kelas11 smk mtk sumadi

Click here to load reader

Post on 31-Jul-2015

365 views

Category:

Documents

4 download

Embed Size (px)

TRANSCRIPT

Bab6Hak Cipta pada Departemen Pendidikan NasionalDilindungi oleh Undang-UndangMatematikaKelasXISMK/MAK Kelompok Teknologi, Kesehatan, dan PertanianPenulis : Sumadi: Darno: Agus SuharjanaEditor : Alnurrizki Muthfisari: Hadi Karyanto: MiyantoPerancang Kulit : SugiyantaLayouter : Haryadi: Isti Nur Chasanah: Rini Suryani: Titik Nur HadiningsihIlustrator : Jumiyo: Muhamad Yusuf: P.C. Krisdiyanto: SuryonoUkuran Buku : 21 29,7 cmDiterbitkan oleh Pusat PerbukuanDepartemen Pendidikan NasionalTahun 2008Diperbanyak oleh ...Hak Cipta Buku ini dibeli oleh Departemen Pendidikan Nasional dari PenerbitSAKA MITRA KOMPETENSIii Copyright510.07SUMmSUMADIMatematika: Sekolah Menengah Kejuruan (SMK)/Madrasah AliyahKejuruan (MAK) Kelas XI Kelompok Teknologi, Kesehatan, danPertanian/Sumadi, Darno, Agus Suharjana; editor Alnurrizki Muthfisari,Hadi Karyanto, Miyanto.-- Jakarta: Pusat Perbukuan, DepartemenPendidikan Nasional, 2008.vi, 194 hlm.:ilus.; 29,7 cm.Bibliografi : hlm. 194Indeks. Hlm. 193ISBN 979-462-966-91. Matematika-Studi dan Pengajaran I. Judul II. DarnoIII. Suharjana, Agus IV. Muthfisari, Alnurrizki V. Karyanto, HadiVI. Miyantoiii Kata SambutanPuji syukur kami panjatkan ke hadirat Allah SWT, berkat rahmat dan karunia-Nya, Pemerintah, dalamhal ini, Departemen Pendidikan Nasional, pada tahun 2008, telah membeli hak cipta buku teks pelajaran inidari penulis/penerbit untuk disebarluaskan kepada masyarakat melalui situs internet (website) JaringanPendidikan Nasional.Buku teks pelajaran ini telah dinilai oleh Badan Standar Nasional Pendidikan dan telah ditetapkan sebagaibuku teks pelajaran yang memenuhi syarat kelayakan untuk digunakan dalam proses pembelajaran melaluiPeraturan Menteri Pendidikan Nasional Nomor 34 Tahun 2008.Kami menyampaikan penghargaan yang setinggi-tingginya kepada para penulis/penerbit yang telahberkenan mengalihkan hak cipta karyanya kepada Departemen Pendidikan Nasional untuk digunakan secaraluas oleh para siswa dan guru di seluruh Indonesia.Buku-buku teks pelajaran yang telah dialihkan hak ciptanya kepada Departemen Pendidikan Nasionalini,dapatdiunduh(download),digandakan,dicetak,dialihmediakan,ataudifotokopiolehmasyarakat.Namun, untuk penggandaan yang bersifat komersial harga penjualannya harus memenuhi ketentuan yangditetapkan oleh Pemerintah. Diharapkan bahwa buku teks pelajaran ini akan lebih mudah diakses sehinggasiswa dan guru di seluruh Indonesia maupun sekolah Indonesia yang berada di luar negeri dapat memanfaatkansumber belajar ini.Kami berharap, semua pihak dapat mendukung kebijakan ini. Kepada para siswa kami ucapkan selamatbelajar dan manfaatkanlah buku ini sebaik-baiknya. Kami menyadari bahwa buku ini masih perlu ditingkatkanmutunya. Oleh karena itu, saran dan kritik sangat kami harapkan.Jakarta, Juli 2008Kepala Pusat PerbukuanPercayakah kalian bahwa matematika adalah ilmu universal? Matematika dapat digunakan dalam bidangteknologi, kesehatan, dan pertanian. Mari kita ambil contoh tentang penggunaan bahan bakar sebuah mesintraktor. Mesin traktor mempunyai bahan bakar 40 liter solar pada tangkinya. Jika pada setiap 3 km solarberkurang 0,125 liter, tentukan sisa bensin pada tangki jika traktor berjalan sejauh 60 km.Penyelesaian:a = 0; b = 0,125; n = 60 : 3 = 20U20= a + 19 b= 0 + 19 0,125= 2,375S20= 10 + (a + U20)= 10 + (0 + 2,375)= 12, 375Solar yang digunakan untuk menempuh jarak 60 km adalah 12,375 liter. Sisa solar = 40 12,375 = 27,625.Jadi, sisa solar 27,625 liter.Teknik penyelesaian menggunakan matematika untuk bidang tertentu lainnya dapat kalian temui padapernik aplikasi dalam buku ini. Masih terdapat berbagai pernik, antara lain trik, info, tugas mandiri, tugaskelompok, diskusi, kilas balik, intisari, dan perlu tahu. Setiap pernik akan membantu kalian belajar matematikadengan mudah dan menyenangkan. Oleh karena itu, buku Matematika Kelompok Teknologi, Kesehatan, danPertanian Kelas XI ini mudah kalian pelajari. Jadi, tunggu apa lagi? Buka dan pelajari.Klaten, Juli 2008Penulisiv Kata PengantarKata Sambutan.................................................................................... iiiKata Pengantar .................................................................................... ivDaftar Isi ............................................................................................. vBab I TrigonometriKegiatan Belajar 1: Perbandingan Trigonometri ...................................................................... 2Kegiatan Belajar 2: Koordinat Cartesius dan Kutub ................................................................ 9Kegiatan Belajar 3: Aturan Sinus dan Cosinus........................................................................ 11Kegiatan Belajar 4: Luas Segitiga ........................................................................................... 16Kegiatan Belajar 5: Rumus Trigonometri Jumlah dan Selisih Dua sudut ................................. 18Kegiatan Belajar 6: Persamaan Trigonometri .......................................................................... 25Rangkuman.............................................................................................................................. 30Evaluasi Kompetensi .............................................................................................................. 33BabII FungsiKegiatan Belajar 1: Pengertian Relasi dan Fungsi .................................................................. 36Kegiatan Belajar 2: Fungsi Linear ........................................................................................... 42Kegiatan Belajar 3: Fungsi Kuadrat ......................................................................................... 49Kegiatan Belajar 4: Menerapkan Konsep Fungsi Kuadrat ....................................................... 53Kegiatan Belajar 5: Fungsi Eksponen ..................................................................................... 57Kegiatan Belajar 6: Fungsi Logaritma ..................................................................................... 60Kegiatan Belajar 7: Fungsi Trigonometri ................................................................................. 63Rangkuman.............................................................................................................................. 67Evaluasi Kompetensi .............................................................................................................. 69Bab IIIBarisan dan DeretKegiatan Belajar 1: Pola, Barisan, dan Deret Bilangan ...........................................................72Kegiatan Belajar 2: Barisan dan Deret Aritmatika ................................................................... 79Kegiatan Belajar 3: Barisan dan Deret Geometri ..................................................................... 83Rangkuman.............................................................................................................................. 88Evaluasi Kompetensi .............................................................................................................. 89v Daftar Isivi Daftar IsiBab IV Geometri Dimensi DuaKegiatan Belajar 1: Sudut ....................................................................................................... 92Kegiatan Belajar 2: Keliling dan Luas Bangun Datar ............................................................... 95Kegiatan Belajar 3: Transformasi Bangun Datar ..................................................................... 113Rangkuman.............................................................................................................................. 122Evaluasi Kompetensi .............................................................................................................. 124Bab V Geometri Dimensi TigaKegiatan Belajar 1: Bangun Ruang dan Unsur-unsurnya ......................................................... 128Kegiatan Belajar 2: Luas Permukaan Bangun Ruang .............................................................. 134Kegiatan Belajar 3: Volume Bangun Ruang ............................................................................ 140Kegiatan Belajar 4: Hubungan antara Unsur-Unsur dalam Bangun Ruang .............................. 144Rangkuman.............................................................................................................................. 150Evaluasi Kompetensi .............................................................................................................. 151BabVI VektorKegiatan Belajar 1: Vektor pada Bidang Datar ........................................................................ 154Kegiatan Belajar 2: Vektor pada Bangun Ruang ..................................................................... 173Rangkuman.............................................................................................................................. 183Evaluasi Kompetensi .............................................................................................................. 184Latihan Ulangan Kenaikan Kelas .......................................................... 186Glosarium............................................................................................ 192Indeks ................................................................................................. 193Daftar Pustaka ..................................................................................... 194MatematikaXISMK/MAK 1 MatematikaXISMK/MAK 1Sumber:www.wikipedia.comRobotBesarCanadarmSegitigasiku-siku?Tentuistilahinitelahkaliankenalsejakkecil.Jenissegitigainimemangpantasdipelajarisebabbangundatarinimemilikibanyakterapan.Tahukahkalianapasegitigasiku-sikuitu?Segitigasiku-sikuadalahsuatubangundataryangmemilikisisisebanyak3buahdengansalahsatusudutnya90. Perbandingan sisi-sisi pada segitiga siku-siku oleh bangsa Mesir danBabilonia dijadikan sebagai dasar ilmu selanjutnya, yaitu trigonometri.TrigonometrimerupakancabangilmuMatematikayangmelibatkanduabidangteori penting, yaitu teori bilangan dan geometri. Secara geometris, ilmutrigonometridikembangkanberdasarkanstudibintang-bintang.Trigonometrimemilikibanyakpenerapanpraktis,misalnyadalamteknikbangunandanarsitektur,digunakanuntukmengukurrangkaatapdansudutelevasi pada sebuah kawat penyangga jembatan. Pada ilmu pelayarantrigonometridigunakanuntukmenentukanposisikapalketikaberadadilautlepas. Selain hal-hal yang bisa dihitung secara nyata, trigonometri dapatdigunakanuntukmenghitungsesuatuyangmustahiluntukdilakukan,sepertimencari jarak dari suatu tempat ke suatu bintang atau ke suatu pulau dilautan. Salah satu kegunaan trigonometri yang paling modern adalahmenentukanposisiseorangastronautketikaberadadiluarangkasasepertipadagambardiatas.Haltersebutdilakukandengancaramenghitungbesarsudutyangdibentukolehlengansatelitterhadapposisisatelitketikamengorbit.Pembahasan lebih lanjut mengenai trigonometri serta rumus-rumus yangberlakudidalamnyaakankitapelajaripadababberikut.Trigonometri 2OxrBAyPerbandingan trigonometri untuksudutpadasegitigasiku-sikuOABdidefinisikansebagaiberikut.a. sinus =sin=yrb. cosinus =cos=xrc. tangen =tan=yxd. cosecan =csc=rye. secan =sec=rxf. cotangen =cot=xyBangun segitiga yang bermacam-macamukurannya memiliki perbandingan trigonometriyang sama antara satu dengan yang lain.Perbandinganyangtetapinidapatkitagunakanuntukmengukurtinggisebuahpohonatausuatubangunanyangbelumkitaketahui.Ajaklahsatuorang teman kalian untuk turut serta dalam ujicoba ini. Cara yang digunakan adalah posisikankalian,temankalian,sertapohonataubangunanyang akan dihitung tingginya dalam satu garislurus. Dalam suatu bayangan, posisikan kaliandalamujungbayanganbendayangdiukur.Posisikanteman kalian sehingga ujung bayangannyaberimpit dengan bayangan benda. Kemudianhitungmasing-masingtinggibadantemankalian(t),banyaknyalangkahdarikalianketemankalian(a),danbanyaknyalangkahdariposisikaliankepohon(b).Akhirnya,kitadapatmenghitungtinggipohonataubangunandenganrumus: t ba.x = sisisiku-sikusampingsudut(proyeksi)y = sisi siku-siku depan sudut(proyektor)r = sisimiring(proyektum)Perbandingan TrigonometriDariperbandingandiatas,kitamemperolehhubungansebagaiberikut.csc=1sin sec=1cos cot =1tan UraianMateriA. Perbandingan Trigonometri1. PerbandinganTrigonometriSuatuSudutpadaSegitigaSiku-SikubatBuktikantan=sin cos .Cara-nya,lengkapilahisianberi-kut.tan=yx=y x :...:...= ... ...(karenay:r=sin,x:r=cos)TugasMandiriMatematikaXISMK/MAK 3O 12rPX5YContoh:SuatugarisOPdenganO(0,0)danP(12,5)membentuksudutterhadapsumbuXpositif.Tentukanperbandingantrigonometrinya!Penyelesaian:r=+2 212 5=+ 144 25=169=13a. sin=513d. csc =135b. cos=1213e. sec =1312c. tan=512f. cot =1252. Perbandingan Trigonometri Sudut KhususSudutistimewaadalahsudutdengannilaiperbandingantrigonometriyangdapatditentukannilainyatanpamenggunakantabeltrigonometriatau kalkulator. Sudut-sudut istimewa antara lain: 0, 30, 45, 60,90,120,135,150,danseterusnya.a. Sudut 0Jika sudut = 0 maka sisi ACberimpitdengansumbuXdanAC=AB=1,BC=0.sin0=BCAC=01=0cos0=ABAC=11=1tan0=BCAB=01=0b. Sudut 30 dan 60JikaABC=90dan1=30maka2=60.DenganperbandinganAB:BC:AC= 3 :1:2diperoleh:sin30 =BCAC=12sin60 =ABAC=32=123cos30 =ABAC=32=123 cos60 =BCAC=12tan30 =BCAB=13=133 tan60 =ABBC= 3c. Sudut 45Jika ABC=90dansudut

