sebagai konsekuensi dari usaha untukmencapaitujuan.SedangkanmotivasiberprestasimenurutTapiardi(dalam Dahlani,2009)adalahsebagaisuatucaraberfikirtertentuapabilaterjadipadadiri UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukaseseorang cenderung membuat orang itu bertingkah laku secara giat untuk meraih suatu hasil atau prestasi. Dari pendapat di atas dapat di pahami bahwa dengan adanya motivasi berprestasi dalamdiriindividuakanmenumbuhkanjiwakompetisiyangsehat,akan menumbuhkanindividu-individuyangbertanggungjawabdandenganmotivasi berprestasiyangtinggijugaakanmembentukindividumenjadipribadiyangkreatif. Jadidapatdisimpulkanbahwamotivasiberprestasimerupakansuatudorongandari dalam diri individu untuk mencapai suatu nilai kesuksesan. Dimana nilai kesuksesan tersebutmengacupadaperbedaannyadengansuatukeberhasilanataspenyelesaian masalahyang pernah diraih olehindividumaupunberupa keberhasilanindividulain yang dianggap mengandung suatu nilai kehormatan. Dengandemikianjikadiamatiuraiandiatas,indikatorkebutuhanakanprestasi diantaranyamenguasaiberbagaikeahlian,prestasikerjayangmaksimal,perasaan senang jika berhasil dalam bekerja, bertingkah laku giat meraih prestasi. Ada beberapa karakteristik dari individu yang memiliki motivasi berprestasi yang dijabarkan oleh McClelland (1987:261), yakni sebagai berikut : 1)Menyukai tugas yang memiliki taraf kesulitan sedang Mereka yang memiliki motivasi berprestasi yang tinggi tidak menyukai tugas yang terlalumudah atau tidakmenantang,yang dinilai tidakmampumemuaskan kebutuhan berprestasi mereka. Mereka berpendapat jika tugas terlalu mudah, tidak ada alasan utuk terlihat lebih baik karena semua orang pasti dapat melakukannya. Namun disisi lain mereka juga tidak menyukai tugas yang terlalu sulit karena hal ini dapat menghambat kesempatan mereka untuk meraih sukses. Mereka tidak tertarikuntukmelakukannyakarenakemungkinanuntukgagalterlampaubesar. Makadariituorangorangyangmemilikikebutuhanberprestasiyangtinggi UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukamenyenangi tugas, pekerjaan, dan vokasional yang realistis, sehingga mereka dapat menyesuaikan kemampuan mereka dengan tuntutan dari pekerjaan mereka tersebut. 2)Bertanggung jawab secara personal atas performa kerja Orangyangmemilikimotivasiberprestasiyangtinggimemilihuntuk bertanggungjawabsecarapersonaluntukperformamereka,karenahanyadalam kondisitersebutmerekadapatmemperolehkepuasansetelahmelakukansesuatu yanglebihbaik.individutersebutjugamempunyaikecenderunganuntuk menyelesaikanpekerjaanyangdiberikankepadanyahinggatuntas,danselelau ingatakantugas-tugasnyayangbelumterselesaikan.Intinya,merekafokuspada peningkatan performa mereka secara pribadi, tanpa memperhatikan apakah prestasi tersebut berpengaruh bagi anggota kelompok mereka atau tidak. 3)Menyukai umpan balik (feedback) Orang dengan kebutuhanberprestasiyang tinggimenyukai performamereka dapat dibandingkan denganyanglain. Mereka senangmendapatkan umpanbalik yangtepat,cepatdanjelasdariapayangtelahmerekakerjakan.Umpanbalik menunjukkan seberapa baik mereka telah bekerja. Mereka selalu mengontrol hasil kerja mereka karena tidak suka mengambil risiko untuk gagal. 4)Inovatif Merekayangmemilikimotivasiberprestasiyang tinggijuga selalu berupaya untuklebihinovatif,menemukancarabaruyanglebihbaikdanefisienuntuk menyelesaikanpekerjaanmereka.Halyangmendorongmerekauntukbertindak seperti itu disebut dengan motif efisiensi. Mereka menghindari segala sesuatu yang monotondanberhubungandenganrutinitas.Merekasenangmencariinformasi untuk menemukan cara menyelesaikan tugas dengan lebih baik.Morgan,dkk(1986)menambahkan,ketikaorangyangmemilikikebutuhan berprestasimeraihkesuksesan,merekaakanterusmeningkatkanlevelaspirasi UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukamereka dengan cara yang realistis, jadi mereka dapat bergerak menuju tugas yang lebih sulit dan menantang. 5)Ketahanan (persistence) Orangdengankebutuhanberprestasiyangtinggiternyatajugamemiliki ketahanankerjayanglebihtinggidalammengerjakantugas.Merekamemiliki ketahanan yang lebih dalam menghadapi kegagalan yang mungkin ditemui dalam pekerjaan.Individutersebutumumnyamampubertahanterhadaptekanansosial yangada.Halinididorongdengankepercayaanbahwamerekadapat menyelesaikanpekerjaannyadengantepatdanbaiksertamampumengerjakan pekerjaanyangserupadenganhasilyanglebihbaikdimasadepan.Namun ketahanan ini tetap tergantung pada kemungkinan mereka untuk meraih sukses. Motivasi berprestasi ini dapat dipengaruhi oleh sejumlah faktor. Andreani (dalam Kadir2009)menjelaskanfaktoryangmempengaruhimotivasiberprestasipada karyawan dilihat dari sumbernya secara umum terbagi 2 (dua) yaitu : factor internal dan eksternal. 1.Faktor internal Bersumberdaridalamdiriindividusepertijeniskelamin,usia,tingkat pendidikan,pengalamankerjadankepribadian.Berdasarkanjeniskelamin, McClelland(dalamSchultz&Sydney,1993)menjelaskanbahwajeniskelamin dapatmempengaruhimotivasiberprestasiseseorang.Troll&Schwartz(dalam Sopah,1999)menambahkanbahwaperbedaannyaterletakpadaperlakuandan sosialisasi,dimanalaki-lakilebihdilatihuntukaktif,kompetitif,danmandiri sementaraperempuandibiasakanpasif,bergantungpadaoranglain,dankurang percaya diri.Dari segi usia, Schultz & Sydney (1993) mengatakan bahwa kualitas motivasi berprestasi mengalami perubahan sesuai dengan usia individu. Motivasi berprestasi UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukaindividu tertingggi pada usia 20-30tahun danmengalami penurunan setelah usia pertengahan(middle age )yangberkisarantara40-60tahun.Darisegitingkat pendidikan dan pengalaman kerja, Mulyawati (2008) mengatakan bahwa seorang karyawan yang mempunyai tingkat pendidikan tinggi dan mempunyai pengalaman kerjapastimempunyaimotivasiberprestasiyanglebihtinggidalambekerja, sehingga dengan hasil kerja yang baik mereka akan mendapat upah atau gaji yang tinggi dari apa yang mereka lakukan. Herzberg(dalamSiagian,1995)menyatakan,motivasiberprestasilebih dipengaruhi oleh faktor yang sifatnya intrinsik dan dihubungkan dengan kepuasan kerja,sepertikeberhasilanmencapaisesuatu,pengakuanyangdiperoleh,sifat pekerjaanyangdilakukan,rasatanggungjawab,kemajuandalamkarir,dan pertumbuhan professional dan intelektual yang dialami sesorang.Kepuasan kerja menjadi salah satu faktor penting yang mempengaruhi motivasi berprestasipadadiriseseorang(Irawan,2007).Kepuasankerjamencerminkan perasaanseseorangterhadappekerjaannya.Initampakdarisikapkaryawan terhadappekerjaanyangdijalanidandapatmendorongdanmempengaruhi semangatkerjakaryawanuntukdapatbekerjadenganbaikdansecaralangsung