kelas11 kimia nenden fauziah

Download Kelas11 Kimia Nenden Fauziah

Post on 19-Jul-2015

2.539 views

Category:

Documents

10 download

Embed Size (px)

TRANSCRIPT

Nenden FauziahKIMIA2 2KIMIA22Nenden FauziahUntuk SMA dan MA Kelas XI IPAKimia untuk SMA dan MA kelas XIiNendenFauzi ahKimia untuk SMA dan MA kelas XIi i540.7NEN NENDEN Fauziahk Kimia 2 : SMA dan MA Kelas XI IPA / penulis, Nenden Fauziah.Jakarta : Pusat Perbukuan, Departemen Pendidikan Nasional, 2009vii, 188 hlm. : ilus. ; 25 cm.Bibliografi : hlm. 175-176IndeksISBN 978-979-068-725-7 (no. jilid lengkap)ISBN 978-979-068-729-51. Kimia-Studi dan PengajaranI. JudulPenulis naskah : Nenden FauziahDesainKover : AndikaCakraPermanaTata Letak : PristaRiniUkuran Buku : 17,6 x 25 cmUnt uk SMA dan MA Kel as XII PAKIMIA2HakCiptaPadaDepartemenPendidikanNasionalDilindungiolehUndang-undangHak Cipta Buku ini telah dibeli oleh Departemen Pendidikan NasionaldariPenerbitHabsaJayaBandungDiterbitkanolehPusatPerbukuanDepartemenPendidikanNasionalTahun2009Diperbanyakoleh...Kimia untuk SMA dan MA kelas XIiiiPuji syukur kami panjatkan ke hadirat Allah SWT, berkat rahmat dankarunia-Nya,Pemerintah,dalamhalini,DepartemenPendidikanNasional, pada tahun 2009, telah membeli hak cipta buku teks pelajaraninidaripenulis/penerbituntukdisebarluaskankepadamasyarakatmelalui situs internet (website) Jaringan Pendidikan Nasional.BukutekspelajaraninitelahdinilaiolehBadanStandarNasionalPendidikandantelahditetapkansebagaibukutekspelajaranyangmemenuhi syarat kelayakan untuk digunakan dalam proses pembelajaranmelalui Peraturan Menteri Pendidikan Nasional Nomor 22 Tahun 2007tanggal 25 Juni 2007Kamimenyampaikanpenghargaanyangsetinggi-tingginyakepadaparapenulis/penerbityangtelahberkenanmengalihkanhakciptakaryanyakepadaDepartemenPendidikanNasionaluntukdigunakansecara luas oleh para siswa dan guru di seluruh Indonesia.Buku-buku teks pelajaran yang telah dialihkan hak ciptanya kepadaDepartemenPendidikanNasionalini,dapatdiunduh(download),digandakan, dicetak, dialihmediakan, atau difotokopi oleh masyarakat.Namun, untuk penggandaan yang bersifat komersial harga penjualannyaharus memenuhi ketentuan yang ditetapkan oleh Pemerintah. Diharapkanbahwa buku teks pelajaran ini akan lebih mudah diakses sehingga siswadan guru di seluruh Indonesia maupun sekolah Indonesia yang beradadi luar negeri dapat memanfaatkan sumber belajar ini.Kamiberharap,semuapihakdapatmendukungkebijakanini.Kepadaparasiswakamiucapkanselamatbelajardanmanfaatkanlahbuku ini sebaik-baiknya. Kami menyadari bahwa buku ini masih perluditingkatkanmutunya.Olehkarenaitu,sarandankritiksangatkamiharapkan.Jakarta, Juni 2009KepalaPusatPerbukuanKimia untuk SMA dan MA kelas XIi vParasiswasekalianbukuinipenulisbuatdenganharapandapatmembantuprosespembelajaranyangsedangAndajalani.Penulisberharap buku ini dapat membantu dalam menghadapi mitos bahwapelajaran sains itu sulit.Kimia adalah sains yang menarik dan sangatdekat dengan kehidupan kita, karena hidup kita dikelilingi bahan danreaksi kimia.PenulisberharapAndamenjadilebihtertarikdalammempelajarikimia melalui buku ini, karena sebelum Anda memasuki materi, petakonsepakanmembimbingAndadancontoh-contohpundisajikansebagai pelengkap agar Anda lebih memahami materi yang disajikan.AgarAndabisamengolahdanmengukurkemampuan,dalambukuinipundisertakanlatihan-latihandenganpenyajianyangvariatif.Penulis mengakui jika penulis bukan orang yang pintar sehinggamembuatbukuini.Tekadpenulisyanginginberperansertadalammemberantaskebodohanmembuatpenulisterusmencobamembuatbuku yang dapat digunakan untuk membantu kalian belajar.Penulispunya keyakinan di dunia ini tidak ada orang yang bodoh, yang adahanya orang yang malas. Harapan penulis semoga buku ini membawaberkahbagisemuapihak,terutamabagikaliananak-anakharapanbangsa.Marikitabangunbangsainidenganmencurahkansegalabakatdankemampuankita.Dengantekadyangkuat,doadankerjakerasdalammempelajarisegalahal,penulisyakincita-citakaliandapatdiwujudkan.Selamatbelajar!Penulis.Kimia untuk SMA dan MA kelas XIvKat a Sambut an . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . i i iKat a Pengant ar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ivDaf t ar Isi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .vBab 1 TeoriAt om dan Mekani ka Kuant um. . . . . . . . . . . . . . . . . . . . . . . 11.1. MekanikaKuantumdanModelAtomBohr ..................... 21.2. Lintasandanbilangankuantumnya ................................. 21.3. BentukOrbital ........................................................................ 41.4. OrbitalpadaAtomBerelektronBanyak............................ 61.5. Konfigurasielektron .............................................................. 61.6. KonfigurasiElektrondanSistemPeriodikUnsur ............ 9Rangkuman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12Uj iKemampuan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13Try Out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13Uj iKompet ensi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15Bab 2 Bent uk dan Int eraksiAnt ar Mol ekul . . . . . . . . . . . . . . . . . . . . . . . 