=45makadenganmemerhatikangambardisampingdiperoleh:AB=BC=samapanjang=1;AC=2 2AB BC +=+ 1 1=2Diperoleh:sin45 =BCAC=12=122cos45 =ABAC=12=122tan45 =BCAB=11=1Keterangan:de=sisidepansa=sisisampingmi=sisimiringsin=demicos=samitan=desaTrikmidesaOB=CXYAB132C6030AB2C45A11Trigonometri 4BCAcabBCA ca30cm30OB=CXYAd. Sudut 90Karena =90makaACberimpitsumbuY.JadiAC=AB=1danBC=0.Diperoleh:sin90 =ABAC=11=1cos90 =BCAC=01=0tan90 =ABBC=10=takterdefinisiDariuraiandiatas,diperolehtabelsebagaiberikut.0 30 45 60 90sin 012122123 1cos 1123122120tan 0133 1 3 B. Panjang Sisi dan Besar Sudut Segitiga Siku-SikuDalamsegitigasiku-siku,jikadiketahuibesarsalahsatusudutlancipdanpanjangsalahsatusisinya diketahui maka ukuran unsur-unsuryang lain dalam segitiga tersebut dapat kitatentukan.Darigambardisamping,jikadiketahuisudutCAB=danpanjangsisiAB=bmakabesarsudut,sisiadansisicdapatditentukan,danberlaku:=90tan =abmaka a=btancos =bcmaka c=bcos Contoh:DiketahuisegitigaABCsiku-sikudiB, BAC=30,danpanjangsisiAC=30cm.Hitunglahpanjangsisiadanc.sin30 =BCAC12=30a a =1230 a =15Jadi,panjangsisia=15cm.cos30 =ABAC 123 =30cc =123 30c =15 3Jadi,panjangsisic=15 3 cm.MatematikaXISMK/MAK 5Sebuah paku ulir ganda seperti gambardi samping memiliki diameter (D) =28113 mmdankisar(P)=8mm.Tentukanbesarsudut!Penyelesaian:Menghitungbesarsudutekuivalendenganmenghitungkemiringanulir.Kemiringanulirdapatdigambarkansebagaiberikut.tan =DP=22 287 1138= 3 =arctan 3 =60Jadi,kemiringanulirsebesar60.C. Perbandingan Trigonometri Sudut di BerbagaiKuadran1. Sudut pada KuadranSelainsudut-sudutistimewa,menentukannilaiperbandingantrigonometri dapat dilakukan dengan menggunakan daftar, tabeltrigonometri, atau kalkulator. Tabel trigonometri hanya memuatsudut-sudutdikuadranIdanselebihnyatidak.Untukmenentukannilaiperbandingantrigonometridengansudutlebihdari90dapatdilakukandenganmengubahsuduttersebutkekuadranI.Sumbu-sumbu pada koordinat membagi bidang koordinatmenjadiempatdaerahyangdisebutkuadran.Denganbegitu,besarsudutdapatdikelompokkanmenjadi4daerahsepertiyangterlihatpadagambarberikut.Dari gambar di atas dapat ditentukan tanda (+/) nilaiperbandingantrigonometripadamasing-masingkuadran.bPDPDAplikasi90KuadranI(x,y)KuadranIV(x,y)KuadranII(x,y)KuadranIII(x,y)2700/360 180Untuk memudahkan kalianmenghafaltandapadakuadran,perhatikangambarberikut. DikuadranInilaisemua(all)sudutbernilaipositif. DikuadranIInilaisinpo-sitif,selainsinusnilainyanegatif. Di kuadran III nilai tanpositif, selain tangennilainyanegatif. DikuadranIVnilai cospositif, selain cosinusnilainyanegatif.TrikKuadranIIsinKuadranIallKuadranIIItanKuadranIVcosTrigonometri 6IntisariDidalamtrigonometri,ra-sioantarasembarangduagarisdarisuatusegitigasiku-sikuditetapkansebagaifungsisudut.Rasio-rasioinidise-but fungsi-fungsi trigono-metri.Rasio-rasioyangpalingumumdipakaiyaitusinus,cosinus,dantangen.OP(x,y)XY(90a)ayrxADasardariilmutrigonometriadalahsegitigasiku-sikuse-pertipadagambar.sin=oppositehypotenusacos=adjacenthypotenusatan=oppositeadjacentPerlu TahuHypotenusaoppositeAdjacent2. Sudut Berelasia. Sudut di Kuadran I (0 < x < 90)PerhatikanOAPdikuadranIdantitikP(x,y).sina =yrsin(90a) =xrcosa =xrcos(90a) =yrtana=yxtan(90a)=xyDapatdisimpulkanbahwa:sina =cos(90a) =yrcosa =sin(90a) =xrtana =1 (90 ) tan a =cot(90a)=xyContoh:1. sin30 =sin(9060) =cos602. cos45 =sin(9045) =sin453. tan30 =tan(9060) =cot60b. Sudut di Kuadran II (90 < x < 180)PerhatikanOAPdikuadranI,titikP(x,y)dantitikP(x,y)dikuadranII.Sudutdikuadran1 SudutdikuadranIIsina =yrsin(180a) =yrcosa =xrcos(180a) =xrtana =yxtan(180a) =yxDaribeberaparumusandiatas,dapatdisimpulkan:sin(180a) =sinacos(180a) =cosatan(180a) =tanaContoh:1. cos120 =cos(18060) =cos60 =122. cos135 =cos(18045) =cos45 =13. tan150 =tan(18030) =tan30 =133c. Sudut di Kuadran III (180 < x < 270)PerhatikanOAPdikuadranIdantitikP(x,y)dantitikP(x,y)dikuadranIII.Diperolehrelasisebagaiberikut.OP(x,y)(180a)ayrP (x,y)rayAXA'YMatematikaXISMK/MAK 7SudutdikuadranI SudutdikuadranIIIsina =yrsin(180+a) =yrcosa =xrcos(180+a) =xrtana =yxtan(180+a) =yxDaribeberaparumusandiatas,dapatdisimpulkan:sin(180+a) =sinacos(180+a) =cosatan(180+a) =tanaContoh:1. sin225 =sin(180+45) =sin45=1222. tan210 =tan(180+30) =tan30 =133d. Sudut di Kuadran IV (270 < x < 360)PerhatikanOAP,titikP(x,y)dikuadranI,OAPdanP(x,y)dikuadranIV.Diperolehrelasisebagaiberikut.SudutdikuadranI SudutdikuadranIVsina =yrsin(360a) =yrcosa =xrcos(360a) =xrtana =yxtan(360a) =yxDari beberapa rumusan tersebut diperoleh hubungan sebagaiberikut.sina =sin(360a) =yratau sin(360a) =sin(a) =sinacosa =cos(360a) =xratau cos(360a) =cos(a) =cosatana =tan(360a) =yxatau tan(360a) =tan(a) =tanaContoh:1. sin300 =sin(36030) =sin(30)=sin30=122. cos315 =cos(36045) =cos(45)=cos45=1223. tan(30) =tan30=133OP(x,y)(180+a)aYP (x,y)xayAX AryxrOP(x,y)(360a)aYP (x,y)xaXryAryTrigonometri 8InfoSumber: www.wikipedia.orgSegitigasiku-sikudanteo-rema Pythagoras merupa-kandasardariilmutrigono-metri.bcaACBBChLatihan 1Kerjakan soal-soal berikut!1. Jikacot=43,tentukannilaidaribentuktrigonometriberikut!a. sinb. cos2. Tentukannilaidarisudutistimewaberikut!a. sin120b. cos210c. tan3003. PadagambardisampingPR=7cmdanPQ=24cm.JikaP=90,tentukannilaisindantan!4. Sebuah antena dipasang dengandiberipenguatdarikawatsepertipada gambar di samping. Jikatinggiantena8mdansudutele-vasi30,berapakahpanjangkawattersebut?5. Sebuahalatpelubangmempunyaiukuran tinggi (h) = 3,5 cm danBC = 7 3 cm. Tentukan besarsudutnya!8m30Qkawat24cmPR7cmQMatematikaXISMK/MAK 90P(x,y)XYxySumber: www.ignoracia.comSalah satu kenampakan gurunPernahkahkaliantersesat?Atau,pernahkahkalianbingungsaat menentukan arah mata angin? Jika ya, berarti kalianmerasakanhalyangsamasepertipendudukzamandahulu.Wilayahbumiyangbegituluasmemungkinkanmanusiauntuk melakukan penjelajahan ke berbagai tempat. Akantetapi,untukkegiatanyangharusmelewatiwilayahgurun,hutan,maupunsamudradibutuhkanalatuntukmenentukanposisiataukeberadaansuatuobjek.PadaabadkedelapanparailmuwanMesirmemperkayailmupengetahuangeometriyangtelahdicetuskanolehbangsaIndiakunodenganteoribarutrigonometri.Teoriiniselanjutnyadigunakansebagaidasarmencariletakatauposisidiatasmukabumi.Teknikinidisebutsistemkoordinat.Padatrigonometriadaduasistemkoordinat yang digunakan yaitu koordinat cartesius dankoordinatkutub.Penjelasanmengenaiduasistemkoordinatiniakankitapelajaripadauraianberikut.UraianMateriA. Pengertian Koordinat Cartesius dan KoordinatKutubLetak suatu titik pada sebuah bidang dapat dinyatakan dengan 2macamsistemkoordinat.1. Sistem Koordinat CartesiusTitikPpadakoordinatcartesiusditulisP(x,y)denganxsebagaiabsisdanysebagaiordinat.2. Sistem Koordinat Kutub (Polar)TitikPpadakoordinatkutubditulisP(r,)denganrjarakdariPketitikpangkalkoordinatdanrmemilikisudutdengansumbuXpositif.TitikP(x,y) TitikP(r,)B. Mengkonversi Koordinat Cartesius ke KoordinatKutub atau SebaliknyaJikapadakoordinatcartesiustitikP(x,y)diketahuimakakoordinatkutubP(r,)dapatditentukandenganmenggunakanrumussebagaiberikut.r= +2 2x ytan=yx =arctanyxKoordinat Cartesius dan KutubInfoSumber: www.wikipedia.orgHipparchosDasarperumusantrigono-metridicetuskanolehilmu-wanmatematika,Hipparchos(170125SM).Beliaumene-rapkantrigonometriuntukme-nentukan letak kota-kota diatasbumidenganmemakaigarislintangdangarisbujur,sistemyangmasihdipakaisam-paisekarang.P(r, )XYxry0Trigonometri 10Perlu TahuSumber: www.egyptos.netPiramidaSudutsiku-sikuyangbesar-nya90dijadikandasarolehilmuwan matematika daribangsaRhind,yaituAhmes,untukmenunjukkanbagai-mana ketinggian sebuahpiramidaberhubungandenganukurandansudutkemiring-andarisetiapdindingsegi-tiga.Hasilnyadisebutdalambentuktabelperbandingantrigonometriyangmasihdi-gunakanhinggasaatini.JikakoordinatkutubtitikP(r,)diketahuimakakoordinatcartesiustitikP(x,y)dapatditentukandenganmenggunakanrumussebagaiberikut.sin =yr y=rsincos =xr x=rcosBerikutiniadalahkoordinatkutubP(r,)biladinyatakandalamkoordinatcartesiusadalah P(rsin,rcos ) .Sebaliknya,koordinatcartesiustitikP(x,y)biladinyatakandalamkoordinatkutubadalah P( +2 2x y,arctanyx)Contoh:1. DiketahuikoordinatkutubtitikP(4,60).TentukankoordinatcartesiustitikP!Penyelesaian:DiketahuiP(4,60),diperolehr=4dan=60.x =rcos y =rsin=4cos60 =4sin60=412=2 =4123 =2 3Jadi,koordinatcartesiusdarititikP(4,60)adalahP(2,2 3 ).2. DiketahuikoordinatcartesiustitikP(2,2 3 ).TentukankoordinatkutubtitikP!Penyelesaian:DiketahuiP(2,2 3 ),diperoleh x=2dany=2 3 yangterletakdikuadranIII.r = +2 2( 2) ( 2 3) tan=yx=2 32 =3=+ 4 12=arctan 3=16=4 =240(kuadranIII)Jadi,koordinatkutubdarititikP(2,2 3 )adalahP(4,240).Latihan 2Kerjakan soal-soal berikut!1. Ubahlahkoordinatkutubberikutkekoordinatcartesius!a. A(6,30) g. G(4 3 ,150)b. B(2,120) h. H(10,330)c. C(6,315) i. I(8,240)d. D(4 3 ,300) j. J(3 2 ,225)e. E(8,45) k. K(5 3 ,3.000)f. F(7,90) l. L(15,330)2. Ubahlahkoordinatcartesiusberikutkekoordinatkutub!a. P(2,2 3 ) f. U(3 2 ,3 2 )b. Q(1,1) g. V(5 3 ,5)c. R(2 3 ,6) h. W(3 2 ,3 6 )d. S(6,2 3 ) i. X(3 15 ,9 5 )e. T(5,5) j. Y(6,6 3 )KarenatitikPterletakdikua-dranIIImakaarctan 3 =240.TrikYX023MatematikaXISMK/MAK 11BaCAcbDESumber: www.wikipedia.orgPermukaan bulanPernahkahkalianmelihatpermukaanbulandengandetail?Pengamatan tersebut tidak dapat kalian lakukan tanpa alatbantu,misalnyateropongbintang.Perkembanganilmupengetahuandanteknologipadatigadasawarsainitelahberhasilmembawamanusiauntukmenye-lidikidanmelihatgambaranluarangkasabesertaisinyasecaranyata.Kondisisistemtatasuryabesertaspesifikasidariisinyadapatdipantauolehparailmuwandarimukabumi.Penyelidikandi stasiun luar angkasa tentunya perlu didukung denganperalatanyangmodern.Selainitu,diperlukanpengembangandari pengetahuan yang sudah ada. Gambar di samping me-nampilkan penampakan salah satu sisi muka bulan yangdiambilolehkrupesawatApollo11yangdiluncurkanolehstasiunruangangkasaAmerikaSerikat,yaituNASA.Ilmutrigonometribeserta rumus-rumus yang terkandung di dalamnya berperanbesar dalamperkembangan penyelidikan luar angkasa.Selanjutnya, akan kita pelajari mengenai aturan sinus dancosinuspadauraianberikut.UraianMateriA. Menemukan dan Menerapkan Aturan SinusGambar segitiga sebarang ABC di sampingmemilikipanjangsisiAB=ccm,BC=acm,danAC=bcm.Sementaraitu,CEdanBDadalahgaristinggiABC.PadaAECdiketahuisinA=CEAC.DiperolehCE=ACsinA=bsinA...(1)PadaBECdiketahuisinB=CECB.DiperolehCE=CBsinB=asinB...(2)Daripersamaan(1)dan(2)diperolehkesamaansebagaiberikut.bsinA=asinB ...(masing-masingdibagidengansinAsinB)a sin Bsin A sin B=b sin Asin A sin Basin A=bsin B...(3)PadaADBberlakusinA=BDAB.DiperolehBD=ABsinA=csinA...(4)PadaCBDberlakusinC=BDBC.DiperolehBD=BCsinC=asinC...(5)Aturan Sinus dan CosinusTrigonometri 12Perlu TahuSumber: www.thank.water.netSalah satu bentuk kristalSalahsatuaplikasimodernyangpalingpentingdalamtrigonometri,yaitustudimenge-naikristal.SeorangahlifisikaInggris,LawrenceBragg(18901971)menggunakantrigono-metri untuk menunjukkanbagaimana struktur kristalbisa dihitung dengan caramengukursudutpenyebaransinarxpadakristal.Ba=12cmCAcb4560Daripersamaan(4)dan(5)diperolehkesamaansebagaiberikut.csinA =asinC ...(masing-masingdibagidengansinAsinC)c sin Asin A sin C=a sin Csin A sin Ccsin C=asin A...(6)Daripersamaan(3)dan(6)makadiperolehaturan sinussebagaiberikut.asin A=6sin B=csin CContoh:1. DiketahuiABC,A=60,B=45,danpanjangsisiBC=12cm.TentukanpanjangsisiAC!Penyelesaian:DarigambardiketahuipanjangBC=12cm.asin A=bsin B12 60 sin= 45ACsin AC=1245 60sinsin=121212 23=12 2333=1236 =4 6Jadi,panjangsisiAC=4 6 cm.2. DiketahuiABCdengansisiAB=8cm,AC=5cm,dan B=37.HitunglahbesarsudutC!Penyelesaian:Daridatadiatasada2kemungkinansegitigayangdapatdibuat,yaitu:Aturanyangdipakai:bsin B=csin C5 37 sin=8sin C C=8375sin sinC= 8 0,6025 sinC=0,9632 sinC=arcsin0,9632DaritabeldiperolehC=7424=74,4(sudutCmerupakansudutlancip).JikasudutCmerupakansuduttumpul,diperolehC=18074,4=105,6Jadi,besarsudutCadaduakemungkinan,yaitu74,4dan105,6.BCA5cm8cm37B8cmCA375cmMatematikaXISMK/MAK 13AplikasiA BCcb aDtSuatubebanditahanolehseutastalisepertipadagambardisamping.TentukanpanjangtaliQR!Penyelesaian:Panjang tali QR dapat dihitung dengan menggunakan aturan sinussebagaiberikut.QRsin P=PQsin R QR =PQ sin Psin R=5030 105sinsin= 50 0,50, 9659=25,9Jadi,panjangtaliQRadalah25,9cm.B. Menemukan dan Menerapkan Aturan CosinusApabiladiketahuiduabuahsisidansatubuahsudutyangdiapitmakapanjangsisiyanglaindapatdihitungdengancarasebagaiberikut.PadagambarABCdisamping,CDadalahgaristinggi.sinA=CDACCD=ACsinACD=bsinAcosA=ADACAD=ACcosAAD=bcosADenganmenggunakandasarTeoremaPhytagorasdariBDCdiperoleh:a2=CD2+BD2=(bsinA)2+(cAD)2=(bsinA)2+(cbcosA)2=b2sin2A+c22bccosA+b2cos2A=b2sin2A+b2cos2A+c22bccos