mempengaruhi prestasi karyawan. Kepuasan kerja disini juga merupakan salah satu dimensi dari job commitment (Morrow & McElroy, 1986), dimana orang yang puas akanpekerjaannyaakanmemilikijobcommitmentyangtinggi.Begitupula sebaliknya,orangyangtidakmerasapuasakanpekerjaannyaakanmemilikijob commitment yang rendah.2.Faktor eksternal Meskipunmotivasiberprestasilebihbanyakdipengaruhiolehfaktorinternal sejumlahahlijugamengungkapkanbeberapafaktoreksternalyangturut mempengaruhi.Faktoreksternalmerupakanfaktoryangmempengaruhimotivasi UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukaberprestasi sesorang yang bersumber dari luar diri individu tersebut, terdiri dari : hubunganpimpinandenganbawahan,hubunganantarrekansekerja,sistem pembinaandanpelatihan,sistemkesejahteraan,lingkunganfisiktempatkerja (Andreani dalam Kadir, 2009), status kerja, administrasi dan kebijakan perusahaan (Herzberg dalam Siagian, 1995), harapan orangtua terhadap anaknya, pengalaman pada tahun-tahun pertama kehidupan, latar belakang budaya seseorang dibesarkan, peniruantingkahlaku,danlingkungantempatprosespembelajaranberlangsung (McClelland dalam Sukadji & Singgih, 2001). Manusia adalah salah satu sumber daya paling utama dalam organisasi, walaupun semakincanggihteknologisaatininamunmanusiatidakdapatdigantikanoleh teknologi apapun. Bagaimana baiknya organisasi, lengkapnya sarana dan fasilitas kerja semuanyatidakakanmempunyaiartitanpaadanyamanusiayangmerencanakan, melaksanakan, mengevaluasi dan memeliharanya.Ungkapanmanusiadibelakangmejacukupmemberikankeyakinanbetapa pentingnya,manusiadalamkehidupanorganisasi.Sebab,manusiajugamampu mengatasi hambatan yang dialami oleh organisasi, mengatasi dan menghitung akibat-akibatsampinganyangditimbulkannya.Winardi(1992:30)mempertegasbahwa: "Harusdiakuibahwasanyatidakadaorganisasitanpamanusia,sehinggadengan demikianparamanejerharusmengetahuicaramemotivasi,memimpindan berkomunikasidanperlumemahamihubungan-hubunganantarperorangandan perilaku kelompok-kelompok orang-orang". Penetapanstrategipemahamanterhadapmanusiadalampencapaianpeningkatan produktivitasperusahaan,yangberorientasikepadasumberdayamanusiasangatlah penting,karenadengankesadaranpegawaisecarasukarelamencurahkan kemampuannyaberartiakanterciptapeluangmencapaitargetyangditetapkan perusahaansehinggakeberhasilanperusahaanakanberlangsungterus.Karenaitu, UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukamanajemen sumberdaya manusia yang berbasis kepada motivasi merupakan salah satu pilarnya.Sesungguhnya,motivating, l eading, d irecting, ac tuating, c ommunicating dalamartiat work.Istilah-istilahinimerupakansalahsatufungsimanajemenyang berorientasi kepada sumberdaya manusia. Salahsatucarayangdapatdigunakanmemahamimanusiaadalahdengan menganalisiskebutuhannyayangberanekaragam.Kebutuhanmanusiamerupakan kekuranganyangdialamipadawaktutertentu.Kekuranganinimungkinbersifat fisiologis,prestasi,sosialdanjeniskebutuhanlainnya.Adanyakebutuhanmanusia dipandangsebagaipembangkitmencarijalankeluaragarkebutuhannyadapat terpenuhi. Tegasnya, manusia moderen dewasa ini dalam usaha memenuhi kebutuhannya tidak mungkin lagi melakukannya dengan bekerja sendirian. Artinya, cara yang paling efektif untukmemuaskanberbagaikebutuhanituadalahdenganmenggunakanjalur-jalur organisasi.Suryawikarta (1994:4)mempertegas"bahwamanusiamoderentidakbisa melepaskan diri dari organisasi, sejak dia lahir sampai mati". Hal inilah yang menjadi dasarutamasemakinrumitnyakebutuhanmanusia,semakinbanyakpulajenis organisasi yang dimasukinya karena berbagai jenis organisasi merupakan wahana yang kiandisadaritidakbisatidakharusdimasukidandigunakanuntukmemuaskan berbagai kebutuhan yang sangat kompleks itu. Masuknyaseseorangkedalamorganisasi,sebagaiungkapanadanyakebutuhan pokokdanpentingbagikelangsunganhidupseseorangdanmotifnyapribadiatau internal. Di lain pihak, rangsangan berasal dari luar. Biasanya rangsangan ini dijadikan sebagai bagian dari lingkungan kerja yang diberikan oleh pimpinan untuk mendorong pegawainya melaksanakan pekerjaan. Setelah lewat beberapa waktu, pimpinan menilai prestasikerja.Darihasilevaluasiakanmenelurkanbeberapaganjaranbaikbersifat positifmaupunnegatif(hukuman).Jikapenilaianbersifatpositifsesuaidengan UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukapertimbanganpegawai,makaakanmemunculkandoronganuntukmemenuhi kebutuhannya. Adapun indikator (tanda) orang-orang yang mengejar kebutuhan berprestasi adalah: menguasai berbagai keahlian, prestasi kerja yang maksimal, perasaan senang jika jika berhasil dalam bekerja, Bertingkah laku giat memiliki prestasi, Kemajuan dalam karier, Hubungan antara pimpinan dan bawahan, sistem pembinaan dan pelatihan 2.The Need for Authority and Power (n-pow) Kebutuhan akan kekuasaan. RamlanSubakti,wakilketuaKPU2002-2007memandangkekuasaansebagai kemampuanmempengaruhi pihaklain untuk berfikir dan berprilaku sesuai kehendak yangmempengaruhi. Menurut Betrand Russel seorang filosof dariinggris kekuasaan adalah konsep dasar ilmu sosial. Kekuasaan penting dalam kehidupan organisasi dan bahwa kekuasaan dalam organisasi terikat dengan status seseorang. DemikianjugayangdiungkapkanolehProf.MariamBudiarjokekuasaanadalah kemampuanuntukmempengaruhitingkahlaku.SedangkanmenurtMaxwaber kekuasaanadalahkemungkinanyangmembuatseseorangdidalamsuatuhubungan sosialberadadalamsuatujabatanuntukmelaksanakankeinginannyasendiridan menyingkirkan segala halangan yang melintas didepannya. Konsep-konsepkekuasaanyangdikemukakanolehparaahlimelahirkanbentuk-bentuk kekuasaan berikut ini : a.Kuasapaksaan(Corvice P ower)yangberkuasamampumenghukumseseorang yang tidak melakukan perintah b.Reward Power, yang diberi order melakukan sesuatu yang dapat tunduk bila diberi imbalan. c.Ligitimative Power, seseorang penguasa akan menuntut bawahan pengikutnya agar taat padanya. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukad.Expert Power, seseorang yang bekerja memang memiliki keahlian luar biasa dalam bidangnya. e.Referant P ower,sangpenguasamemilikikarismasehinggapengikutnyaingin menjadi seperti dia dan melakukan apasaja untuknya. Dengandemikiankebutuhanakekuasaanselaludikejaragarseseorangingin mendapatjabatan.Adapunindikator(tanda)orang-orangyangmengejarkebutuhan kekuasaan adalah Kemampuan mempengaruhi pihak lain,Menunjukkantingkah laku kepadapemimpin,Melakukanpendekatanmanusiawi,Berusahadekatkepada pimpinan, Membuka jaringan kepada semua pihak. 