A=b2(sin2A+cos2A)+c22bccos

A=b2+c22bccos

AJadi,diperoleh a2=b2+c22bccos

AAnalog dengan cara tersebut dapat diperoleh panjang sisi b dan c yangdinamakanaturan cosinus sebagaiberikut.a2=b2+c22bccos

Ab2=a2+c22accos

Bc2=a2+b22abcos

C50cm 4530 P QRPerlu Tahusin2A+cos2A=1Persamaan tersebut akankitapelajaripadakegiatanbelajar6babini.Trigonometri 14ABC8605InfoSumber: www.palmbeachprinces.comKapal pesiarTabel-tabel bilangan, sepertihalnya pedoman nautika (pe-layaran), telah digunakan lebihdari 4.000 tahun sebagai pe-doman untuk menyelesaikanperhitungan-perhitungan yangrumit. Beberapa di antaranyadigunakan untuk nilai-nilaitrigonometri.Contoh:DiketahuiABC,AB=5danAC=8danA=60HitunglahpanjangsisiBC.Penyelesaian:AB =c=5,AC=b=8,A=60a2=b2+c22bccos A=82+52285cos

60=64+258012=8940=49 a = 49 =7KarenasisiharuslahbernilaipositifmakapanjangsisiBC=7cm.Aturan cosinus dapat digunakan untuk menentukan besar sudut dalamABCdengansyaratpanjangketigasisinyaharusdiketahui.Untukituaturancosinusdapatdinyatakandalambentuksebagaiberikut.cos A=+ 2 2 22b c ab ccos B=+ 2 2 22a c ba ccos C=+ 2 2 22a b ca bContoh:1. DiketahuiABCdenganAB=6cm,AC=5cm,danBC=4cm.HitunglahbesarsudutB!Penyelesaian:cos B =+ 2 2 22a c ba c=+ 2 2 24 6 52 4 6=+ 16 36 2548=0,5625 B=arccos0,5625=5544Jadi,besarsudutB=55,77.2. DiketahuiABCdenganA=60,sisib=10cm,dansisic=16cm.Tentukanbesarunsur-unsur:a. panjangsisia,b. besarB,danc. besarC.Penyelesaian:a. a2=b2+c22bccos A=102+16221016cos 60=100+2562101612=196Jadi,panjangsisia= 196 =14cm.b. cos B =+ 2 2 22a c ba c=+ 2 2 21416102 14 16=+ 196 256 100448=356448=0,795 B=arccos0,795Jadi,besarB=3828.c. Sudut C dihitung dengan aturan jumlah sudut dalam sebuahsegitigaadalah180.C =180(60+3828)=1809828=8132Jadi,besarC=8132.DiskusiBuatlah kelompok bersamateman sebangku kalian, ke-mudian diskusikan hal beri-kut. Buktikanlah bahwa padasegitiga ABC berlaku:b2 = a2 + c2 2ac cos B.Gunakan petunjuk berikut. Buktikan dahulu:BD = a cos BCD = a sin B Gunakan rumus:b2 = CD2 + AD2MatematikaXISMK/MAK 15AplikasiDiberikanposisitigabuahbangunansepertigambardisamping.Setelahdilakukanpe-ngukuran diperoleh bahwa jarak rumahsakitdenganapotekadalah1kmdanjarakrumahsakitdenganbankadalah2km.Padabangunan rumah sakit dipasang pesawattheodolityangdiarahkankerumahsakitdanbank.Sudutyangdibentukolehtheodolitadalah120.Tentukanjarakbankdenganapotek!Penyelesaian:Dimisalkan: rumahsakit =Aapotek =Bbank =CDenganmenggunakanrumusaturancosinusdiperoleh:BC2=AB2+AC22ABACcos120 BC2=12+22212cos(18060) BC2=1+4212(cos60) BC2=5212(12) BC2=5+2 BC2=7 BC = 7 =2,6458Jadi,jarakapotekdenganbankadalah2,6458km2,7km.Latihan 3Kerjakan soal-soal berikut!1. PadaPQR,jikaPQ=7cm,QR=9cm,danPR=6cm,hitunglahnilaiP,QdanR!2. KotaBterletak20kmsebelahutarakotaAdankotaCterletak15kmbaratlautkotaA.HitunglahjarakantarakotaBdankotaC!3. PadaABCdiketahuiA:B:C=2:3:5.Tentukanperbandingansisia:b:c.4. Sebuahbendakerjaberbentuklingkarandengan r bola = 40 mm dan R pisau =50mm.Tentukanpanjangx!5. Perhatikan pasangan roda gigi padagambardisamping.Hubunganantara,h, dan modul (m) diberikan pada per-samaanberikut.h=m(14cossin)Jikadiketahuih=6danm=8,tentukannilaisin2!CB1kmA2kmCDBRArx59hTrigonometri 16InfoTabelsinusdantangenyangdipakai saat ini ditemukanoleh ilmuwan matematikadari Persia, Al-Khwarizmi,pada10SM.Sumber: www.wikipedia.orgAl-KhwarizmiBaCAcbD Sumber: www.ignoracia.comPiramidaKunotidakselaluidentikdengankebodohan.Bukti-nya dapat kalian lihat pada gambar di samping. Ya,ternyatapiramidainimenyimpanilmupengetahuanyanghebat.Berdasarkansumberdaridaunlontarpeninggalanbangsa Rhind, seorang ilmuwan matematika bernamaAhmesmenuliskanbuah-buahpikirannyaterkaitdengansegitigasiku-siku.Halinidilakukanuntukmenunjukkanhubungan antara ketinggian piramida terkait denganukuran dan sudut kemiringan dari setiap dindingpiramida. Selanjutnya, Ahmes membuat sebuah tabelperbandingan(rasio)yangdapatmembantuparaperancangpiramidapadazamandahuluagarmenghasilkankemi-ringandindingpiramidasesuaiyangdiinginkan.Tabelyangdihasilkandisebutsebagaiperbandingan-perban-dingan trigonometri yang masih digunakan oleh paramatematikawanhinggasaatini.Sisi-sisipiramidayangberbentuksegitigamerupakanbangundataryangtentu-nyamemilikiluas.Penggunaantrigonometriuntukmeng-hitung luas segitiga akan kita pelajari pada uraianberikut.UraianMateriRumusumumuntukmencariluassegitigaadalah:LuasABC= alas tinggi2Dari gambar ABC di atas, alas = AB dan tinggi = CD. Panjang CD dicaridenganlangkahberikut.PerhatikanACDpadaABCdiatas.ACDadalahsegitigasiku-sikusehinggadiperoleh:sinA=CDbatauCD=bsinA.LuasABC=2AB CD = 2AB b sin A =12cbsinA.DengancarayangsamauntukmenghitungluasABCbilapanjangduasisidanbesarsalahsatusudutyangdiapitkeduasisitersebutdiketahuiakandiperolehrumus-rumussebagaiberikut.LABC =12absinC=12bcsinA=12acsinBLuas SegitigaMatematikaXISMK/MAK 17A CB552520Perlu TahuSumber: www.wikipedia.orgAstronom-astronomterda-hulu menggunakan astrolabeuntuk mengukur sudut ele-vasi dari bintang-bintang danhasilnya digunakan untuk meng-hitung jarak bintang dan planet-planet serta keliling bumi.Contoh:1. DiketahuiABCdengansisia=20cm,c=25cm,B=55.CarilahluasABCtersebut!Penyelesaian:LuasABC =12acsinB=122025sin55=122025(0,8191)= 209,78Jadi,luassegitigaABCadalah209,78cm2.2. DiketahuiABCdengansisia=14cm,b=16cm,danc=22cm.CarilahluasABCtersebut!Penyelesaian:a2=b2+c22bccos

A 142=162+22221622cos

A 196 =256+484704cosA cosA = 740 196704 cosA =544704=0,7727 A =arccos(0,7727)A =3924LuasABC =12bcsinA=121622. sin3924=176(0,6347)=111,7072Jadi,luasABCadalah111,7072cm2.Latihan 4Kerjakansoal-soalberikut!1. CarilahluasABCjikadiketahuiunsur-unsurnyasebagaiberikut!a. a=7cm,b=9cm,dan=72b. b=24cm,c=30cm,dan=45c. c=40cm,a=14cm,dan=60d. a=4cm,b=6cm,danc=8cm2. LuassegitigaABCadalah32cm2.AB=8cmdanAC=16cm.TentukanbesarsudutA!3. Selembar pelat tembaga dipotongsehinggaberbentuksegitigasepertipadagambardisamping.Tentukanluaspelattersebut!4. PerhatikansegitigaABCdisampingini.Bilapanjangsisic=5cm,tentukanluassegitigaABC!5. Hitunglah luas segi empat ABCDsepertipadagambardisamping!727

cm9cmBaCAcb60AB9 D1207108CTrigonometri 18Sumber: Ensiklopedi Matematika dan Peradaban ManusiaGunungyangdigambarkansebagailimassegitigaDalam buku ilmu pengetahuan tentu kalian pernahmembaca data tentang ketinggian gunung. Ketinggiangunungdituliskandalambilanganbulat.Tahukahkalian,bagaimana cara mengukur ketinggian gunung? Tentuketinggiangunungtidakdihitungsecaramanualatausecaralangsung.Akantetapi,denganmenggunakandasartrigono-metri.Langkahpertamayaitugunungyangakandihitungketinggiannya digambarkan sebagai bangun ruang limassegitiga.Limastersebutdisusunatastigasegitigasiku-siku,dan satu buah segitiga sembarang yaitu PQR. PanjangPS = SQ dan RSP = RQS = 90. Selanjutnya dihitungpanjangPQ,RPQ,RQP, RPS,danRQS.AkhirnyatinggigunungyaituRSdapatdicarinilainya.Didalamtrigonometrirumus yang digunakan bermacam-macam, salah satunyarumusjumlahdanselisihduabuahsudutyangakankitapelajariberikut.UraianMateriA. Rumus Trigonometri untuk Jumlah Dua Sudut danSelisih Dua SudutApabila diketahui dua buah sudut yaitu A dan B maka identitastrigonometridarijumlahdanselisihsudutAdansudutBdapatdicaridenganrumusberikut.cos(A+B) =cosAcosBsinAsinBcos(AB) =cosAcosB+sinAsinBsin(A+B) =sinAcosB+cosAsinBsin(AB) =sinAcosBcosAsinBtan(A+B) = + 1tan A tan Btan A tan B tan(AB) = 1tan A tan Btan A tan B+ InfoSumber: www.wikipedia.orgClaudius PtolemyTrigonometri sebagai fungsi di-pelajari lebih lanjut oleh ma-tematikawan Yunani, Hipparchos(90 M SM12 SM) dan mate-matikawan Mesir, Ptolemy(90 M SM12 SM). Kedua il-muwan inilah yang menemu-kanrumus-rumuspentingdalamtrigonometri,salahsatunyasin(A+B)dancos (A + B).Rumus Trigonometri Jumlah dan Selisih Dua SudutSRQ PMatematikaXISMK/MAK 19InfoSumber: www.wikipedia.orgGuilloche PatternsGuilloche Patterns adalahkurva berbentuk spirograf(spiralterhubung).Kurvainidigunakandalambidangke-amanan pada perbankan,untukmencegahpemalsu-an.TeknikinidigunakandiAmerika,Brasil,Rusia,dannegara-negaradiEropa.BCA534BCA51312Contoh:1. Denganmenyatakan105=(60+45),tentukannilaisin105!Penyelesaian:sin105 =sin(60+45)=sin60cos45+cos60sin45=123 122 +12122=146 +142=14( 6 + 2 )Jadi,nilaisin105=14( 6 + 2 ).2. Diketahui sinA=35untukAsudutlancip,dancosB=1213untukBsuduttumpul.Tentukannilaidarijumlahdanselisihsudutberikut!a. sin(A+B)b. cos(BA)c. tan(AB)Penyelesaian:Untuk sudut lancip, nilai trigonometri sudut A seluruhnya bernilaipositif.sinA=35cosA=45tanA=34UntuksuduttumpuldengannilaicosnegatifmakasudutterletakdikuadranII.sinB=513cosB=1213tanB=512a. sin(A+B) =sinAcosB+cosAsinB=35 1213+45513=3665+2065=1665b. cos(BA) =cosBcosA+sinBsinA=121345+51335=4865+1565=3365c. tan(AB) = 1tan A tan Btan A tan B+ =( )( ) + 3 54 123 54 12 1=+3 54 121548 1=+36 2048 4848 1548 48 =56483348=5633Trigonometri 20Aplikasi220P1P1xYX220P1P1yYX340P2P2xYX340P2P2yYXPadasuatutitiktumpuanbekerjaduabuahgayayaituP1sebesar5Ndenganarah1=220danP2sebesar7Ndenganarah2=340.Tentukantiap-tiapgayaapabiladiuraikansesuaisumbukoordinat!Penyelesaian:Gaya P1 dan P2 apabila digambarkan dalam bidang koordinat akandiperoleh:UntukgayaP1: DiuraikanpadasumbuX:P1x = P1cos1= 5cos220= 5cos(180+40)= 5(cos180cos40sin180sin40)= 5(10,76600,642)= 5(0,766)= 5,766 DiuraikanpadasumbuY:P1y = P1sin1= 5 sin220= 5sin(180+40)= 5(sin180cos40cos180sin40)= 5(00,766+(1)0,642)= 5(0,642)= 3,214UntukgayaP2: DiuraikanpadasumbuX:P2x = P2cos2= 7cos340= 7cos(270+70)= 7(cos270cos70sin270sin70)= 7(00,342+10,939)= 7(0,939)= 6,5779 DiuraikanpadasumbuY:P2y = P2sin2= 7 sin340= 7sin(270+70)= 7(sin270cos70cos270sin70)= 7(10,342+00,939)= 7(0,342)= 2,394220340YXP1P2MatematikaXISMK/MAK 21BCA534B. Rumus Trigonometri Sudut RangkapDi dalam trigonometri terdapat rumus yang menjadi dasar dariperkembangantrigonometriselanjutnya,yaituidentitas trigonometri.sin2A+cos2A=1Selanjutnyaditurunkanrumus-rumuspentingsebagaiberikut.a. sin2A =2sinAcosAb. cos2A =cos2Asin2A=cos2A(1cos2A)=cos2A1+cos2A=2cos2A1cos2A =cos2Asin2A=(1sin2A)sin2A=12sin2Ac. cos2A =12(1+cos2A)d. sin2A =12(1cos2A)e. tan2A =221tan Atan A Contoh:DiketahuisinA=35untukAsudutlancip.Tentukannilaiidentitastrigonometriberikut!a. sin2Ab. cos2Ac. tan2APenyelesaian:cosA=45sinA=35tanA =34a. sin2A=2sinAcosA=23545=2425b. cos2A=12sin2A=12 235=12925= 25 1825=725c. tan2A=221tan Atan A =( )2343421=6416 916 16=64167=2471. Sebuahtegangangeserdiberikandenganrumus=hcossin.Jikadiketahui=5N/m2,h=10m,dan=2N/m2,tentukanbesarsudutyangdibentuk()!AplikasiInfoIdentitastrigonometriakankitabuktikansebagaiberi-kut.sinA=yrdancosA=xrsin2A+cos2A =2 yr+2 xr=22yr+22xr=2 22+ yxr=22rr=1BA OyrxTrigonometri 22Penyelesaian:Rumusyangdiketahuiadalah:=hcossin 5 =2 10 cos sin 5 =10 2cos sin 5 =10 sin212=sin2 sin30=sin2 30=2 =15Jadi,besarsudutyangdibentuk15.2. Diketahuie=maxsintdani=Imaxsint.Tentukannilaiei!Penyelesaian:Rumusyangdiketahuisebagaiberikut.ei =maxsintImaxsint=maxImaxsint

sint=maxImaxsin2t=maxImax1 22cos t Jadi,nilaieiadalahmaxImax1 22cos t .C. Rumus Perkalian Sinus dan Cosinusa. 2sinAcosB=sin(A+B)+sin(AB)b. 2cosAsinB=sin(A+B)sin(AB)c. 2cosAcosB=cos(A+B)+cos(AB)d. 2sinAsinB=cos(A+B)cos(AB)Contoh:Nyatakanbentukberikutsebagairumusjumlahsinus!a. 2sin75cos15b. cos2xsinxPenyelesaian:a. 2sinAcosB =sin(A+B)+sin(AB)2sin75cos15 =sin(75+15)+sin(7515)=sin90+sin60=1+123b. 2cosAsinB =sin(A+B)sin(AB)cosAsinB =12{(sin(A+B)sin(AB)}cos2xsinx =12{(sin(2x+x)sin(2xx)}=12(sin3xsinx)=12sin3x12sinxMatematikaXISMK/MAK 23InfoSumber: www.wikipedia.orgMarine SextantsAlatpadagambardiatasdi-sebutmarinesextants.Alatini digunakan untuk meng-hitungbesarsudutmatahariataubintangyangdiukurdaripermukaanbumi.Dengandi-lengkapi trigonometri danketepatanjurusantigaangkamaka posisi suatu kapaldapat ditentukan denganmenggunakanalatini.AplikasiPada sebuah batang silinder diketahui besar nilai e = m sin dani=Imsin(+)denganmadalahmoduluselastisitasdanImadalahmomeninersia.Tentukannilaiei!Penyelesaian:ei =(msin)(Imsin(+))=mImsin(sin+)=mIm

12(cos(+w+)cos((+ )))=12 mIm(cos(2+)cos)=12 mIm(coscos(2+))Jadi,nilaieiadalah12 mIm(coscos(2+)).D. Rumus Penjumlahan dan Selisih Dua Suduta. sinA+sinB=2sin12(A+B)cos12(AB)b. sinAsinB=2cos12(A+B)sin12(AB)c. cosA+cosB=2cos12(A+B)cos12(AB)d. cosAcosB=2sin12(A+B)sin12(AB)Contoh:Hitunglahpenjumlahantrigonometriberikut!a. cos75+cos15b. sin75+sin15Penyelesaian:a. cosA+cosB =2cos12(A+B)cos12(AB)cos75+cos15 =2cos12(75+15)cos12(7515)=2cos12(90)cos12(60)=2cos45cos30=2 122 123 =126b. sinA+sinB =2sin12(A+B)cos12(AB)sin75+sin15 =2sin12(75+15)cos12(7515)=2sin12(90) cos12(60)=2sin45cos30=2 122 123=126Trigonometri 24AplikasiSepasang roda gigi memiliki kecepatan putar masing-masinge1=1102sin(t+2)dane2=1102sint.Tentukane1+e2!Penyelesaian:e1+e2=1102sin(t+2)+1102sint=1102(sin(t+2)+sint)=1102[2sin12(t+2+t)cos12(t+2t)]=2202[sin12(2t+2)cos122]=220sin(t+4)Jadi, jumlah kecepatan putar sepasang roda gigi tersebut adalah220sin(t+4).Latihan 6Kerjakan soal-soal berikut!1. DiketahuitanA=45dantanB=724,denganAsuduttumpuldanBsudutlancip.Tentukannilaidaribentuktrigonometriberikut!a. cos(AB) c. tan(AB)b. sin(A+B)2. Sederhanakanbentuktrigonometriberikut!a. + 75 1575 15cos cossinsin b.+ 739 3sin A sin AsinA sinA3. Diketahui sin A =12, cos B =32, A sudut tumpul, dan B sudut lancip.Tentukannilaicos(AB)!4. Sebuahmotorlistrik3fasememerlukanarus(I)50Apadateganganjala(U) = 220 volt dan cos = 0,8. Apabila pengukuran dilakukan denganmenggunakan2buahwattmeter,tentukannilaiP1danP2apabiladiketahuipersamaanberikut!P1=UIcos(30)P2=UIcos(30+)5. Jikae=maxsintdani=Imaxsint,buktikanpersamaanberikut!p=ei=max max(1 2 )2Icos t_MatematikaXISMK/MAK 25Jembatanmerupakansaranapenghubungantar-wilayah yang dipisahkan oleh sungai atau jurang.Seiringbertambahnyawaktu,bertambahpulateknologipembangunanjembatan.Dalammerancangkerangkasebuahjembatanperhitunganyangdilakukantidaklahmudah.Beban,tegangan,sertagayayangbekerjapadajembatanmenjadipertimbanganutamaparaperancanguntukmengkonstruksikanmodelrancangannya.ProsesinididasarkanataspengetahuandaribangsaRomawibahwabusurdapatmenjangkaujarakyanglebihjauhdan menahan berat yang lebih berat daripada lintel(bentuk balok yang lurus horizontal). Atas dasar inisemakinbanyakpulajembatanberbentukbusuryangdibangun. Penggunaan bentuk busur ini melibatkankelengkunganyangperludiperhitungkankemiringansudutnyayangdiberikandalampersamaantrigonometri.Lebih lanjut mengenai persamaan trigonometri akankitapelajaripadauraianberikut.UraianMateriInfoTrigonometripertamakalidi-gunakanolehbangsaBabiloniapada1900SM.Pemahamanyangdihasilkanberupatabelsecan.TrigonometridigunakandiSriLankapada6SMuntukwaduk,strukturhidrolikper-airan,danmenghitungke-miringan permukaan bumiyaitu6untuksetiapmil.Persamaan TrigonometriSumber: www.image.tour.comSalah satu bentuk jembatanPersamaan trigonometri adalah persamaan yang memuat satu ataubeberapafungsitrigonometridaribeberapasudutyangbelumdiketahui.1. Persamaan Trigonometri Bentuk Sederhanaa. Jika sinx=sin makahimpunanpenyelesaiannya(i) x=+k360 atau (ii) x=(180)+k360b. Jika cosx=cos makahimpunanpenyelesaiannya(i) x=+k360 atau(ii) x=()+k360c. Jika tanx=tan makahimpunanpenyelesaiannyax=+k180dengankadalahbilanganbulat.Ataua. Jika sinx=sin maka (i) x=+k2 atau(ii) x=()+k2b. Jika cosx=cos maka(i) x=+k2 atau(ii) x=+k2c. Jika tanx=tan maka(i) x=+ykdengankadalahbilanganbulat.Trigonometri 26Contoh:1. Tentukanhimpunanpenyelesaiansinx=123 untuk0x 360!Penyelesaian:sinx=123 (untuk0x 360)sinx=sin60makaberlaku:(i) x=60+k360 k=0 x=60+0360=60 k=1 x=60+1360=420(tidakmemenuhikarena0x 360)(ii) x=(18060)+k360 k=0 x=120+0360=120 k=1 x=120+1360=480(tidakmemenuhikarena0x 360)Jadi,himpunanpenyelesaiannya{60,120}.2. Diketahuicosx=12.Tentukanhimpunanpenyelesaiannya!Penyelesaian:cosx=12(untuk0x 360)cosx=cos60maka:(i) x=60+k360 k=0 =60+0360=60 k=1 =60+1360=420(tidakmemenuhi)(ii) x=60+k360 k=0 x=60+0360=60(tidakmemenuhi) k=1 x=60+1360=300 k=2 x=60+2360=660(tidakmemenuhi)Jadi,himpunanpenyelesaiannya{60,300}.3. Tentukanhimpunanpenyelesaiandaritanx=133 untuk0x2!Penyelesaian:tanx=133 (untuk0x2) tanx=tan6,makax=6+kk=0 x=6+0 =6k=1 x=6+1 = 76k=2 x=6+2 =136(tidakmemenuhi)Jadi,himpunanpenyelesaiannya{6, 76}.2. Persamaan Bentuk sin px = a, cos px = a, dan tan px = aUntukmenyelesaikanpersamaantrigonometribentuksinpx=a,cospx=a,dantanpx=a,denganpdanamerupakankonstanta,terlebihdahulupersamaanharusdiubahkedalambentukdasarpersamaantrigonometri.Contoh:Tentukanhimpunanpenyelesaianpersamaanberikutuntuk0x 360!a. 2sin2x= 3b. cos2x=12c. 3 tan3x=1Perlu TahuSumber: www.wikipedia.orgSistemTataSuryaTrigonometridigunakanda-lamberbagaimacambidangkehidupan.Sebagaicontohdalambidangastronomiuntukmenghitung jarak bintang,geografiuntukmenghitungjarakantarpulau,danilmufisika sebagai dasar teorifungsiperiodikdalampem-bahasangelombangsuaradancahaya.MatematikaXISMK/MAK 27Penyelesaian:a. 2sin2x = 3sin2x=123sin2x=sin60.Diperoleh:(i) 2x=60+k360 x=30+k180 k=0 x=30+0180=30 k=1 x=30+1180=210 k=2 x=30+2180=390(tidakmemenuhi)(ii) 2x=120+k360 x=60+k180 k=0 x=60+0180=60 k=1 x=60+1180=240 k=2 x=60+2180=420(tidakmemenuhi)Jadi,himpunanpenyelesaiannya{30,60,210,240}.b. cos2x=12cos2x=cos60.Diperoleh:(i) 2x=60+k360x=30+k180 k=0 x=30+0180=30 k=1 x=30+1180=210 k=2 x=30+2180=390(tidakmemenuhi)(i) 2x=60+k360x=30+k180 k=0 x=30+0180=30(tidakmemenuhi) k=1 x=30+1180=150 k=2 x=30+2180=330 k=3 x=30+3180=510(tidakmemenuhi).Jadi,himpunanpenyelesaian{30,150,210,330}.c. 3 tan3x=1 tan3x=133 tan3x=tan150Diperoleh:3x=150+k180 x=50+k60 k=0 x=50+060=50 k=1 x=50+160=110 k=2 x=50+260=170 k=3 x=50+360=230 k=4 x=50+460=290 k=5 x=50+560=350 k=6 x=50+660=410(tidakmemenuhi)Jadi,himpunanpenyelesaiannya{50,110,170,230,290,350}InfoSumber: www.wikipedia.orgRadiosatelitRadiosatelitmerupakansa-ranakomunikasipentingbagiparaastronom.Denganalatiniinformasiyangdiperolehdariluarangkasadapatdite-rimadibumimelaluisistemnavigasi satelit. Ilmu trigo-nometrimemilikiperanyangcukup besar dalam peran-cangandanpenggunaanalatini.3. PersamaanBentukcos(x+a)+cos(x+b)=cdansin(x+a)+sin (x + b) = cUntukmenyelesaikanpersamaantrigonometridenganbentukcos(x+a)+cos(x+b)=cdansin(x+a)+sin(x+b)=c,kitaingatkembalirumus-rumusberikut.cos(A+B)+cos(AB)=2cosAcosBcos(AB)cos(A+B)=2sinAsinBsin(A+B)+sin(AB)=2sinAcosBcos(A+B)sin(AB)=2cosAsinBTrigonometri 28InfoSumber: www.wikipedia.orgKurvaLissajousTrigonometrisebagaifungsidapatdisajikansebagaisuatukurvayangkontinu(selaluterhubung).SalahsatunyaadalahkurvaLissajous.Perlu TahuSumber: DokumentasiSMKSegitiga siku-sikuTrigonometrimerupakanda-sarbagiilmugeometri.Hu-kumsinusdancosinusda-patdigunakanuntukmen-caribesarsudutdansisisu-atusegitiga.Dengandemiki-anhukuminidapatdiguna-kan secara luas pada geo-metri.Halinidikarenakanse-muasisipadabangundatardapatdibentukdarikombi-nasidanbangunsegitiga.Contoh:Tentukanpenyelesaianpersamaanberikut,untuk0x 360!a. sin(60+x)sin(60x)=1b. sin5xsinx=0Penyelesaian:a. sin(60+x)sin(60x)=1 2cos60sinx=1 212sinx =1 sinx =1 sinx =sin90Diperoleh:(i) x=90+k360 k=0 x=90+0360=90 k=1 x=90+1360=450(tidakmemenuhi)(ii) x=(18090)+k360 x=90+k360 k=0 x=90+0360=90 k=1 x=90+1360=450(tidakmemenuhi)Jadi,himpunanpenyelesaiannya{90}.b. sin5xsinx=0 sin(3x+2x)sin(3x2x)=0 2cos3xsin2x =0 cos3x =0atausin2x=0Untukcos3x=0 cos3x=cos90,diperoleh:(i) 3x=90+k360 x=30+k120 k=0 x=30+0120=30 k=1 x=30+1120=150 k=2 x=30+2120=270 k=3 x=30+3120=390(tidakmemenuhi)(ii) 3x=90+k360 x=30+k120 k=0 x=30+0120=30(tidakmemenuhi) k=1 x=30+1120=90 k=2 x=30+2120=210 k=3 x=30+3120=330 k=4 x=30+4120=450(tidakmemenuhi)Untuksin2x=0 sin2x=sin0,diperoleh:(i) 2x=0+k360 x=k180 k=0 x=0120=30 k=1 x=1120=180 k=2 x=2120=360 k=3 x=3120=540(tidakmemenuhi)(ii) 2x=(1800)+k360 2x=180+k360 x=90+k180 k=0 x=90+0180=90 k=1 x=90+1180=270 k=2 x=90+2180=450(tidakmemenuhi)Jadi,himpunanpenyelesaiannya{0,30,90,150,180,210,270,330,360}.A CBacbMatematikaXISMK/MAK 29Kilas BalikNilaiberadadikuadranIV.YXa10b14. Persamaan Trigonometri Bentuk a cos x + b sin x = cUntuk menyelesaikan persamaan a cos x + b sin x = c, persamaantersebutharusdiubahkebentukberikut.kcos(x)=c dengank=+2 2a btan=ba =arctanbaContoh:Tentukan nilai x yang memenuhi persamaan cos x sin x = 1 untuk0x 360!Penyelesaian:Diketahui cos x sinx=1.Berdasarkanpersamaan acosx+ bsinx= c,diperoleha=1,b=1,danc=1.Nilaik= +2 2a b =+2 2(1) ( 1)=+ 1 1=2.tan=ba tan=11=1(kuadranIV)maka=315Diperolehkcos(x)=c2cos(x315)=1 cosxsinx=12 cos(x315)=cos45,maka:(i) x315=45+k360 x=360+k360 k=0 x=360 k=1 x=360+1360=720(tidakmemenuhi)(ii) x315=45+k360 x=270+k360 k=0 x=270+0360=270 k=1 x=270+1360=630(tidakmemenuhi)Jadi,himpunanpenyelesaiannya{270,360}.5. Persamaan Kuadrat dalam sin, cos, dan tanUntukmencarihimpunanpenyelesaiandaribentukpersamaankuadratdalamtrigonometri,terlebihdahulubentuktrigonometri(sin,cos,tan)harusdimisalkandengansuatupeubahtertentu(misalnyaa,x,p,dansebagainya).Selanjutnya,bentukpersamaankuadratdalambentukpeubahdiselesaikansesuaidenganrumusdasaruntukmemperolehakar-akarpenyelesaiannya.Contoh:Tentukan himpunan penyelesaian dari persamaan sin2 x + sin x 2 = 0untuk0x 360!Penyelesaian:Diketahuisin2x+sinx2=0.Dimisalkansinx=p,makasin2x+sinx2=0p2+p2=0 p2+p2=0 (p+2)(p1)=0 (p+2)=0atau(p1)=0 p=2 atau p=1Untuk p=2 sinx=2(tidakmungkin,karena1 sinx 1) p=1 sinx=1 sinx= sin90.Diperoleh:(i) x=90+k360 k=0 x=90+0360=90 k=1 x=90+1360=450(tidakmemenuhi)(ii) x=18090+k360x=90+k360 k=0 x=90+0360=90(samadengan(i))Jadi,himpunanpenyelesaiannya{90}.Trigonometri 30Rangkuman Latihan 7Kerjakan soal-soal berikut!1. Tentukanhimpunanpenyelesaiandaripersamaantrigonometriberikut!a. sinx=122 untuk0x 360b. cosx=12untuk0x 360c. tanx=133 untuk0x d. sin3x=122 untuk0x e. 6 cos2x+ 3 =0untuk0x 2f. sin4x+sin2x=0untuk0x2g. cos5x+cosx=0untuk0x h. tan5x=133 untuk0x22. Tentukanhimpunanpenyelesaiandaripersamaantrigonometriberikut!a. 2sin2x6sinx4=0untuk0x 360b. 2cos2x3cosx+1=0untuk0x 360c. cosx 3 sinx= 3 untuk0x 360d. 2 cosx 2 sinx=1untuk0x 3601. sin=yr2. cos=xr3. tan=yx4. y=r.sin5. x=r.cos6. Sudut 0 30 45 60 90sin 012122123 1cos 1123122120tan 0133 1 3 sin(90a)=cosa sin(180a)=sinasin(180+a)=sina sin(360a)=sin(a)=sinacos(90a)=sina cos(180a)=cosacos(180+a)=cosa cos(360a)=cos(a)=cosatan(90a)=ctana tan(180a)=tanatan(180+a)=tana tan(360a)=tan(a)=tanaMatematikaXISMK/MAK 317. Koordinat kutub titik P (r, ) bila dinyatakan dengan koordinatcartesiusP(x,y)diperolehhubungan:x=rcosdany=rsin.kutubcartesiusP(r,)P(rcos,rsin)8. Koordinat cartesius titik P (x, y) bila dinyatakan dengan koordinatkutubP(r,)diperolehhubungan:r=2 2x y +dantan=yxdannilai=arctanyx.CartesiuskutubP(x,y)( )+ 2 2,yxP x y arc tan9. Aturansinus:a b csin A sin B sin C= =10. Aturancosinus:a. a2=b2+c22bccosA cosA=2 2 22b c ab c+ b. b2=a2+c22accosB cosB=2 2 22a c ba c+ c. c2=a2+b22abcosC cosC=2 2 22a b ca b+ 11. LuassegitigaABC=12c asin 12c bsin 12a b sin 12. Rumusjumlahdanselisihduasudut:a. cos(A+B)=cosAcosBsinAsinBb. cos(AB)=cosAcosB+sinAsinBc. sin(A+B)=sinAcosB+cosAsinBd. sin(AB)=sinAcosBcosAsinBe. tan(A+B)=+ 1tan A tan Btan A tan Bf. tan(AB)=+ 1tan A tan Btan A tan B13. Rumussudutrangkap:a. sin2A =2sinAcosBb. cos2A =cos2Asin2A=2cos2A1=12sin2Ac. tan2A =221tan Atan A14. Rumusperkaliansinusdancosinus:a. 2sinAcosB=sin(A+B)+sin(AB)b. 2cosAsinB=sin(A+B)sin(AB)c. 2cosAcosB=cos(A+B)+cos(AB)d. 2sinAsinB=cos(A+B)cos(AB)ABCabcTrigonometri 3215. Rumusjumlahdanselisihsinusdancosinus:a. sinA+sinB=2sin12(A+B)cos12(AB)b. sinAsinB=2cos12(A+B)sin12(AB)c. cosA+cosB=2cos12(A+B).cos12(AB)d. cosAcosB=2sin12(A+B).sin12(AB)16. Identitastrigonometri:a. sin2 +cos2=1b. tan =sin cos c. ctan =cossind. sec =1cose. cosec =1sinf. ctan =1tang. tan =1c tan h. tan2 +1=cosec2i. ctan2 +1=cosec217. Rumusdasarpenyelesaianpersamaantrigonometri:a. sinx=sin,maka:1) x=+k360ataux=+k22) x=180+k360ataux=+k2b. cosx=cosa,maka:1) x=+k360ataux=+k22) x=+k360ataux=+k2c. tanx=tan,maka:x=+k180ataux=+k18. Rumuspengubahbentukpenjumlahanmenjadiperkaliantrigonometri:a. cos(A+B)+cos(AB)=2cosAcosBb. cos(AB)cos(A+B)=2sinAsinBc. sin(A+B)+sin(AB)=2sinAcosBd. sin(A+B)sin(AB)=2cosAsinBUntukmenyelesaikanacosx+bsinx=cdiubahmenjadikcos(xa)=cdengan2 2k a b = + danbatan = .MatematikaXISMK/MAK 33EvaluasiKompetensiA. Pilihlah jawaban yang tepat!1. Nilaidaricos135adalah....a. 123 d.122b. 123 e.123c.1332. Jikatan=513(dikuadranIV)makasec=....a. 135d.1312b. 125e.135c.12133. Selembartripleksepertigambardengan=60,BC = 18 cm, dan CD = 22 cm. Panjang ABadalah...cm.a. 18 3b. 20 3c. (22+6 3 )d. 28 3e. 404. Koordinatcartesiustitik(4,330)adalah....a. (2 3 ,2) d. (2,2 3 )b. (2 3,2) e. (2,2 3)c. (1,2 3 )5. Koordinatkutubtitik(1, 3 )adalah....a. (4,210) d. (5,240)b. (2,240) e. (2,210)c. (2,225)6. Nilaicos()padabentuksepertigambardisampingadalah....a.1665b.3365c.6365d.4865e.56657. Jikatan2x+1=a2makasin2x=....a.22(1 ) aad.+22( 1)aab. +22( 1)aae.22( 1) aac.21aA E BD C18