3.The Need for Affiliation (N-affil) Kebutuhan akan Afilasi/Keanggotaan. Dalam kehidupan sehari-hari manusia selalu merasa kekurangan, tidak sempurna, ketiadaandansebagainya,sehinggamerusakkesejahteraannya.Keadaanyang dirasakan tersebut merupakan suatu bentuk kebutuhan yang ingin dipenuhi oleh setiap individuselamarentangkehidupannya.Perasaankekuranganyangdirasakanbisa bersifatfisiologis,sepertikebutuhanakanmakanan,atauyangbersifatpsikologis seperti harga diri dan yang bersifat sosiologis, seperti aktualisasi diri dan afiliasi. Maslow(dalamKoeswara,1991)mengatakanbahwamanusiasebagaimakhluk yang tidak pernah berada dalam keadaan sepenuhnya puas. Bagi manusia kepuasan itu sifatnyasementara,jikasuatukebutuhantelahterpuaskanyanglainakanmuncul menuntutkepuasan,begituseterusnya.Berdasarkanciriyangdemikian,Maslow mengajukan gagasan bahwa kebutuhan pada manusia adalah bawaan, tersusun menurut tingkatanataubertingkat,dengankebutuhandasarfisiologissebagaikebutuhan pertama, lalu seterusnya diikuti oleh kebutuhan akan rasa aman, kebutuhan akan cinta dan memiliki, kebutuhan akan rasa harga diri.Kebutuhan fisiologis dan rasa aman jika relatif sudah terpuaskan, maka kebutuhan sosialuntukjadibagiandarikelompoksosialdancintamunculmenjadikebutuhan UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukayang dominan. Orang sangat peka dengan kesedihan, pengasingan, ditolak lingkungan dankehilangansahabatataucinta.Kebutuhansosialiniteruspentingsepanjang kehidupan manusia, mulai dari dalam kandungan sampai akhir hayat.Kebutuhanuntukmelakukaninteraksidenganoranglaindikenaldengankonsep kebutuhanafiliasi.Kebutuhanaffiliasiadalahsuatuistilahyangdipopulerkanoleh David McClelland, ia menguraikan bahwa kebutuhan afiliasi adalah suatu kebutuhan dari seseorang untuk merasakan suatu perasaan terlibat dan ikut serta di dalam suatu kelompoksosial.Orang-orangdengankebutuhanafiliasiyangtinggimendambakan suatu hubungan antar pribadi yang hangat. Kebutuhan afiliasi adalah hasrat untuk disukai dan diterima baik oleh orang-orang lain(dalamRobbins,1996).Stanley(dalamGellerman,1984)menyatakanbahwa, afiliasimerupakankeinginanuntukbersatudenganoranglaintanpamemperdulikan apapun kecuali kebersamaan yang jelas dapat diperoleh. McClelland (dalam As'ad, 1998) mengatakan bahwa kebutuhan afiliasi merupakan kebutuhanakankehangatandansokongandalamhubungannyadenganoranglain. Kebutuhaninimengarahkan tingkahlakuuntukmengadakanhubungan secara akrab dengan orang lain. Afiliasiadalahsuatubentukkebutuhanakanpertaliandenganoranglain, pembentukan persahabatan, ikut serta dalam kelompok-kelompok tertentu, kerja sama dankooperasi(Chaplin,2002).AfiliasimenurutPoerwadarwinta(1986),adalah penggabungan, perkaitan, kerja sama, penerimaan sebagai anggota. MenurutMurray(dalamHalldanLindzey,1993),kebutuhanafiliasiadalah mendekatkandiri,bekerjasamaataumembalasajakanoranglainyangbersekutu (oranglainyangmenyerupaiataumenyukaisubjek),membuatsenangdanmencari afeksi dari objek yang disukai, patuh dan setia kepada seorang kawan. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaKebutuhan akan kehangatan dan dukungan dalam hubungannya dengan orang lain, dimana kebutuhan ini mengarahkan tingkah laku untuk mengadakan hubungan secara akrab dengan orang lain merupakan bentuk dari kebutuhan berafiliasi. Budiardjodkk.(dalamListiana,2002)menjelaskankebutuhanafiliasisebagai formasi hubungan sosial, keinginan untuk bergabung, beramah-tamah dan membentuk persahabatan.Orang-orangyangmemilikikebutuhanyangtinggiuntukberafiliasi biasanyamemilikikesenangandarikasihsayangdancenderungmenghindari kekecewaankarenaditolakolehsuatukelompoksosial.Secaraindividu,mereka cenderungberusahamembinahubungansosialyangmenyenangkan,rasaintimdan pengertian. Berdasarkan pendapat para ahli tersebut, maka dapat disimpulkan bahwa kebutuhan berafiliasiadalahsuatukebutuhanuntukmembentukhubungansosialsecarahangat, memelihara,mengembangkanhubunganafeksiyangpositifdanmemperbaiki hubungan sosial dengan orang lain, sehingga individu memiliki kebutuhan afiliasi yang tinggi akan cenderung untuk menghindari kekecewaan karena ditolak dalam kelompok sosial, serta berusaha membina hubungan sosial yang menyenangkan dan positif. MenurutMaslow(T.HaniHandoko:2003:258) kebutuhanafilasi(sosial)adalah kebutuhan akan rasa diakui, diterima oleh masyarakat, cinta mencintai, rasa memiliki, persahabatan,diterimadalamkelompok,kekeluargaan,asosiasi.Adapuntanda (indikator) orang-orang yang mengejar kebutuhan afiliasi atau sosial adalah Perasaan terlibatdengankelompok,Diterimaolehoranglain,Dukungandarioranglain, Persahabatan,Mendekatkandiridanbekerjasama,Mencarikontak-kontaksosial, Berusaha membentuk kelompok sosial, Tidak bekerja secara individual. a.Disiplin Kerja Dalam melaksanakan disiplin kerja, disiplin yang baik dapat diukur dalam wujud pimpinan atau pegawai datang dan pulang kantor tepat pada waktu yang ditentukan, UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukamenghasilkanpekerjaanbaikkuantitasmaupunkualitasyangmemuaskan, melaksanakan tugas dengan penuh dengan semangat, memenuhi peraturanyang ada.HaltersebutsesuaidenganpendapatM.Sinunganyangmenyatakandisiplinadalah sikapkewajibandariseseorangataukelompokataukelompokorangsenantiasa berkehendakuntukmengikutiataumematuhisegalaaturankeputusanyangtelah ditetapkandandisiplinjugadapatdikembangkanmelaluilatihanantaralaindengan bekerja, menghargai waktu (Sinungan, 1991:115). Disiplincenderungdiartikansebagaihukumandalamartisempit,namun sebenarnyadisiplinmemilikiartiyanglebihluasdarihukuman.MenurutMoekijat (2005;64), "Disiplin adalah kesanggupan menguasai diri yang diatur". Disiplin berasal dari bahasa latin, yaitu diciplina yang berarti latihan atau pendidikan, kesopanan dan kerohanian serta pengembangan tabiat. Disiplin menitik beratkan pada bantuan kepada pegawai untuk mengembangkan sikap yang baik terhadap pekerjaan. Disiplin pegawai yangbaikakanmempercepat tercapainyatujuanorganisasi,sedangkandisiplinyang rendah akan menjadi penghalang dan memperlambat pencapaian tujuan organisasi. Menurut Singodemejo (2002:98)"Disiplinadalahsikapkesediaandankerelaanseseoranguntukmemahamidan mentaati norma-norma peraturan yang berlaku disekitarnya". Dalam kaitannya dengan pekerjaan, Nitisemito (2001:71) menyatakan:"Disiplinkerjamerupakansuatusikap,tingkahlakudanperbuatanyangsesuai dengan peraturan dari organisasi baik tertulis maupun tidak tertulis". MenurutSiswanto(2006:32)disiplinkerjasebagaisuatusikapmenghormati, menghargai,patuhdantaatterhadapperaturan-peraturanyangberlakubaikyang tertulismaupuntidaktertulissertasanggupmenjalankannyadantidakmengelak menerimasanksi-sanksiapabilaiamelanggartugasdanwewenangyangdiberikan kepadanya. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaDaribeberapapengertiandiatas,dapatdisimpulkanbahwadisiplinadalah merupakancerminanbesarnyatanggungjawabseseorangdalammelakukantugas-tugasyangdiberikankepadanyayangmendoronggairahdansemangatkerja seseorang. Pada umumnya disiplinyang baik apabila pegawai datang ke kantor atau perusahaandenganteraturdantepatwaktu.Merekaberpakaianbaikpadatempat bekerja.Merekanmenggunakanbahan-bahandanperlengkapandenganhati-hati. Mereka menghasilkan jumlah dan kualitas pekerjaan yang memuaskan dan mengikuti carakerjayangditentukanolehperusahaandanmenyelesaikandengansangatbaik (Hasibuan, 2000:190). PentingnyaperanandisiplinjugadikemukakanolehMusnef(1994:116)yang berpendapat bahwa: "Disiplinjugatidakkalahpentingnyadenganprinsip-prinsiplainnyaartinya disiplinsetiappegawaiselalumempengaruhihasilprestasikerja.Olehsebabitu dalamsetiaporganisasiperluditegaskandisiplinpegawai-pegawainya.Melalui disiplin yang tinggi produktivitas kerja pegawai pada pokoknya dapat ditingkatkan. Olehsebabituperluditanamkankepadasetiappegawaidisiplinyangsebaik-baiknya". Disiplin kerja adalah yang memberikan dorongan atau yang menyebabkan pegawai untukberbuatdanmelakukansemuakegiatansesuaiaturanataunorma-normayang telahditetapkan(Ig.Wursanto,1989:108).SelanjutnyaSunTzudalamTriguno (2000:50)menyatakanbahwasegalasesuatuitutidakakanadaartinyajikatidak disiplin oleh para pelaksananya. Disiplinkerjadibutuhkanuntukmenjagaagarprestasikerjapegawaimeningkat. Siagian(2008:53)menyatakanterdapatduajenisdisiplindalamorganisasi,yaitu disiplin preventive dan disiplin korektif. Untuk mengetahui pengertian lebih jelasnya mengenai dua jenis disiplin tersebut dapat diuraikan sebagai berikut ini: 1.Disiplin Preventif Disiplin yang bersifat preventif adalah tindakan yang mendorong para pegawai taat kepada berbagai ketentuan yang berlaku dan memenuhi standar yang telah ditetapkan. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaArtinya melalui kejelasan dan penjelasan tentang pola, sikap, tindakan dan prilaku yang dinginkandarisetiapanggota organisasidiusahakanpencegahanjangansampaipara pegawai berperilaku negative. Keberhasilan penerapan disiplin preventif terletak pada pribadi para anggota organisasi. Agar disiplin pribadi tersebut semakin kokoh, paling sedikit tiga hal perlu mendapatkan perhatian manajemen yaitu: 1)Para anggota organisasai perlu didorong agar mempunyai rasa memiliki organisasi, karena secara logika seseorang tidak akan merusak sesuatu yang menjadi miliknya. 2)Para pegawai perlu diberi penjelasan tentang berbagai ketentuan yang wajib ditaati danstandaryangharusdipenuhi.Penjelasanyangdimaksudseyogianyadisertai informasi yang lengkap mengenai latar belakang berbagai ketentuan yang bersifat normative. 3)Parapegawaididorongmenentukansendiricara-carapendisiplinandiridalam rangka ketentuan-ketentuan yang berlaku umum bagi seluruh anggota organisasi. 2.Disiplin korektif Disiplinyangbersifatkorektifadalahjikapegawainyata-nyatatelahmelaukan pelanggaran atas ketentuan-ketentuan yang berlaku atau gagal memenuhi standar yang telahditetapkan,kepadanyadikenakansanksidisipliner.Beratatauringannyasuatu sanksitentunyatergantungpadabobotpelanggaranyangtelahterjadi.Pengenaan sanksibiasanyamengikutiproseduryangsifatnyahirarki,artinyapengenaansanksi diprakarsaiolehatasanlangsungpegawaiyangbersangkutan,diteruskankepada pimpinan yang lebih tinggi dan keputusan akhir pengenaan sanksi tersebut diambil oleh pejabatpimpinanyangberwenanguntukitu.Prosedurituditempuhdengandua maksud,yaitubahwapengenaansanksidilakukansecaraobjektifdansifatsanksi sesuai dengan bobot pelanggaran yang dilakukan. Menurut Siagian (2008:47), bentuk disiplin yang baik akan tercermin pada suasana: 1)Tingginya rasa kepudilian pegawai terhadap pencapaian tujuan perusahaan UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka2)Tingginya semangat dan gairah kerja dan inisiatif para pegawai dalam melakukan pekerjaan 3)Besarnyarasatanggungjawabparapegawaiuntukmelaksanakantugasdengan sebaik-baiknya 4)Berkembangnya rasa memilki dan solidaritas yang tinggi di kalangan pegawai 5)Meningkatkan efisiensi dan prestasi kerja pegawai. Disiplinadalahmerupakancerminanbesarnyatanggungjawabseseorangdalam melakukantugas-tugasyangdiberikankepadanyayangmendoronggairahdan semangat kerja seseorang. Pada umumnya disiplin yang baik apabila pegawai datang kekantoratauperusahaandenganteraturdantepatwaktu.Merekaberpakaianbaik padatempatbekerja.Merekanmenggunakanbahan-bahandanperlengkapandengan hati-hati. Merekamenghasilkanjumlah dan kualitas pekerjaanyangmemuaskan dan mengikuticarakerjayangditentukanolehperusahaandanmenyelesaikandengan sangat baik (Hasibuan, 2000:190). PentingnyaperanandisiplinjugadikemukakanolehMusnef(1994:116)yang berpendapat bahwa: "Disiplin juga tidak kalah pentingnya dengan prinsip-prinsip lainnya artinya disiplin setiap pegawai selalu mempengaruhi hasil prestasi kerja. Oleh sebab itu dalam setiap organisasiperluditegaskandisiplinpegawai-pegawainya.Melaluidisiplinyang tinggi produktivitas kerja pegawai pada pokoknya dapat ditingkatkan. Oleh sebab itu perlu ditanamkan kepada setiap pegawai disiplin yang sebaik-baiknya". Disiplin kerja adalah yang memberikan dorongan atau yang menyebabkan pegawai untukberbuatdanmelakukansemuakegiatansesuaiaturanataunorma-normayang telah ditetapkan (Ig.Wursanto,1989:108). SelanjutnyaSunTzudalamTriguno(2000:50)menyatakan:"Bahwasegala sesuatu itu tidak akan ada artinya jika tidak disiplin oleh para pelaksananya". Menurut Keit Davis dan John W.Newtsone disiplin mempunyai 3 sifat yakni: UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka1)Preventif,artinyatindakantersebutmempunyaitujuanpokokyaitumendorong sumber daya manusia agar memiliki disiplin yang tinggi. 2)Korektif, artinya tindakan dilakukan setelah terjadi pelenggaran yang tinggi. 3)Progresif,artinyatindakandisiplinberupahukumanberatdenganmaksuduntuk memperbaiki sebelum hukuman lebih berat dijatuhkan. Haltersebutmerupakantindakan-tindakandidalamupayamencapaitujuan organisasiyaitumencapaikualitasataukeberhasilan(Triguno,2002:59).Menurut Saydim (1996:286-287) menjelaskanbentuk disiplin kerjayang baik tergambar pada suasana : 1)Tingginya rasa kepedulian pegawai terhadap pencapaian tujuan perusahaan. 2)Tingginya semangat dan gairah kerja dan inisiatif para pegawai dalam melakukan pekerjaan. 3)Besarnyarasatanggungjawabparapegawaiuntukmelaksanakantugasdengan sebaik-baiknya. 4)Berkembangnya rasa memiliki dan rasa solidaritas yang tinggi dikalangan pegawai. 