cm22cm4123Trigonometri 348. Faktordayadarisuatumotorlistrikdinyatakandenganrumus(p1+p2)tan = 3 (p1p2).Jikap1=6kmdanp2=3kmmakabesarnya adalah....a. 15 d. 90b. 60 e. 45c. 309. PadasegitigaABCdiketahuia+b=10cm,sudutA=30danB=45makapanjangb=...cm.a. 5( 2 1) d. 10( 2 +2)b. 5(2 2 ) e. 10( 2 +1)c. 10(2 2 )10.( ) 1 cos xsin x=....a.( ) 1 cos xsin xd. 1cos xsin x +b. 1cos xsin xe. 1sin xcos x +c. 1sin xcos x B. Kerjakan soal-soal berikut!1. Jikasin=817dancos=35untukdansudutlancip,tentukannilaidaribentuktrigonometridibawahini!a. sincoscossin c.+1tan tantan tan b. 2sincos2. TentukanluasABCjikadiketahuiunsur-unsurnyasebagaiberikut!a. a=7cm,b=9cm,dan=72b. b=24cm,c=30cm,dan=45c. c=40cm,a=14cm,dan=603. Sederhanakanlah!a. 7515 75 15cos cossin sin + b. 73 93sin A sin Asin A sin A+4. Buktikanbentukpersamaanberikut!a. cosA(1tanA)=cosAsinA c. tan A cot Atan A cot A+=212 A 1 sin b. 2cos2A1=12sin2A5. Daffa mengamati puncak sebatang pohondenganmembentuksudutelevasi36denganpermukaantanah.Daffabergerakmendekatipohonsejauh30mdenganmembentuksudutelevasiyangbarusebesar48.Hitunglahtinggipohon!3648Mesin Frais CNCDi dalam memroduksi bentuk suatu benda dikenal adanya beberapa jenis mesinproduksi, antara lain mesin milling CNC, mesin frais, dan mesin bubut. Mesin bubutadalah salah satu alat perkakas yang bersifat universal. Mesin ini digunakan untukmenghasilkan benda-benda berbentuk silindris, ulir, kerucut, dan bola. Sedangkanmesin frais digunakan untuk menghasilkan benda-benda berbentuk bidang-bidangdatarataubengkoksebelah,antaralainalursambungan,bidangrata,danrodagigi. Dari penjelasan tersebut dapat diambil kesimpulan bahwa mesin bubut danmesin frais dapat menghasilkan bermacam-macam benda kerja. Sebaliknya, satubendakerjahanyadapatdihasilkanolehsatumesinproduksi.Jikahaltersebutdikaitkan dalam matematika, benda kerja diumpamakan sebagai fungsi dari mesinproduksi.Didalammatematikafungsiterdiriatasberbagaimacam,antaralainfungsilinear, fungsi kuadrat, fungsi eksponen, fungsi logaritma, dan fungsi trigonometri.Lebih lanjut mengenai fungsi akan kita pelajari pada bab berikut.Sumber: www.abltechnology.com35 Matematika XI SMK/MAK36 FungsiPengertianRelasidanFungsiPemilu (Pemilihan Umum) di Indonesia diadakan setiaplima tahun sekali. Pada pesta demokrasi ini para pemilihyang memenuhi syarat berhak untuk memilih salah satucalon presiden (capres) yang akan menjabat sebagai kepalanegara Indonesia selama lima tahun ke depan. Di dalamprosespemilu,perhitungansuaradilakukansetelahmenyelesaikan pencatatan hasil surat suara yang dinya-takan sah. Salah satu syarat surat suara dinyatakan sahapabilapemilihhanyamencoblossatugambarcalonpresiden dan tidak boleh lebih.Uraian di atas dapat menyatakan hubungan sebagaiberikut. Seorang pemilih hanya berhak memilih satu calonpresiden, sedangkan satu calon presiden dapat dipilih olehlebihdariseorangpemilih.Diagramilustrasikeadaantersebut sebagai berikut.Pemilih 1Pemilih 2 Capres APemilih 3 Capres BPemilih 4Capres CPemilih 5Penulisan diagram seperti di atas dan sifat-sifat yang berlaku di dalamnyadisebutfungsidanpenghubungantarapemilihdengancapres(ditunjukkandengan panah) disebut relasi.A. Pengertian Relasi dan Fungsi1. RelasiUntuk memahami konsep relasi, perhatikanlah contoh berikut.Diketahui dua buah himpunan, himpunan A yang beranggotakan nama-nama anak, yaitu Nia, Doni, Cica, dan himpunan B beranggotakan jenis-jenis makanan, yaitu bakso, mi, dan soto. Kedua himpunan tersebutapabila ditulis dalam bentuk himpunan, diperoleh:A = {Nia, Doni, Cica}B = {bakso, mi, soto}Ketiga anak tersebut diberi pertanyaan tentang makanan kesukaannyadan diperoleh hasil sebagai berikut.1. Nia suka makan bakso.2. Doni suka makan bakso dan mi.3. Cica suka makan mi dan soto.UraianMateriSumber: www.cetro.go.idProses penghitungan suara di salah satu TPS37 Matematika XI SMK/MAKHasil tersebut dapat ditulis dalam bentuk diagram sebagai berikut.Himpunan A dan himpunan B dalam diagram di atas menggunakanrelasi yang dinyatakan dengan diagram panah. Diagram panah di atasmenyatakanbahwahimpunanAberelasisukamakandenganhimpunan B.Dari uraian tersebut, diperoleh pengertian mengenai relasi sebagaiberikut.Suatu relasi dari himpunan A ke himpunan B adalah pasangan ataukorespondensianggotaAdengananggotaB.DaerahhimpunanAdisebut domain (daerah asal). Daerah himpunan B disebut kodomain(daerah kawan).Selain dengan diagram panah suatu relasi dapat dinyatakan dalampasangan berurutan dan grafik sebagai berikut.Relasi dalam pasangan berurutan:R = {(Nia, bakso), (Doni, bakso), (Doni, mi), (Cica, mi), (Cica, soto)}.Relasi dalam grafik:Dalam bentuk grafik berikut Nia, Doni, dan Cica dilambangkan denganN, D, dan C, dan makanan bakso, mi, dan soto dilambangkan oleh x, y,dan z.Relasi dari dua himpunan ditulis dengan lambang R sesuai denganpengertian berikut.Relasi dariAkeBadalahhimpunanbagiandariABditulisR A B. Apabila A = B maka relasi dari A ke B disebut relasi pada Aatau relasi pada B.Dalambentukpasanganberurutan,relasisecaragrafikdiatasdapat ditulis sebagai berikut.R = {(N, x), (D, x), (D, y), (C, y), (C, z)}Contoh:Diketahui himpunan A = {2, 3, 4} dan himpunan B = {2, 3, 4, 6}.a. Dengan diagram panah, tunjukkan relasi faktor dari himpunan Ake himpunan B!b. Tuliskan relasi di atas dalam bentuk pasangan berurutan!c. JikapasanganberurutandinyatakansebagaihimpunanRmakatentukan n(R)! n(R) = banyaknya himpunan anggota R.d. Gambarkan grafik relasi di atas!NiaDoniCicaABaksoMiSotoBBzyxN D C A38 FungsiPenyelesaian:a. A = {2, 3, 4}B = {2, 3, 4, 6}b. R = {(2, 2), (2, 4), (2, 6), (3, 3), (3, 6), (4, 4)}c. n(R) = 6, yaitu banyaknya anggota himpunan Rd.2. FungsiatauPemetaanUntuk memahami pengertian fungsi, perhatikan gambar berikut.(i) (ii)Padagambar(i)dapatdilihatbahwasetiapanggotahimpunanAberpasangandengantepatsatuanggotahimpunanB.Relasiyangmemiliki ciri demikian disebut dengan fungsi ataupemetaan.Pada gambar (ii) dapat dilihat bahwa sebuah anggota himpunan TberpasangandenganduaanggotahimpunanP.Dalamhaldemikianrelasipadagambar(ii)bukanmerupakanfungsi.Dariuraiandiatasdapat didefinisikan sebagai berikut.Relasi dari himpunan A ke himpunan B disebut fungsi atau pemetaanjika dan hanya jikasetiapanggotahimpunanAberpasangantepathanya satu dengan anggota himpunan B.Atau:Fungsi atau pemetaan dari himpunan A ke himpunan B adalah relasiyang memasangkan setiap x A dengan tepat satu y B.Jadi, fungsi adalah keadaan khusus dari relasi. Dalam fungsi, setiapanggota daerah hanya memunyai tepat satu pasangan dengan anggotadaerah kawan. Fungsi yang memetakan setiap x A ke y B dinotasikan:a. f : x y ataub. f : x f(x)AB64322 3 4Perlu Tahun(R)menyatakanbanyak-nya anggota dari relasi R.AB2342346RA B T P123123ABC456739 Matematika XI SMK/MAKXY522 522Y2XContoh:Diketahui fungsi f(x) = 2x + 5 dengan f : A R, A = {0, 1, 2, 3, 4}.Tentukan hasil:a. daerahasal,b. daerah hasil, danc. grafiknya.Penyelesaian:a. Daerah asal A = {0, 1, 2, 3, 4} c.b. f(x) = 2x + 5f(0) = 2 0 + 5 = 5f(1) = 2 1 + 5 = 7f(2) = 2 2 + 5 = 9f(3) = 2 3 + 5 = 11f(4) = 2 4 + 5 = 13Daerah hasil = {5, 7, 9, 11, 13}B. Macam-Macam FungsiDalam matematika terdapat bermacam-macam fungsi, dua di antaranyasebagai berikut.1. FungsiKonstanFungsi konstan dapat dirumuskan f(x) = c untuk setiap x D(f ).(c = konstanta, D(f ) = domain)Contoh:f(x) = 2, berapa pun nilai x maka nilai fungsinya tetap 2.2. FungsiIdentitasFungsi identitas memetakan setiap x D(f ) ke dirinya sendiri dandirumuskanf(x) = x .Contoh:f(x) = x, maka f(2) = 2, f(5) = 5, f(2) = 2, dan seterusnya.f(x)1311975012 34 X40 FungsifAB123abcdfAB1234abcdfAB1234abcfAB123abc1. FungsiOntoDiberikan himpunan A = {1, 2, 3} dan B = {a, b, c, d}.Fungsi f : x A y B disebut fungsi onto jika ada y B bukanpasangan dari x A.Perhatikan gambar di samping, dalam himpunan A terdapat bdan dyang bukan merupakan peta dari himpunan A.f = {(1, a), (2, a), (3, c)}2. FungsiInjektifDiberikan himpunan A = {1, 2, 3, 4} dan B = {a, b, c, d}.Fungsi f : x A y B disebut fungsi injektif jika setiap y Bmemiliki kawan tunggal di x A. Fungsi injektif disebut jugafungsi satu-satu. Apabila f(x1) = f(x2) maka x1 = x2 atau jika f(x1) f(x2) maka x1 x2.f = {(1, a), (2, d), (3, b), (4, c)}3. FungsiSurjektifDiberikan himpunan A = {1, 2, 3, 4} dan B = {a, b, c}.Fungsi f : x A y B disebut fungsi surjektifjika setiap y B memiliki pasangan x A atau setiap anggota himpunan daerahkawan memiliki pasangan di daerah asal.f = {(1, a), (2, c), (3, b), (4, c)}4. FungsiBijektifFungsif:xAyBdisebutfungsibijektifjikafungsitersebutinjektifsekaligussurjektif(korespondensisatu-satu)dengan ketentuan n(A) = n(B).f = {(1, c), (2, b), (3, a)}Latihan 1Kerjakan soal-soal berikut!1. Dari fungsi-fungsi yang disajikan dalam diagram panah berikut, manakahyang merupakan fungsi onto, injektif, atau bijektif?a. b.C. Sifat-Sifat FungsiBerikut ini beberapa sifat fungsi.41 Matematika XI SMK/MAKARB2342346c. e.d.2. Suatu relasi R dinyatakan dalam himpunan pasangan berurutan R = {(a, 1),(b, 2), (b, 3), (c, 2), (a, 6), (d, 7)}.a. Tentukan domain dari R!b. Tentukan kodomain dari R!c. Apakah R merupakan fungsi?3. SuaturelasiRdinyatakandengandiagram panah di samping.a. Apakah R merupakan fungsi?b. Jika R fungsi, nyatakan R sebagairumus f(x).4. Tuliskanrangefungsidarif(x)=4x2jikadiketahuiketentuansebagaiberikut!a. Domain fungsi Df ; {2, 1, 0, 1, 2}b. Domain fungsi Df ; {x|2 x 2}c. Domain fungsi Df ; {x|x R}5. Gambarlah grafik fungsi f(x) = x2 4 dengan domain fungsi sebagai berikut!a. Df ; {2, 1, 0, 1, 2}b. Df ; {x|2 x 2}c. Df ; {x|x R}42 FungsiDiarenabalap,setiappembalaptentunyainginmemaculajukendaraandengan secepat-cepatnya. Akan tetapi, ada saat pembalap harus mengurangikecepatanlajukendaraannyasepertiketikaberadaditikungan.Halinidilakukanuntukmenghindariselip(hilangnyakontrolterhadapkendaraan).Dengan demikian, kecepatan kendaraan yang dipacu oleh pembalap dari detikpertama ia menjalankan kendaraan hingga detik ke-tbesarnya