5)Meningkatnya efisiensi dan produktifitas para pegawai. Sementara itu kelemahan disiplin kerja pegawai terlihat pada suasana kerja sebagai berikut: a)Tingginya angka absensi pegawai. b)Seringnya terlambatnya pegawai untuk masuk kantor atau pulang lebih cepat dari jam yang sudah ditentukan. c)Menurunnya semangat dan gairah kerja. d)Berkembangnya rasa tidak puas, saling curiga dan saling melempar tangung jawab. e)Penyelesaianpekerjaanyanglambatkarenapegawailebihsenangmengobrol daripada kerja. f)Tidak terlaksanaya supervise dan waskat yang baik. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukag)Sering adanya konflik antara pegawai dan pimpinan perusahaan. AdapuncontohpelaksanaandisiplinkerjayangbaikmenurutStraus(1985:214) adalah sebagai berikut: 1)Masuk kerja tepat waktu. 2)Mentaati intruksi kerja dari supervisor. 3)Menghindari perkelahian, mabuk dan pencurian. 4)Mencetakkan jam kerja pada waktu hadir. Begitu pula I.C. Wursanto (1985:135), menyatakan bahwa kinerja yang tinggi dan disiplin yang tinggi akan diperoleh apabila para pegawai terpenuhi kebutuhannya. Pada hakekatnya disiplin terdiri dari beberapa unsuryaitu : 1)Pengetahuan tentang pekerjaan yang harus dilakukan. 2)Kesadaranbahwadisampingindividuadalahsebagaiorangdipercayauntuk melaksanakantugasdankewajibansehinggamempunyairasasaling tanggungjawab. 3)Ketaatandankepatuhanterhadapsegalaperaturandanketentuan-ketentuanyang berlaku. 4)Ketertibandalammelaksanakanapayangharusdikerjakansehinggadapat dihindarai penyimpangan-penyimpangan yang mungkin terjadi. 5)Inisiatifdalammenyajikanapayangharusdikerjakansehinggadihindari penyimpangan-penyimpangan yang mungkin terjadi. 6)Inisiatifyangmenunjangkelancaranpelaksanaantugas-tugas,sehinggatidak melakukan seperti halnya melakukan pola kerja hanya itu-itu saja. 7)Rasa senang hati, tidak terpaksa dan dipaksa. 8)Dilaksanakannya sanksi yang sungguh-sungguh (WS.Widodo, 1980:60). Dalamdisiplinkerja,kesadaranadalahintidalammelaksanakanaturankerja sehinggadidalampelaksanaanaturanadatanggapanpositifdariparapegawai, UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukamelaksanakantugasdenganpenuhrasapatuh,tertibdanpenuhrasatangungjawab tanpa ada beban terpaksa (Juhro, 1978:38). Disiplinbilasudahmenyatudengandirinya,makasikapatauperbuatanyang dilakukanbukanlagiatausamasekalitidakdirasakansebagaibeban,bahkanakan sebaliknya akan membebani dirinya bilamana ia tidak berbuat sebagaimana mestinya. Dengandemikiandisiplinkerjaseseorangdalambekerjamerupakansikapatau perlakuan ketaatan, ketertiban, tanggungjawab danloyalitas pegawai terhadap segala tatatertibyangberlakudlanorganisasi.Bilapegawaibertindakatauberbuatsesuai dengankeinginanorganisasimakaperaturanitumenjadiefektif.Disiplinkerjabila pegawai datang tepat waktu, mempergunakan alat kantor dengan rasa tanggungjawab, hasilpekerjaanmemuaskandanbilabekerjadengansemangattinggi(Laterner, 1983:71). Dede hasan (2002:66) merumuskan indikator disiplin kerja adalah sebagai berikut: 1)Melaksanakan dan menyelesaikan tugas tepat pada waktunya 2)Bekerja dengan penuh kreatif dan inisiatif 3)Bekerja dengan jujur, semengat dan penuh tanggung jawab 4)Datang dan pulang tepat pada waktunya 5)Bertingkah laku sopan SedangkanmenurutGuntur(1996:67)yangtermasukdalamdisiplinkerja mempunyai tiga demensi disiplin yaitu: 1)Disiplin waktu Disiplinwaktudisinidiartikansebagaisikapatautingkahlakuyang menunjukkan ketaatan terhadap jam kerja yang meliputi: kehadiran dan kepatuhan pegawaipadajamkerja,pegawaimelaksanakantugasdengantepatwaktudan benar. Orang-orangyangdisiplin terhadap waktu tercermin dariindikator (tanda) yaitu:Kepatuhanpegawaipadajamkerja.,Ketepatanmenyelesaikanpekerjaan, UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaTidakmengulur-ulurwaktu,Memilikijadwalkerja,Memilkikomitmen, Mengevaluasi jam kerja. 2)Disiplin peraturan Peraturan maupun tata tertib yang tertulis dan tidak tertulis dibuat agar tujuan suatu organisasi dapat dicapai dengan baik. Untuk itu dibutuhkan sikap setia dari pegawai terhadap komitmen yang telah ditetapkan tersebut. Kesetian disini berarti taat dan patuh dalam melaksanakan perintah dari atasan dan peraturan, tata tertib yangtelahditetapkan.Sertaketaatanpegawaidalammenggunakankelengkapan pakaianseragamyangtelahditentukanorganisasiataulembaga.Pegawaiyang memilikidispilinterhadapperaturanmemilikitandayaitu:kepatuhanpada peraturan/tatatertibyangada,kepatuhanpegawaiterhadapinstruksidariatasan, menggunakan kelengkapan pakaian seragam sesuai dengan ketentuan yang berlaku, melaksanakanperaturandenganbaik,penerapansanksi,memilikiketegasan, mengevaluasi peraturan. 3)Disiplin tanggung jawab Salahsatuwujudtanggungjawabpegawaiadalahpenggunaandan pemeliharaanperalatanyangsebaik-baiknyasehinggadapatmenunjangkegiatan kantorberjalandenganlancer.Sertaadanyakesanggupandalammenghadapi pekerjaan yan menjadi tanggung jawabnya sebagai seorang pegawai. PadademensidesiplinmenggunakanindikatoryangtelahdiutarakanGuntur (1996:67)karenaditemukankecocokandenganfenomenadilapanganyaitudari demensidisiplinwaktumeliputikehadirandankepatuhannpegawaipadajamkerja, demensi disiplin peraturan yaitu tata tertib peraturan dan pada disiplin tanggung jawab terlihat pada penggunaan dan peralatan kerja. Pegawai yang memiliki disipilin terhadap tanggungjawabtampakdari:Menggunakanfasilitasperalatankerjasesuaiprosedur kerja yang telah ditentukan, Memelihara fasilitas/peralatan kerja sesuai prosedur kerja UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukayangtelahditentukan.Tidakmenghindardaritanggungjawab, Mempertangungjawabkan pekerjaannya, Konsisten dengan waktu dan Tidak merugikan jam kerja orang lain. b.Penelitian Sebelumnya Penelitian mengenai pengaruh motivasi terhadap disiplin kerja pegawai khususnya padaDinasKesehatanKabupatenBintanbelumpernahdilakukanolehpenelitilain. Beberapa Peneliti pernahmelakukan penelitianyangberkaitan denganmotivasi, dan disiplin kerja pegawaiyang hampir mirip dengan penelitian ini antara lain: 1.Anggawanahasan(2005),denganjudul:"PengaruhMotivasiTerhadapDisiplin Kerja Karyawan PT.PLN (Persero) Distribusi J awa Barat dan Banten. Penelitian ini berbeda dalam hal: 1)Lokasi penelitian di Jawa Barat dan Banten. 2)PenelitiandilakukanterhadapkaryawanPT.PLN(Persero)DistribusiJawa BaratdanBanten,analisisyangdigunakanadalahKoefisienkorelasiRank SpearmandenganmetodedeskriptifdenganmenggunakantioriAbraham Maslow. 