berubah-ubah.Hubungan antara kecepatan (v) dengan waktu (t) dapat kita gambarkan dalamkoordinat cartesius dengan waktu (t) sebagai sumbu X dan kecepatan (v) sebagaisumbu Y. Apabila titik-titik yang bersesuaian saling dihubungkan maka akankita peroleh grafik berupa garis lurus yang disebut grafik fungsi linear. Apakahyang dimaksud dengan fungsi linear? Sifat apa sajakah yang dimiliki oleh fungsilinear?Untukmenemukanjawabannyaterlebihdahulukitapelajariuraianberikut.FungsiLinearA. Grafik Fungsi LinearBentuk umum persamaan fungsi linear ditulis: y = ax + b dengan adan b R, a 0.Grafikfungsilinearberupagarislurusyangdiperolehdenganmenghu-bungkantitikpotongdengansumbuXdansumbuYpadakoordinatcartesius. Perhatikan contoh berikut.Contoh:Gambarlah grafik yang persamaannya y = 3x 4.Untuk menggambar grafik fungsi linear dapat digunakan dua cara, yaitudengan:1. Tabel.Persamaan garis adalah y = 3x 4.Y85204234 XUraianMateriy = 3x 4x y Titik0 4 (0, 4)1 1 (1, 1)2 2 (2, 2)3 5 (3, 5)4 8 (4, 8)Sumber: www.motogranprix.comPembalap sedang berlaga di arena balap43 Matematika XI SMK/MAKgarisy=3x4(43,0)(0,4)YX0XY210132. Menentukan titik potong dengan sumbu X dan sumbu Y.a. Perpotongan dengan sumbu X, syaratnya y = 0. y = 3x 4 0 = 3x 4 3x = 4 x =43Jadi, koordinat titik potongnya (43, 0).b. Perpotongan dengan sumbu Y, syaratnya x = 0. y = 3x 4 y = 3 0 4 y = 4Jadi, koordinat titik potongnya (0, 4).Jika titik potong sumbu X dan titik potong sumbu Y dihubungkan makaterbentuklah garis y = 3x 4.B. GradienGradienadalahangkakemiringangrafikataukoefisienarahgaris.Gradien disebut juga kemiringan garis terhadap sumbu X positif. Gradiendinotasikan dengan huruf m.JikasudutyangdibentukantaragaristerhadapsumbuXpositifdinyatakan dengan dan gradien dinyatakan m, maka:m = tan = komponen ykomponen x = 2 12 1y yx xSifat-sifat grafik fungsi linear berdasarkan nilai m sebagai berikut.1. Jika m = 0 maka grafik sejajar sumbu X.2. Jika m > 0 maka grafik condong ke kanan (0 < < 90).3. Jika m < 0 maka grafik condong ke kiri (90 < < 180).4. Jika m = maka grafik sejajar sumbu Y.Contoh:Hitung gradien garis lurus yang melalui titik A(3, 2) dan B(1, 1)!Penyelesaian:m = 2 12 1y yx x = 1 21 3 = 12 = 12Diperoleh grafik seperti di samping.YXYXYXYX44 FungsiC. Menentukan Persamaan Garis Melalui Satu Titikdengan Gradien mPersamaan garis melalui satu titik A (x1, y1) dengan gradien m, dapatditentukan dengan rumus:y y1 = m(x x1)Jika melalui titik O(0, 0) dengan gradien m maka persamaannya y = mx.Contoh:TentukanlahpersamaangarisyangmelaluititikP(2,1)danmemilikigradien 2!Penyelesaian: y y1= m(x x1) y 1 = 2 (x (2)) y = 2x + 2 + 1 y = 2x + 3Jadi, persamaan garis yang terbentuk adalah y = 2x + 3.D. Menentukan Persamaan Garis yang Melalui DuaTitikPersamaangarisyangmelaluiduatitikA(x1,y1)danB(x2,y2)dapatditentukan dengan rumus:12 1y yy y = 12 1x xx x atau y y1 = m(x x1) dengan m = 2 12 1y yx xPersamaan garis yang melalui A(a, 0) dan titik B(0, b) adalah bx + ay = abatau y = bax + ab.Contoh:Tentukan persamaan garis yang melalui titik A(1, 2) dan B(2, 5)!Penyelesaian:12 1y yy y=12 1x xx x( 2)5 ( 2)y =12 1x 23y +=11x y + 2 = 3(x 1) y = 3x + 3 2 y = 3x +1Jadi,persamaangarisyangterbentukadalahy=3x+1dengan grafik seperti di samping.X025garisy=3x+1Y1 2E. Menentukan Sudut yang Dibentuk oleh GrafikFungsiBesarnyasudutyangdibentukolehgrafikfungsilinearataugaristerhadap sumbu X positif dapat ditentukan dengan gradiennya.tan = m = arc tan m45 Matematika XI SMK/MAK garis 2x y = 0 garis 3x + y = 6XY601 2Y1X0,83130Contoh:Tentukan besarnya sudut yang dibentuk oleh garis 2 3 x 6y = 5!Penyelesaian:2 3x 6y = 5 6y = 5 2 3x y =133x + 56Dengan melihat hasil akhir persamaan makam =133tan =133 = arc tan 133 = 30F. Menentukan Titik Potong Dua GarisTitikpotongduabuahgarisdapatditentukandengancaraeliminasidan substitusi.Contoh:Tentukan titik potong garis 3x + y = 6 dengan garis 2x y = 0!Penyelesaian:3x + y = 6 2 6x + 2y = 122x y = 0 3 6x 3y = 05y = 12 y =125Dapat dicari nilai x sebagai berikut.2x y = 0 2x 125 = 0 2x =125 x =1210Jadi, kedua garis berpotongan di koordinat 12 12,10 5 .G. Hubungan Dua Garis1. HubunganDuaGarisBerpotonganTegakLurusDua garis saling berpotongan tegak lurus jika m1 m2 = 1 (hasil kalikedua gradien sama dengan 1). Dengan kata lain kedua garis salingmembentuk sudut siku-siku (90).Contoh:Tentukanlah persamaan garis yang melalui titik (1, 2) dan tegak lurusterhadap garis 3y 6x + 9 = 0!Penyelesaian:Misal garis 3y 6x + 9 = 0 dinyatakan dengan garis /.Menentukangradiendiperolehdenganmengubahpersamaan3y 6x + 9 = 0 ke bentuk umum persamaan garis y = mx + c, yaitu:3y 6x + 9= 0 y = 2x 3 (gradien garis /(m1) = 2)Dua garis tegak lurus jika:m1 m2= 1 2 m2= 1diperoleh m2 = 12.garis2 3 x6y=546 FungsiAplikasiPersamaan garis yang dicari dengan gradien 12 dan melalui titik (1, 2)sebagai berikut.y y1= m(x x1) y 2 = 12(x (1)) y = 12x 12 + 2 y = 12x + 112 2y = x + 3Diperoleh grafik seperti di samping.2. HubunganDuaBuahGarisyangSejajarDua buah garis saling sejajar jika m1 = m2 (gradiennya sama).Contoh:Tentukan persamaan garis yang melalui titik (2, 4) dan sejajar dengangaris 3y + 9x + 6 = 0!1. Suatu pengangkutan dikerjakan dengan mesin yang memiliki tenaga Edan beban w. Hubungan antarvariabel diberikan dengan f : w aw + batau E = aw + b. Diketahui f (10) = 8,9 kg dan f (30) = 19,1 kg. Tentukanpenyelesaian dari soal-soal di bawah ini.a. nilai a dan bb. grafik fungsi tersebutPenyelesaian:a. Diketahui E = aw + bw = 10 a 10 + b = 8,9 10a + b = 8,9w = 30 a 30 + b = 19,1 30a + b = 19,120a = 10,2 20a = 10,2 a = 0,51Penyelesaian:Menentukangradiengaris/13y+9x+6=0diperolehdenganmengubah ke bentuk umum persamaan garis y = mx + c, yaitu:3y + 9x + 6 = 0 3y = 9x 6 y = 3x + 2Jadi, gradien garis /1 adalah 3. Karena disyaratkan sejajar makagradien garis /2 juga 3. Diperoleh persamaan sebagai berikut.y y1= m2(x x1) y (4) = 3(x 2) y + 4 = 3x 6 y = 3x 10Jadi,salahsatugarisyangsejajardengan3y+9x6=0adalahy = 3x 10.XYgarisy=3x102112910323103garis3y+9x+6=04 (2,4)/ garis 2y = x + 3XY garis 3y 6x + 9 = 033232347 Matematika XI SMK/MAKNilaia=0,51disubstitusikankepersamaan10a + b = 8,9 10(0,51) + b = 8,9 5,1 + b = 8,9 b = 3,8Jadi, nilai a = 0,51 dan b = 3,8b. Grafik fungsi E = a + b19,18,90E1030A Bfgf(x)yxg(y)2. Diketahuihubunganantarakecepatan(V)danwaktu(t)tampaksepertipadagambartabel berikut.t 1 2 3 6V 8,9 10,3 11,7 15,9Hubungan antara V dan t dinyatakan denganV = at + b. Tentukan nilai a dan b.Penyelesaian:Diketahui persamaan V = at + b.t = 1 a 1 + b = 8,9 a + b = 8,9t = 3 a 3 + b = 11,7 3a + b = 11,72a = 2,8 a = 1,4Nilai a = 1,4 disubstitusikan ke persamaana + b = 8,91,4 + b = 8,9 b = 7,5Jadi, nilai a = 1,4 dan b = 7,5.H. Invers Fungsi LinearPerhatikan gambar.Jika f dan g fungsi bijektif, sertaf: A Bmaka peta setiap x A adalah y B ditulisy=f(x).Jikag:BAmakapetasetiapy BadalahxAdanditulisx=g(y).Dengan demikian dapat dikatakan bahwaf dan g saling invers. Fungsi g merupakaninversdarifditulisg=f1danfmeru-pakaninversdarig ditulisf=g1.Jadi,invers dari f dinotasikan dengan f1.Contoh:1. Diberikan fungsi f(x) = 3 22 4xx+,x 2, tentukan f1(x)!Penyelesaian:f(x) =3 22 4xx+, x 2.Dapat dinyatakan:y =3 22 4xx+y (2x + 4) = 3x 2 2xy + 4y = 3x 2 2xy 3x = 4y 2 x (2y 3) = 4y 2 x =(4 2)(3 2 )yy + f1(y) =4 23 2yy+Jadi, f1(x) = 4 23 2xx+.2. Tentukan f1(x) dari f(x) = 15 x .Penyelesaian:f(x) = 15 x y =15 x x 5 =1y x =1y + 5 f1(y) =1y + 5 f1(x) =1x + 5Jadi, f1(x) = 1x + 5.48 FungsiLatihan 2Kerjakan soal-soal berikut!1. Tentukan gradien garis yang melalui dua titik berikut!a. (1, 2) dan (2, 4) c. (1, 1) dan (2, 1)b. (0, 1) dan (1, 3)2. Tentukan titik potong dua garis dengan persamaan berikut!a. 4x + 5y = 14 dan x 3y = 5 b. 2x 5y = 1 dan x + 2y = 43. Tentukan persamaan garis lurus yang tegak lurus dengan garis 2x y = 5dan melalui titik potong garis 2x + y 2 = 0 dengan sumbu X!4. Tentukan fungsi invers dari fungsi-fungsi berikut ini!a. f(x) = 12 x + 4 d. f(x) = 5 3xb. f(x) = 8x 23e. f(x) = 2x 6c. f(x) = 4 5x5. Diberikan f(x) = 1 + 22 x dan f1(m) = 1. Tentukan nilai m!6. Rumuskecepatanpermukaangerinda(s)dinyatakanolehdiameterrodagerinda (d) dengan s = 12 d dengan = 1.200 ppm, d dalam inchi dans dalam fpm.a. Tentukan harga s untuk d = 7,6 dan d = 10,5!b. Gambarlah grafiknya!7. KecepatansebuahmotordinyatakandalamVdengansatuanm/detdandisajikandenganpersamaanV=mt+n.HubunganantaraVdantdinyatakan dalam bentuk tabel sebagai berikut.t 2 4 6 8V 19,1 23,1 27,1 35,1a. Tentukan nilai m dan n!b. Gambarkan grafiknya!c. Tentukan harga V, jika t =15 detik!8. Hambatan pada sebuah penghantar pada suhu t = 100C diberikan denganrumus: Rt = Rr {1 + a(tt tr)}denganRt = hambatan pada suhu tinggi tr= suhu rendahRr = hambatan pada suhu rendah a = koefisien suhutt= suhu tinggi Rt = f(t) = f(tt tr)Jika Rr = 100 ohm, tr = 15C, dan a = 0,00017C, tentukan unsur-unsurberikut!a. Rt pada suhu (tt) = 60C b. Rt pada suhu (tt) = 85C9. Padarangkaiankapasitasdalamarusbolak-balikdiperolehreaktansikapasitatif yang dirumuskan dengan xc = 12cF dengan c dinyatakan dalamfarad (F). Jika kapasitor (c) tetap maka xc merupakan fungsi dari f (frekuensi).Dengan demikian dapat ditulis xc = F(f) dengan c = 70F. Tentukan operasiberikut!a. Nilai Xc untuk f = 10 Hz, f = 15 Hz, dan f = 20 Hz.b. Gambar grafik hubungan Xc dan f.10. Gambarkan grafik fungsi untuk data berikut!R (ohm) 0,5 0,75 1 2 5 10I (ampere) 3 1,9 1,4 0,75 0,3 0,1549 Matematika XI SMK/MAKRoda adalah piranti kendaraan bermotor yang memegang peranansangatpenting.Rodaterdiriatasbagian-bagianyaituban,velgataurim,danjari-jari.Permukaanrodatelahdidesaindenganbaikdansesuai dengan permukaan jalan sehingga dapat memberikan gaya traksi(dorong) atau gaya rem yang tepat tanpa terjadi slip pada kendaraan.Rim pada ban dibuat dari baja atau aluminium sehingga memiliki sifatkuat di berbagai kondisi jalan. Rim dihubungkan dengan jari-jari yangberfungsi untuk menahan beban dalam daerah