3)Hasil penelitian didapatkan adanya pengaruh yang kuat antara motivasi dengan disiplin kerja karyawan berdasarkan perhitungan uji hipotesis diperoleh thitung >ttabel1.Windi Rizki Adi (2011), dengan judul : "Pengaruh Motivasi dan Kepuasan Kerja terhadap Disiplin Kerja Karyawan Kusuma Agrowisata Hotel Batu" yaitu5,849>1,701sehinggaberadapadadaerahpenolakanHoyang artinya bila Ho terima maka Hi ditolak, dan begitu pula sebaliknya. Oleh karena ituhipotesisyangdiajukanjikamotivasiterhadapkaryawandiberikansecara efektif maka disiplin karyawan akan meningkat. Penelitian ini berbeda dalam hal : 1)Lokasi penelitian di Kusuma Agrowisata Hotel Batu - Malang. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka2)PenelitiandilakukanterhadapkaryawanKusumaAgrowisataHotelBatu,menggunakan pendekatan survey. Keseluruhan data kualitatif akan diuji dengan regresi liner berganda dengan menggunakan SPSS Windows. 3)HasilpenelitiandidapatkanvariabelMotivasi(X1c. Yuli Wardani (2010), dengan judul : "Pengaruh Pengawasan Melekat dan Motivasi Terhadap disiplin Kerja Karyawan PT. Bank Jatim Surabaya". memilikinilaithitung=3.303;nilaisignifikansi0,002< 0,05makahipotesisyangberbunyiada pengaruh positif yang signifikan motivasi kerja (XI) terhadap disiplin kerja (Y) diterima.Penelitian ini berbeda dalam hal : 1)Lokasi Penelitian di PT. Bank Jatim surabaya 2)Penelitian dilakukan terhadap karyawan PT. Bank Jatim surabaya, penelitian ini menggunakanmetodeanalisiskoefisienkorelasispermanrankdengan menggunakan 140 responden sebagai sampel. 3)Hasilpenelitiandidapatkanbahwahasilkoefisienkorelasispermenrank diperolehsebesar0,4657125dimanahasiltersebutsetelahdikonsultasikan dengan tabel pedoman untuk memberikan interprestasi koefisien korelasi, hasil tersebut terletakantara0,40-0,599yangmenunjukkanbahwaantaramotivasi dengan disiplin kerja karyawan terdapat korelasi atau hubungan yang sedang. Sedangkanujideterminasimenunjukkanbahwamotivasiberpengaruhpositif dansignifikanterhadapdisiplinkerjakaryawanPT.BankJatimSurabaya sebesar21,69%.Berdasarkanhasilujihipotesisdenganmenggunakanujit diperoleh nilai t hitung sebesar 6,1822352. Menurut kriteria pengujian hipotesis t hitung lebih besar dar t tabel hal ini menunjukkan bahwa ada pengaruh yang signifikanantaramotivasiterhadapdisiplinkerjakaryawanPT.BankJ atim Surabaya. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka B. Kerangka BerpikirSebagaimanatelahdipaparkandiatas,makasecararingkasdalampenelitianini dapat digambarkan sebuah bagan kerangka berpikir sebagai berikut : Gambar 2.2 Kerangka Pemikiran

Sumber : Variabel motivasi : David Mclelland (1987:261), variabel Disiplin kerja oleh : Guntur (1996:67) DariGambar2.2diatasjikadijelaskanbahwayangfaktor-faktormotivasikerja yangmempengaruhidisiplinkerjadiantaranya:Kebutuhanprestasi,kebutuhan kekuasaan,dankebutuhanafiliasi.Variabel-variabelpadamotivasikerjatersebut merupakan variabel bebas atau variabel independent, sedangkan yang menjadi variabel terikatatauvariabeldependenadalahdisiplinkerja.Variabeldisiplinkerjameliputi disiplin waktu, disiplin peraturan, dan disiplin tanggung jawab. C. Definisi Operasional Definisioperasionaladalahdefinisiyangbersifatmemberikanartikepadasuatu variabeldenganmenetapkankegiatanatautindakanyangperluuntukmengukur variabel tersebut. Definisi operasional ini akan memberikan batasan atau ciri-ciri suatu variabel denganmerincihal-halyang harus dikerjakan oleh peneliti untuk mengukur variabel tersebut. Jadi dalam definisi operasional ini harus dirinci ciri-ciri yang akan diteliti dan bagaimana mengamatinya. Berikut ini penjelasan definisi operasional dari penelitian ini: Motivasi Kerja (X) Kebutuhan Prestasi (Xa) Kebutuhan Kekuasaan (Xb) Kebutuhan Afilasi (Xc) Disiplin Kerja (Y)Disiplin Waktu (Ya) Disiplin Peraturan (Yb) Disiplin Tanggungjawab (Yc) UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka1.Motivasiadalahsuatudorongankehendakyangmempengaruhiperilakutenaga kerja, untuk berusaha meningkatkan kinerja karena adanya suatu keyakinan bahwa peningkatankinerjamempunyaimanfaatbagidirinya.Mclelland(1987:261) menguraikansecararingkasdemensi-demensiyangmelatarbelakangimotivasi seseorang : a.The Need for Achievement (n-ach) atau Kebutuhan akan prestasi/pencapaian. Kebutuhan akan prestasi adalah kebutuhan seseorang untuk memiliki pencapian signifikan,menguasaiberbagaikeahlian,ataumemilkistandaryangtinggi. Orang memiliki n-ach yang tinggi biasanya selalu ingin menghadapi tantangan baru dan mencari tingkat kebebasan yang tinggi. b.The Need for Authority and Power (n-pow) atau Kebutuhan akan kekuasaan. Kebutuhaninididasariolehkeinginanseseoranguntukmengaturdan memimpinoranglain.MenurutMclelland,adaduajeniskebutuhanakan kekuasaan, yaitu pribadi dan sosial. c.The Need for Affiliation (n-affil) atau Kebutuhan akan Afiliasi/keanggotaan. Kebutuhaniniadalahkebutuhanyangdidasariolehkeinginanuntuk mendapatkan ataumenjalankan hubunganyangbaikdengan oranglain orang merasa ingin disukai dan diterima oleh orang lain. 2.Disiplinkerjamerupakansuatusikap,tingkahlakudanperbuatanyangsesuai denganperaturandariorganisasibaiktertulismaupuntidaktertulis.Guntur (1996:67) menguraikan dimensi yang mempengaruhi disiplin kerja yaitu : a.Disiplin waktu Disiplinwaktudisinidiartikansebagaisikapatautingkahlakuyang menunjukkanketaatanterhadapjamkerjayangmeliputi:kehadirandan kepatuhan pegawai pada jam kerja, pegawai melaksanakan tugas dengan tepat waktu dan benar.UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukab.Disiplin peraturan Peraturan maupun tata tertib yang tertulis dan tidak tertulis dibuat agar tujuan suatuorganisasidapatdicapaidenganbaik.Pegawaiyangmemilikidispilin terhadap peraturan memiliki tanda yaitu : Kepatuhan pada peraturan/tata tertib yangada,kepatuhanpegawaiterhadapinstruksidariatasan,menggunakan kelengkapanpakaianseragamsesuaidenganketentuanyangberlaku, melaksanakanperaturandenganbaik,penerapansanksi,memilikiketegasan, pengevaluasi peraturan. c.Disiplin tanggung jawab Salahsatuwujudtanggungjawabpegawaiadalahpenggunaandan pemeliharaanperalatanyangsebaik-baiknyasehinggadapatmenunjang kegiatankantorberjalandenganlancer.Sertaadanyakesanggupandalam menghadapipekerjaanyanmenjaditanggungjawabnyasebagaiseorang pegawai. C. HipotesisBerdasarkan hasil pengamatan terhadap fenomena, rumusan masalah dan kerangka konseptual penelitian, maka hipotesis penelitian adalah : 1.Adapengaruhyangsignifikanantarakebutuhanprestasiterhadapdisiplinkerja pegawai Dinas Kesehatan Kabupaten Bintan. 