radial, tangential, danlateralsehinggajari-jaritersebutdapatmenampungperubahan-perubahan dari beban tumbukan. Kondisi dari bagian-bagian pada rodaperlu dirawat dengan baik sehingga tidak mengganggu perputaran roda.Salahsaturumusperputaranrodayangberputarselamatdetikdiberikan dengan persamaan berikut. = 60t 13t2Di dalam matematika, persamaan di atas disebut persamaan kuadrat yangmemilikipenyelesaianatastdangrafiknyaberupaparabola.Lebihlanjutmengenai persamaan kuadrat akan kita pelajari pada uraian berikut.A. Grafik Fungsi KuadratPada matematika kelas X bab 3 telah dipelajari tentang fungsi kuadrat.Bentuk umum fungsi kuadrat adalah f(x) = ax2 + bx + c, dengan a, b, dan cbilangan real, a 0. Grafik yang dibentuk oleh fungsi kuadrat berbentukparabola. Fungsi f(x) = ax2 + bx + c dapat juga ditulis y = ax2 + bx + c,dengan unsur-unsur sebagai berikut.Diskriminan D = b2 4acSumbu simetri x =2baNilai ekstrim y =4DaKoordinat titik puncak P,2 4b Da a Bentukfungsikuadratyanglainadalahy=a(xxp)2+ypdengankoordinat titik puncak (xp, yp).FungsiKuadratSumber: www.bearperkins.comSalahsatupenampangrodaUraianMateriTugasMandiriFungsikuadratmudahdi-jumpaidalambidangteknik.Lebihmudahlagijikakalianmencari dalam pembahasantentanggerakparabolik.Cobacaribeberapacontohterapan fungsi kuadrat denganmenggunakanmesinpencari(misalnyawww.google.com).50 FungsiSifat-sifat grafik fungsi kuadrat berdasarkan nilai a dan D:D < 0 D = 0 D > 0a < 0a > 0Tidakmenyinggungsumbu X(definitifnegatif)MenyinggungsumbuX di satu titikMenyinggungsumbuX di dua titikTidakmenyinggungsumbu X(definitifpositif)MenyinggungsumbuX di satu titikMenyinggungsumbuX di dua titikB. Langkah-LangkahMenggambarGrafikFungsiKuadratBerikutdiberikanlangkah-langkahdalammenggambargrafikfungsikuadrat.1. Menentukan sumbu simetri yaitu x = 2ba.2. Menentukan titik puncak yaitu P(x, y) dengan x = 2ba dan y = 4Da.3. Menentukan titik potong dengan sumbu Y (syarat x = 0).4. Bila D > 0 tentukan titik potong dengan sumbu X (syarat y = 0).5. Bila D 0 tentukan beberapa titik di sekitar sumbu simetri.Contoh:1. Gambarlah grafik dari y = x2 + 4x!Penyelesaian:Dari persamaan y = x2 + 4x diperoleh a = 1, b = 4, dan c = 0. D = b2 4ac= (4)2 4(1)(0)= 16 Sumbu simetri x = 2ba = 42( 1) = 2 y = 4Da = 164( 1) = 4Nilai balik maksimum adalah 4.Jadi, titik puncak (2, 4). Titik potong dengan sumbu X diperoleh jika y = 0. x2 + 4x = 0 x (x + 4) = 0 x = 0 atau x = 4Jadi, titik potong dengan sumbu X adalah (0, 0) dan (4, 0).X X XX X X51 Matematika XI SMK/MAK Titik potong dengan sumbu Y diperoleh jika x = 0.y = (0)2 + 2(0) = 0Jadi, titik potong dengan sumbu Y adalah (0, 0).Grafik fungsi kuadrat dengan persamaan y = x2 + 4x sebagai berikut.2. Gambarlah grafik dari y = x2 4x 5!Penyelesaian:Diketahui persamaan y = x2 4x 5, diperoleh a = 1, b = 4, c = 5. Grafik memotong sumbu X, jika y = 0.x2 4x 5 = 0 (x + 1)(x 5) = 0 (x + 1) = 0 atau (x 5) = 0Jadi, grafik memotong sumbu X di titik (1, 0) dan (5, 0). Sumbu simetri x = 2ba = ( 4)2 1 = 2Nilai maksimum y =4Da = 2( 4 )4b aca =2((4) 4( 1)(5))4 1 =(16 20)4 + = 9Jadi, koordinat nilai balik minimum (2, 9). Titik potong dengan sumbu Y, jika x = 0y = x2 4x 5= (0)2 4(0) 5= 5Jadi, koordinat titik potong dengan sumbu Y adalah (0, 5).Dari keterangan di atas, diperoleh grafik seperti di bawah.YX40 2grafiky=x2+4xYX25 159(2,9)grafiky=x24x552 FungsiLatihan 3Kerjakan soal-soal berikut!1. Diketahui y = x2 x + 2 dengan D(f ) = {x|4 x 3).Tentukan unsur-unsur dari grafik berikut!a. Titik potong dengan sumbu X dan Y.b. Sumbu simetri.c. Koordinat titik puncak.d. Gambarlah grafiknya!2. Tentukan batas-batas nilai m supaya grafik y = (m 2)x2 2mx + (m + 6)seluruhnya di atas sumbu X!3. Sebuah balok AB dengan beban terbagi rata q kg/mdijepitpadaB.Diperolehpersamaangarisgayalintang D dan garis momen M dengan Mx = 12qx2.GambarlahgarisMxdenganMxsebagaisumbutegak, melalui A, dan memiliki arah ke bawah dan xadalah sumbu mendatar!4. Putaran sebuah roda selama t detik menempuh sudut radian. Persamaanputaran roda adalah = 50t 23t2.a. Tentukan besarnya untuk t = 3 detik dan t = 6 detik!b. Gambarkan grafiknya!5. DayayangditimbulkanolehsuatuturbindiberikandenganpersamaanP = uv u2. Diketahui v = 40 m/detik.a. Tentukan nilai P untuk u = 15 dan u = 20!b. Gambarkan grafik dari persamaan P = 40u u2!LA Bx2kg/mq=20kg/m53 Matematika XI SMK/MAKMenerapkanKonsepFungsiKuadratA. Menentukan Persamaan Fungsi KuadratDaripersamaanfungsikuadraty=ax2+bx+cdapatkitaperolehkoordinattitikpotonggrafikdengansumbuXdansumbuY,persamaansumbusimetri,titikbalikmaksimum/minimum,danbentukgrafiknya.Demikianpulasebaliknya,dariunsur-unsurtersebutdapatkitasusunsebuah fungsi kuadrat yang sesuai dengan rumus sebagai berikut.1. DiketahuiKoordinatTitikPotongGrafikdenganSumbuXApabila diketahui koordinat titik potong dengan sumbu X yaitu (x1, 0)dan (x2, 0) maka bentuk persamaan kuadratnya adalah:(x x1)(x x2) = 0 x2 (x1 + x2)x x1x2= 02. Diketahui Koordinat Titik Puncak dan Koordinat yang LainApabiladiketahuikoordinattitikpuncak(xp,yp)dankoordinatyanglain maka bentuk fungsi kuadratnya adalah:y = a(x xp)2 + yp3. DiketahuiGrafiknyaSebuahgrafikfungsikuadratdilengkapidenganunsur-unsurpadagrafik, antara lain koordinat titik potong grafik dengan sumbu X dansumbu Y, persamaan sumbu simetri, dan titik maksimum/minimum.Selanjutnya,unsur-unsuryangdiketahuitersebutdapatdigunakanuntuk mencari bentuk fungsi kuadrat seperti pada nomor 1 dan 2.Contoh:1. Tentukan persamaan fungsi kuadrat yang memiliki titik puncak (1, 1)dan melalui (0, 3)!Sumber: www.skoda.czPenampang belahan turbinUraianMateriTurbinuapadalahsalahsatumesinkonversienergijenismesin fluida yang menghasilkan energi. Turbin uap mendapatpasokan energi uap yang memiliki temperatur dan tekanan yangtinggi. Energi uap tersebut terekspansi melalui sudu-sudu turbindengantekananyangsecaradrastisditurunkan.Akibatnyaterjadiperubahanenergikinetikpadauap.Perubahanenergitersebutmemutarporosturbindanakhirnyamenghasilkantenaga.Salahsaturumustenaga(daya)yangdihasilkanolehturbin uap sebagai berikut.P = u(v u)u = kecepatan sudutv = kecepatan pancar air dari nozelDari persamaan tersebut kita dapat mencari daya maksimum yang dapatdihasilkan oleh turbin uap. Untuk dapat menyelesaikan permasalahan tersebut,terlebih dahulu kita pelajari uraian pada kegiatan belajar berikut.54 FungsiPenyelesaian:Diketahui koordinat titik puncak adalah (1, 1), diperoleh xp = 1 danyp = 1 serta koordinat titik yang lain (0, 3). Akan dicari nilai a terlebihdahulu.y0= a(x0 xp)2 + yp 3 = a(0 1)2 + (1) 3 = a 1 4 = aDengan demikian, bentuk persamaan fungsi kuadratnya adalah:y = a(x xp)2 + yp y = 4(x 1)2 + (1) y = 4(x2 2x + 1) + (1) y = 4x2 8x + 4 + (1) y = 4x2 8x + 3Jadi, bentuk persamaan fungsi kuadratnya y = 4x2 8x + 3.2. Tentukanbentukpersamaanfungsikuadratyanggrafiknyaseperti gambar di samping!Penyelesaian:Darigrafikdiperolehkoordinattitikpuncakadalah(3,1)dangrafikmelalui titik (0, 3). Dari contoh pada nomor 2, kita dapat mencari nilai aterlebih dahulu.y0= a(x0 xp)2 + yp 3 = a(0 3)2 + 1 3 = 9a + 1 4 = 9a a =49Bentuk persamaan fungsi kuadratnyay = a(x xp)2 + yp y =49(x 3)2 + 1 y =49(x2 6x + 9) + 1 y =49x2 249x + 369 + 1 y =49x2 249x + 459Jadi, bentuk persamaan fungsi kuadrat dari grafik tersebut adalahy = 49x2 249x + 5.B. Menyelesaikan Masalah Program Keahlian yangBerkaitan dengan Fungsi KuadratDi dalam bidang teknik, mengukur merupakan kegiatan yang hampirselaludilakukan.Selainmembutuhkanketelitian,deskripsimengenaibentuk maupun hasil dari pengukuran memegang peranan penting dalamproses mengukur. Sebagai contoh dalam membuat talang air. Tentu talangyangdihasilkandenganmenggunakanbahanyangdisediakanharusmampumenampungairsebanyak-banyaknya.Didalammatematikapermasalahan tersebut dapat diselesaikan dengan fungsi kuadrat.YX(3,1)(0,3)10355 Matematika XI SMK/MAKLangkah-langkahmenyelesaikanterapanyangmenggunakanfungsikuadrat.1. Tentukan bilangan yang tidak diketahui dalam bentuk variabel.2. Susunlahsebuahfungsikuadratberdasarkanrumusyangdigunakan.3. Tentukan sumbu simetri dari fungsi kuadrat.4. Tentukan nilai ekstrim fungsi kuadrat.Perhatikan contoh berikut.Contoh:Selembar seng yang panjangnya p meter memiliki lebar 64 cm. Kedua sisipadapanjangnyaharusdilipatkeatassepanjangxcmuntukmembuattalang. Tentukan:a. kapasitas talang dalam x,b. lebar lipatan pada sisi panjang agar kapasitas maksimum,c. kapasitas maksimum jika panjang seng adalah 3 cm.Penyelesaian:Tentukan bilangan yang tidak diketahui dalam bentuk variabel.Dimisalkan lebar sisi panjang yang dilipat adalah x cm.a. Susunlahsebuahbentukfungsikuadratberdasarkanrumusyangdigunakan.Kapasitas talang air = volume talang air= p / t= p (64 2x) (x)= (64 2x)pxJadi, bentuk fungsi kuadratnya y = 64px 2px2.b. Menentukan sumbu simetri.Diketahuipersamaankuadraty=64px2px2.Diperoleha=2p,b = 64p, dan c = 0.x = 2ba = (64 )2( 2 )pp = 644pp = 16Jadi, nilai x = 16.c. Nilai maksimum fungsi kuadrat untuk p = 3 dan x =16.y = f(x) = f(16)= 64 3 16 2 3(16)2= 1.536Jadi, untuk p = 3 cm talang memiliki kapasitas maksimum 1.536 cm2.