2.Ada pengaruh yang signifikan antara kebutuhan kekuasaan tehadap disiplin kerja pegawai Dinas Kesehatan Kabupaten Bintan.3.Adapengaruhyangsignifikanantarakebutuhanafiliasiterhadapdisiplinkerja pegawai Dinas Kesehatan Kabupaten Bintan.4.Adapengaruhyangsignifikanantaravariabelmotivasiyangmeliputikebutuhan prestasi, kekuasaan dan afiliasi secara parsial terhadap disiplin kerja pegawai Dinas Kesehatan Kabupaten Bintan. UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbuka UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaBAB III METODE PENELITIAN A.Desain Penelitian Desainpenelitianadalah r ancangan u mum t entangmetode-metode da n pr osedur-prosedur un tuk m engumpulkan da nmenganalisisinformasiyang d ibutuhkan.Rancangan pe nelitian a tau de sain pe nelitian d apat pul a d iartikan s ebagai s trategi mengaturlatar pe nelitian a gar pe nelitimemperoleh da tayangvalid s esuai de ngan karakteristik variabel dan tujuan penelitian. Rancangan penelitian yang akan digunakan dalam pe nelitianiniadalahmetode kua ntitatif de nganmembuatkue sioner, s ehingga data da lam pe nelitianini ada lah da ta kua ntitatif. D ata kua ntitatif ada lah da tayang berbentuk angka, seperti data yang berskala ukur interval dan rasional, kemudian diolah dengan statistik. B.Populasi dan Sampel Penelitian Populasi dalam suatu penelitian merupakan sekumpulan objek yang dapat dijadikan sumber penelitian yang berbentuk benda-benda, manusia ataupun peristiwa yang terjadi sebagai o bjekatausasaran pe nelitian. Halinisesuai de ngan pe ndapat Djarwanto,cs, (1988:95)yaitu: P opulasiadalahjumlah ke seluruhan o bjekyang k arakteristiknya hendak d idugayang t erdiri a tas: o byek/subyekyangmempunyai kua litas da n karekteristik t ertentuyang d itetapkan o leh pe neliti u ntuk d ipelajari d an ke mudian ditarik kesimpulannya. Populasi dari penelitian ini adalah seluruh pegawai yang bekerja pada Dinas KesehatanKabupaten Bintanyaitusebanyak 93orangsebagaimana yang disampakan o leh S ugiono ( 2003: 75)j ika po polasinyasedikitmaka s eluruhnya dijadikan sampel.UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaMengingat j umlah po pulasi d alam pe nelitianinisedikitmaka s eluruh po pulasi dijadikan s ampel. S ampel pe nelitianini d itentukan de nganmenggunakanmetode sensus. C.Variabel Penelitian Variabel penelitian digunakan dalam penelitian sebagai petunjuk untuk mencari data maupun segala informasi di lapangan. Dalam penelitian ini variabel yang diteliti dibagi menjadi 2, yaitu variabel dependen dan variabel independen. Variabel dependen adalah variabelyang a kan d iprediksiatau d ijelaskan, s edangkanvariabelindependen a dalah variabel (diperkirakan) mempengaruhi variabel dependen. Variabel independen (variabel X) pada penelitian ini adalah variabel motivasi kerja diuraikan menjadi dimensi-dimensi berikut ini: Xa = Kebutuhan Prestasi Xb = Kebutuhan Kekuasaan Xc = Kebutuhan afiliasiSementaraituyangmenjadivariabel dependen ( variabel t erikat/variabel Y) dalam penelitianini adalah disiplinkerja. Variabel dependen (Variabel Y) pada penelitianini adalahvariabel d isiplinkerja. D imensi d isiplin ke rja da pat d iuraikanmenjadi 3,meliputi: disiplin waktu (Ya), disiplin peraturan (Yb), dan disiplin tanggungjawab (YcD.Instrumen Penelitian ). Pengumpulan da tadilakukan de nganmenggunakanalat da lambentuk kue sioner yang d iisi o leh r esponden d ibuat da lambentuk pe rtanyaan/pernyataan, d imana da lam kuesioner s udah d isediakanalternatifjawabandari t iapitem p ernyataan. D alam pelaksanaan pe ngisian r esponden d imintauntukmemilihsalahsatujawaban y ang sekiranya cocok dengan keadaan yang dialami. Untuk mengetahui tanggapan responden UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukaterhadapdisiplinyang menyangkut motivasi s ertauntuk mempermudahpengambilan kesimpulan dari t anggapan pegawaiyang diperoleh dalam pembagian koesioner,maka digunakan skala Likertdengan 4 option. Alternatifjawaban disesuaikan dengan skalalikert yang dibuat menjadi 4 a lternatif jawaban.Skala l ikert melibatkan s erangkaianpertanyan y ang b erkaitandengan s ikap respondendimintamenyatakan "sangat baik" sampai padajawaban"tidakbaik" untuk setiap pertanyaan, jawaban diberi nilai yang akan merefleksikan secara konsisten sikap responden. Nilai total seluruh pertanyaan dihitung untuk setiap responden. Untuk setiap jawaban akan diberi skor 1 - 4 yang dapat dijelaskan sebagai berikut:1.Skor 1 untuk jawaban tidak baik2.Skor 2 untuk jawaban kurang baik3.Skor 3 untuk jawaban baik4.Skor 4 untuk jawaban sangat baikUntukmemastikan bahwaa latuku r yanga kand igunakanda lam pe nelitian memilikivaliditasda n reliabilitas,d ilakukan uj i coba skala motivasi dan disiplin kerja pe gawai. Data hasil kue sioner d iolah de nganmenggunakan pr ogram SPSS 18. 0 for windows. Untuk lebih jelasnya mengenai variabel, dimensi dan indikator yang digunakan dalam penelitian, Tabel 3. 1 berikutini akan menjelaskan kisi-kisi instrumen penelitian secara terperinci: UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaTabel 3. 1 Kisi-kisi Instrumen Penelitian NoVariabelDimensiIndikator Nomor Item 12345 1 Variabel Bebas Motivasi (X) David McCLelland (1987:261) 1.Kebutuhan Prestasi 2.Kebutuhan kekuasaan a.Menguasai berbagai keahlian b.Prestasi kerja yang maksimal c.Perasaan senang jika jika berhasil dalam bekerja d. Giat berupaya untuk berprestasi e.Kemajuan dalam karier f.Hubungan antara pimpinan dan bawahan g.Sistem pembinaan dan pelatihan a.Kemampuan mempengaruhi pihak lain b.Menunjukkantingkah laku yang baik kepada pemimpin c.Melakukan pendekatanManusiawi d.Berusaha dekat dengan pimpinan e.Membukajaringan ke pada semua pihak 1,2 3,4 5 6 7 8,9 10,11 12,13 14 15 16 17 3.Kebutuhan Afiliasi a.Perasaan terlibat dengan kelompok b.Diterima oleh orang lain c.Dukungan dari orang lain d.Persahabatan e.Mendekatkan diri dan bekerjasama f.Mencari kontak-kontak sosial g.Berusaha membentuk kelompok 18 19 20 21 22 23 UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukasosial h.Tidak bekerja dengan individu 24 25 2Variabel Tidak Bebas Disiplin Kerja Pegawai (Y) Guntur (1996-34-35) 1.Disiplin waktu a.Kepatuhan pe gawai pa dajam kerja. b.Ketepatan menyelesaikan pekerjaan c.Tidak mengulur-ulur waktu d.Memiliki jadwal kerja e.Memilki komitmen f.Mengevaluasi jam kerja 26,27 28 29 30 31 32 2.Disiplin peraturan a.Kepatuhan pa da pe raturan/tata tertib yang ada b.Kepatuhan pe gawai t erhadap instruksi dari atasan. c.Menggunakan kelengkapan pakainan seragam sesuai dengan ketentuan yang berlaku. d.Melaksanakan peraturan dengan baik e.Penerapan sanksi f.Memiliki ketegasan g.Mengevaluasi peraturan 33,34 35,36 37 38 39 40,41 42 3. Disiplin Tanggung jawab a.Menggunakan fasilitas peralatan kerja sesuai prosedur kerja yang telah ditentukan. b.Memelihara fasilitas/peralatan kerja sesuai prosedur kerja yang telah ditentukan. c.Tidak menghindar dari tanggungjawab d.Mempertangungjawabkan pekerjaannya. e.Konsisten dengan waktu f.Tidak merugikan jam kerja orang lain 43,44 45,46 47 48 49 50 Sumber : David Mclelland (1987:261), Guntur (1996:34-35) UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaE.Prosedur Pengumpulan Data 1.Jenis dan sumber data Jenis penelitianyang akan digunakan dalampenelitianini adalah t ipe eksplanatori. Dengan kata lain penelitian ini berusaha menjelaskan hubungan kausal antaravariabel-variabelmelalui pengujianhipotesis. Data yangdigunakan da lam pe nelitianini adalah data kua ntitatif. Data kua ntitatif ada lah da tayangberbentukangka, s eperti da tayang berskala ukur interval dan rasio. Adapun sumber data yang dipakai dalam penelitian ini diperoleh melalui: a.Data P rimer,yaitu da tayang d iperolehlangsung da ri r esponden de ngan c ara membagikan kuisioner selain itu penulis juga melakukan survey langsung ke Dinas Kesehatan Kabupaten Bintan tempat dimana penulis melakukan penelitian. b.Data S ekunder, y aitu da tayang d iperoleh de nganmelakukan s tudi ke pustakaan yang be rhubungandengan masalah y ang a kandikaji l ebih l anjut.Datasekunder diperoleh da ri r eferensi-referensi mis alnya da ri b uku-buku,internet, j urnal da n sumber-sumber l ainnya yangdapat menunjangpenelitian i ni.Dari bukudiperoleh teori-teori t entangmotivasi da n d isiplinkerja.Sementaraitu, t eori-teori t entang sejarah da n s trukturorganisasi d iperolehlangsung da ri k antor D inasKesehatan Kabupaten Bintan.2.Teknik Pengumpulan Data Cara pe ngumpulan da ta da lam pe nelitianini d ibagimenjadi 2cara,yaitumelalui studilapangan da n s tudi ke pustakaan. B erikut pe njelasan da ri ke dua t eknik pengumpulan data tersebut: a.Studi Lapangan (Field Research) Yaitu t eknik pengumpulan data dengan caramelakukan penelitian dan pengamatan secara langsung pada objek yang diteliti. Data tersebut penulis peroleh dengan cara : menyebarkan ku isioner un tuk d ijawab r esponden da n p ertanyaanitutelah UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukadipersiapkansebelumnya s ecara s istematis. Disampingitu untuk melakukan c ross cekdilapangan pe nelitimelakukan w awancara ke padabeberapa o rang, s eperti: temankerja,kepala s eksi da nkepala bi dang Dinas Kesehatan KabupatenBintan. Datayangdiperoleh s elanjutnya a kandigunakanuntuk m emperkuathasil u ji statistik. b.Studi Pustaka (Library Research) Yaitumengumpulkan da ta s ebagai r eferensi u ntuk melakukan pe nelitian de ngan mempelajari l iteratur-literatur ya ngberhubungandengan a spekpermasalahan da n menunjang pembahasan dalam pembuatan tesis ini. F.Teknik/Cara Analisis Data Setelah i ndikatoryang m enjadi ukur an m asing-masingvariabel d an t eknik pengukuranyang d igunakan d itentukan,makaditentukan t eknik a nalisis da tayang disesuaikan de ngan da tayangtersedia,A nalisis K uantitatif y aituanalisis y ang digunakan untukmengolah data, terutama data yang diperoleh melalui pertanyaan yang memerlukan pengukuran. Jika da ta t elah t erkumpul,selanjutnya d ibuat a nalisis da ta de ngancara t abulasi, yang t ermasukdalam ke giatanini a ntaralainmemberikanskor ( scoring) t erhadap jawaban r espondenmenurut ka idahyang t epat, ke mudianmenyajikan da ta t ersebut kedalamtabel m enurutkategori j awaban s ertamenghitung f rekuensi da ri m asing-masing kategori. Selain it u juga dilakukan uji statistik terhadap data yang diperoleh. Uji stastik tersebut meliputi hal-hal berikut ini: 1.Uji Validitas Validitasinstrumen pe nelitian a tautingkat ke tepataninstrumen pe nelitian a dalah tingkat ke mampuaninstrumen pe nelitian u ntuk mengungkapkan da ta s esuaidengan masalahyanghendak diungkapkannya (Singarimbun, 1995:124). Validitas pengukuran UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas Terbukaberhubungan dengan kesesuaian dan kecermatanfungsi ukur darialatyang digunakan. Dengan menggunakan i nstrumenpenelitian yang memiliki validitastinggi, maka hasil penelitian a kanmampumenjelaskanmasalah pe nelitian s esuai de ngan ke adaanyang sebenarnya. U jivaliditasini t erlebih da hulu di ujicobakan ke pada 30 o rang responden/sampel melalui kuisioner. Tinggi r endahnyavaliditassuatu angket dihitung de ngan t eknikKorelasi Product Moment Pearson dengan rumus: Keterangan : rxya.Jika r: Koefisien korelasi antara variabel x dan y n : Jumlah sampel x : Nilai total atribut y : Nilai dari variabelKriteria pengambilan keputusan menurut Arikunto (1993) adalah sebagai berikut:hitung > rtabel b.Jika rdan taraf signifikan 5%, berarti item (butir soal) pernyataan valid. hitung < rtabel Hasilpengujian v aliditas ma sing-masinginstrumen d apat d ilihat pa da T abel 3. 2 berikut ini : dan t araf signifikan 5%,berartiitem (butir soal) pernyataan t idak valid. rxy=

UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaTabel 3.2Hasil Pengujian Validitas Instrumen (rtabel Dimensi Kebutuhan Prestasi (X= 0,204) a) Butir r rhitung Keterangan tabel Butir 1 0,382 0,204Valid Butir 2 0,516 0,204Valid Butir 3 0,495 0,204Valid Butir 4 0,293 0,204Valid Butir 5 0,330 0,204Valid Butir 6 0,408 0,204Valid Butir 7 0,424 0,204Valid Butir 8 0,357 0,204Valid Butir 9 0,449 0,204Valid Butir 10 0,320 0,204Valid Butir 11 0,357 0,204Valid Dimensi Kebutuhan Kekuasaan (Xb) Butir r rhitung Keterangan tabel Butir 12 0,215 0,204Valid Butir 13 0,357 0,204Valid Butir 14 0,549 0,204Valid Butir 15 0,750 0,204Valid Butir 16 0,714 0,204Valid Butir 17 0,613 0,204Valid Dimensi Kebutuhan Afiliasi (Xc) Butir r rhitung Keterangan tabel Butir 18 0,608 0,204Valid UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaButir 19 0,686 0,204Valid Butir 20 0,699 0,204Valid Butir 21 0,639 0,204Valid Butir 22 0,684 0,204Valid Butir 23 0,518 0,204Valid Butir 24 0,479 0,204Valid Butir 25 0,413 0,204Valid Dimensi Disiplin Waktu (Ya) Butir 26 0,620 0,204Valid Butir 27 0,688 0,204Valid Butir 28 0,719 0,204Valid Butir 29 0,649 0,204Valid Butir 30 0,668 0,204Valid Butir 31 0,532 0,204Valid Butir 32 0,497 0,204Valid Dimensi Disiplin Peraturan (Yb) Butir 33 0,274 0,204Valid Butir 34 0,503 0,204Valid Butir 35 0,288 0,204Valid Butir 36 0,400 0,204Valid Butir 37 0,376 0,204Valid Butir 38 0,417 0,204Valid Butir 39 0,477 0,204Valid Butir 40 0,307 0,204Valid Butir 41 0,452 0,204Valid Butir 42 0,401 0,204Valid UNIVERSITAS TERBUKA13/40933Koleksi Perpustakaan Universitas TerbukaDimensi Disiplin Tanggung Jawab (Yc) Butir 43 0,323 0,204Valid Butir 44 0,642 0,204Valid Butir 45 0,466 0,204Valid Butir 46 0,288 0,204Valid Butir 47 0,283 0,204Valid Butir 48 0,372 0,204Valid Butir 49 0