(64 2x) cm64cm x cm x cmpm = 100p cm 100pcm 100pcm(64 2x) cm56 FungsiYX32(0,0) (4,0)YX0(2,0) (4,0)Latihan 4Kerjakan soal-soal berikut!1. Tentukan bentuk persamaan kuadrat yang memiliki koordinat titik potonggrafik dengan sumbu X di titik-titik berikut!a. (3, 0) dan (5, 0)b. (152, 0) dan (15, 0)c. (2, 0) dan (92, 0)2. Tentukanbentukpersamaankuadratyangmelaluititikpuncakdankoordinat berikut ini!a. Puncak (6, 36) dan melalui (0, 0)b. Puncak (3, 250) dan melalui (2, 0)c. Puncak (72, 14) dan melalui (4, 12)3. Tentukan bentuk persamaan kuadrat dari grafik-grafik berikut!a. b.4. Sebuahpelatbajaakandipotongmenjadibentukpersegipanjang.Jikakeliling persegi panjang yang diperoleh adalah 80 mm, tentukan panjangdan lebar pelat tembaga agar diperoleh luas maksimum!5. Daya (P) yang ditimbulkan oleh sebuah turbin diberikan dengan persamaanu(v u), dengan u adalah kecepatan sudut dan v adalah kecepatan pancarair dari nozel. Jika v = 40 m/detik, tentukan besarnya kecepatan sudutagar menghasilkan daya maksimum!57 Matematika XI SMK/MAKFungsiEksponenPenemuan benda-benda bersejarah oleh parailmuwanpadaabadke-20mampumemberikangambarankepadakitatentangkehidupanpadamasalalu.Sebagaicontohpenemuanbesardidataran Mesir, yaitu piramida beserta patung singaberkepalamanusia(sphinx).Menurutparaahliarkeolog,salahsatudaritujuhkeajaibanduniatersebut telah dibangun lebih kurang pada 2500 SM.Bagaimanaparailmuwanbisamemper-kirakantahunpembuatankeduapeninggalanbersejarahtersebut?Ternyataperhitungantersebutdiperolehdariperhitungandenganmenggunakan ilmu kimia, yaitu waktu paruh, yangdirumuskan:11212ttoNN =Nt= jumlah zat yang tersisaNo= jumlah zat mula-mulat = waktu peluruhan12t= waktu paruhBentuk rumus di atas menggunakan sistem bilangan berpangkat. Nah, untukmengetahui lebih lanjut mengenai bilangan berpangkat, akan kita pelajari padauraian berikut.A. Fungsi EksponenFungsieksponenadalahfungsiyangmengandungpeubahatauvariabel sebagai pangkat dari suatu konstanta. Bentuk umum fungsieksponen:f : x ax atau f(x) = ax atau y = ax dengan a > 0 dan a 1Pada fungsi eksponen yaitu f(x) = ax, berlaku:1. x disebut peubah dan daerah asal f(x) (domain) dari fungsi eksponenadalah himpunan bilangan real yaitu Df : {x| < x < + , x R},2. a disebut bilangan pokok fungsi dengan syarat a > 0 dan a 1. Dengandemikian berlaku 0 < a < 1 atau a > 1.Fungsi eksponen pada umumnya dibentuk dengan menggunakan bilanganpokok e, yaitu konstanta Napier (e = 2,71828 . . .) atau y = ex.Untuk menyelesaikan permasalahan fungsi eksponen perlu diingat kembalisifat-sifat operasi bilangan berpangkat yang telah kita pelajari pada kelasX bab 1 sebagai berikut.Sumber: www.fyvie.netPiramidaUraianMateriInfoJohnNapier(15501617)adalahilmuwanberkebang-saanSkotlandiayangber-peran dalam perkembanganilmu logaritma.Sumber: Ensiklopedi Matematikadan Peradaban ManusiaJohn Napier58 FungsiContoh:1. Tentukan bentuk sederhana dari 15(32) 212 !Penyelesaian:15(32) 212 =1552 212 =( )1552 21 2= 2 22= 23= 82. Tentukan nilai dari f(x) = 32x 1 untuk x = 2!Penyelesaian:f(x) = 32x1 f(2) = 3221 f(2) = 341 f(2) = 33 f(2) = 27B. Menggambar Grafik Fungsi EksponenFungsieksponenselalumemotongsumbuYdititik(0,1)dantidakmemotong sumbu X.y = ax, untuk a > 1 berupa grafik naikuntuk 0 < a < 1 berupa grafik turunUntuk menggambar sketsa grafik fungsi eksponen dapat dilakukan dengancara sebagai berikut.1. Menentukan beberapa titik yang mudah.2. Gambarlah beberapa titik tersebut pada koordinat cartesius.3. Melalui titik-titik tersebut dibuat kurva yang mulus.Contoh:1. Gambarlah grafik fungsi eksponen f(x) = 2x!Penyelesaian:Untuk menentukan titik-titik, dapat menggunakan tabel seperti berikut.x f(x) = 2x1 21= 120 20= 11 21= 22 22= 43 23= 8Grafikfungsieksponendenganpersamaanf (x)=2xsepertidisamping.Kilas Balik1. am an = am + n2.mnaa = am n3. (am)n=amn4. (a b)m = am bm5.( )mab= mmab6. am = 1ma7. a0 = 18.( )mab= mmba9.n ma= mnaXY84210 12 3 1grafikf(x)=2x59 Matematika XI SMK/MAK2. Gambarlah grafik fungsi y = 12x !Penyelesaian:Dapat dibuat tabel:x y = 12x2212 = 41112 = 20012 = 11112 =122212 =14Latihan 5Kerjakan soal-soal berikut!1. Gambarlah grafik fungsi eksponen dengan persamaan berikut!a. y = 4xc. y = 2 3xe. y = 14x b. y = 3xd. y = 2 4xf. y = 13x 2. Tentukan nilai dari f(x) = 1315425xx untuk x = 5!3. Tentukan nilai dari f(x) = 145 32x xx untuk x = 2!4. Tentukan nilai x yang memenuhi f(x) = 3 425x + = 125!5. Tentukan nilai x yang memenuhi persamaan berikut!a. 53x 4 = 5x + 2b.222x x = 16x 2c.2 113x + = 2127x Y841210 1 2 3Xgrafiky= 12x 60 FungsiUraianMateriFungsiLogaritmaSumber: www.home.zcu.czTransformatorEnergilistrikyangdisalurkanmelaluipembangkitlistrikdikirimkandengancaramengubah-ubah proporsi voltase (tegangan listrik)danampere.Voltaseyangrendahdapatmeng-hantarkan arus yang kuat dan voltase yang tinggimenghantarkan arus yang lemah.Perhitungan tegangan listrik pada umumnyadinyatakan dengan rumus:V = V0ektV = tegangan listrikV0= tegangan awalt = waktu (detik)k = konstantaApabila persamaan tersebut kita nyatakan dalam bentuk t akan diperoleh:t = 0log loglogV Vk ePerhatikanpenggunaanbentuklogaritmapadarumusdiatas.Fungsilogaritma di atas memiliki penyelesaian berbentuk bilangan dan grafik. Lebihlanjut mengenai fungsi logaritma akan kita pelajari pada uraian kegiatan belajarberikut.A. Fungsi LogaritmaFungsilogaritmamerupakaninversdarifungsieksponen.Fungsilogaritma dapat dicari nilai fungsinya untuk domain 0 < x < . Bentuk umumfungsi logaritma:f : x alog x atau f(x) = alog x atau y = alog xdengan a > 0, a 1, dan x R.Dari bentuk umum di atas dapat diambil pengertian sebagai berikut.1. Daerah asal (domain) fungsi logaritma adalah Df : {x|x > 0, x R}.2. a adalah bilangan pokok (basis) logaritma dengan syarat a > 0 dan a 1berarti boleh 0 < a < 1 atau a > 1.3. Daerah hasil (range) dari fungsi logaritma adalah Rf : {y| < y < + , y R}.Contoh:Diketahui f(x) = 3log (x + 2). Tentukan nilai dari fungsi berikut!a. f(1)b. f(7)c. f(25)Penyelesaian:a. f(x) = 3log (x + 2) f(1) =3log (1 + 2)=3log (3)= 1TugasMandiriFungsilogaritmabanyakdigunakandalamsainsdanteknologi. Coba buka internet.Akseslahsituspencarise-macamwww.google.comatauwww.yahoo.com.De-ngan situs pencari ini, carilahcontohterapandarifungsilogaritma.61 Matematika XI SMK/MAKb. f(x) = 3log (x + 2) f(7) =3log (7 + 2)=3log (9)=3log (3)2= 2c. f(x) = 3log (x + 2) f(25) =3log (25 + 2)=3log (27)=3log (3)3= 3B. Menggambar Grafik Fungsi LogaritmaGrafik fungsi logaritma f(x) = a log x selalu memotong sumbu X di (1, 0)dantidakpernahmemotongsumbuY.Untukmenggambargrafikfungsilogaritma perhatikan langkah-langkah sebagai berikut.y = alog xuntuk a > 1 berupa grafik naikuntuk 0 < a < 1 berupa grafik turunContoh:1. Gambarlah grafik fungsi logaritma y = 3log x.Penyelesaian:x y = 3log x133log 13= 113log 1 = 033log 3 = 193log 9 = 22. Gambarlah grafik fungsi logaritma y = 2log (x 2).Penyelesaian:x y = 2log (x 2)2122log (212 2) = 132log (3 2) = 042log (4 2) = 162log (6 2) = 2102log (10 1) = 3Aplikasi1. Diberikan rumus tegangan V = V0ekt. Diketahui V0 = 100 volt, k = 0,0075,t=3,5detik,danloge=0,434.TentukannilailogVyangmemenuhipersamaan berikut!Penyelesaian:V = V0ekt log V = log100e(0,00753,5) log V = log100e0,02625 log V = log 100 + log e0,02625 log V = log 102 + (-0,02625) log e log V = 2 + (0,02625)(0,434) log V = 2 0,0114 log V = 1,9885Jadi, nilai log V yang memenuhi persamaan adalah 1,9885.Y21011 39 X13Y32101346 10X62 Fungsi2. Kerja suatu motor (w) dirumuskan dengan w = ln V2 ln V1. DiketahuiV1 = 0,01, V2 = 0,5, dan log 5 = 0,6989. Tentukan besarnya kerja motortersebut.Penyelesaian:w = ln V2 ln V1 w = ln 21VV w = ln 0,50,01 w = ln 50 w = 2,303 log 50 w = 2,303(log 5 + log 10) w = 2,303(0,6989 + 1) w = 3,9126Jadi, besarnya kerja motor adalah 3,9126 joule.Latihan 6Kerjakan soal-soal berikut!1. Diketahui y = 12log (2 4) x , tentukan nilai fungsi-fungsi berikut!a. f(3) d. f(174)b. f(6) e. f(6516)c. f(10)2. Tentukan titik potong grafik fungsi f(x) dengan sumbu X jika diketahui nilaifungsi sebagai berikut!a. f(x) = 3log x c. f(x) = 2log xb. f(x) = 3log (x + 1) d. f(x) = 2log (x 1)3. Perhitungansuhuakhirpadaakhirlangkahkompresi(T2)dinyatakandengan rumus T2 = T1 ek 1. Diberikan T1 = 1.000, e = 10, dan k = 1,4dengan antilog 0,4 = 2,511 dan antilog 0,34 = 2,188. Tentukan nilai T2!4. Perhitungan tegangan listrik diberikan dengan rumus V = V0ekt. Tentukanbentuk persamaan dalam t!5. Hubungan kuat arus (I) yang melalui rangkaian induktansi (L) dan tekanan(R) dinyatakan dengan rumus T = I0RtLe. Jika I0 = 1.000 mA, L = 100 Henry,R = 40 ohm, t = 15 m/detik, dan log e = 0,434, tentukan nilai log T!63 Matematika XI SMK/MAKFungsiTrigonometriListrikadalahenergikehidupan.Setujukahkaliandengan kalimat ini? Jika mengingat begitu vitalnya listrik bagikehidupan, kalian tentu akan setuju dengan kalimat itu.Salah satu sarana penting pembangkit listrik hidroelektrikadalahbendungan.Energiairyangtersimpanselanjutnyadiubahmenjadienergilistrik.Bendunganmenaikkanbataspermukaanairagarmemilikijarakjatuhvertikalairyangtinggi. Selanjutnya, air mengalir turun melalui saluran sembarimenghimpun energi dan membawanya kepada turbin. Air yangmengalir turun menekan baling-baling turbin dan membuatturbinberputar.Kemudiandihantarkankepadarotorolehsebuahporos.Generatormenghasilkanlistrikdarigerakanrotor di dalam stator dan mengubah tenaga air menjadi listrikdengan arah bolak-balik yang menghasilkan gaya gerak listrik(ggl).Salahsatupersamaanggldiberikandenganrumussebagai berikut.e = Emax sin (t)e = ggl dalam voltEmax= nilai tertinggi ggl = 2ft = waktuPerhatikan penggunaan bentuk sinus pada rumus di atas. Sinus merupakansalah satu bentuk trigonometri yang erat hubungannya dengan besar sudut.Lebih lanjut mengenai fungsi trigonometri akan kita pelajari pada uraian berikut.A. Pengertian Fungsi TrigonometriFungsi trigonometri didefinisikan pada pengertian-pengertian berikut. Untuksetiapxyangdipasangkantepatsatudengannilaisinx ataufungsi yang memetakan himpunan sudut x ke himpunan bilangan realsin x disebut fungsi sinus yang ditulis: f : x sin x atau f(x) = sin x Untuk f yang memetakan x ke nilai cos x disebut fungsi cosinus yangditulis:f : x cos x atau f(x) = cos x atau f(x) = cos x Untuk f yang memetakan x ke tan x disebut fungsi tangen dan ditulis:f : x tan x atau f(x) = tan xSumber: www.nwk.usace.army.milBendunganUraianMateri64 FungsiB. PeriodeFungsi trigonometri merupakan sebuah fungsi periodik (berulang). Jikafungsi f(x) berlaku f(x) = f(x + p) untuk setiap x maka nilai positif terkecil darip disebut periode fungsi f(x) tersebut.1. PeriodeFungsisinJikaf(x)=sinx=sin(x+k360)dandinyatakansebagaif(x+p)dengan p = k 360 maka nilai positif terkecil dari p adalah 360 untukk = 1. Jadi periode f(x) = sin x adalah 360. Artinya nilai f(x) akan berulangdanmemilikinilaiyangsam