192.1. Pembentukkan molekul dan teori hibridisasi. .................. 202.2 Bentuk Molekul dan Teori Domain Elektron.................... 222.3. InteraksiIon-dipol ................................................................. 252.4. Interaksiantarmolekul ......................................................... 25Rangkuman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31Uj iKemampuan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32Try Out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33Uj iKompet ensi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34Bab 3 Ter moki mi a . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 393.1 PerubahanEntalpi,ReaksiEksotermdanEndoterm...... 403.2. Jenis-jenisEntalpiReaksi ...................................................... 423.3. Hukum Hess ........................................................................... 443.4. PenentuanHReaksidariHPembentukanStandar.. 46Kimia untuk SMA dan MA kelas XIvi3.5. EnergiIkatandanPenentuanHReaksi .......................... 48Rangkuman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51Uj iKemampuan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52Try Out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53Uj iKompet ensi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54Bab 4 Laj u Reaksi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 594.1. UngkapanLajuReaksi ......................................................... 604.2. Faktor-faktoryangMempengaruhiLajuReaksi .............. 604.3. PersamaanlajuReaksidanOrdeReaksi ........................... 664.4. Lajureaksidalamkehidupansehari-hari ......................... 69Rangkuman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71Uj iKemampuan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72Try Out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74Uj iKompet ensi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75Bab 5 Keset i mbanganKi mi a. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 815.1. Pengenalanpadakesetimbangankimia ............................ 825.2. TetapanKesetimbangan. ...................................................... 825.3 TetapanKesetimbanganBerdasarkanTekanan.............. 865.4. HubunganKcdenganKp...................................................... 885.5. PergeseranKesetimbangan.................................................. 895.6. ReaksiKesetimbangandalamIndustri .............................. 95Rangkuman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97Uj iKemampuan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98Try Out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99Uj iKompet ensi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100Bab 6 AsamdanBasa . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1056.1. DefinisiAsamdanBasaArrhenius .................................... 1066.2. AsamBasaBrnsted-Lowry ................................................ 1076.3. AsamBasaLewis ................................................................... 1106.4. IndikatorAsamBasa............................................................. 1116.5. DerajatDisosiasiAsamdanBasa ....................................... 1146.6. DerajatKeasaman,pH ......................................................... 114Kimia untuk SMA dan MA kelas XIvii6.7. TitrasiAsamBasa .................................................................. 120Rangkuman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 123Uj iKemampuan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 124Try Out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 125Uj iKompet ensi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 126Bab 7 Keset i mbangan Larut an . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1317.1. AirdannilaiKw...................................................................... 1327.2. LarutanPenyangga ............................................................... 1327.3. Hidrolisis Garam.................................................................... 1387.4. GaramSukarLarutdanKSP................................................ 1417.5. PengaruhionSenamapadakelarutansuatuzat ............ 144Rangkuman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 146Uj iKemampuan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 147Try Out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 148Uj iKompet ensi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 149Bab 8 Kol oi d . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1538.1. Koloid,LarutandanSuspensi. ............................................ 1548.2. Macam-macamSistemKoloid............................................. 1558.3. Sifat-SifatKoloid .................................................................... 1568.4. PembuatanKoloid ................................................................. 1608.5. KoloiddalamKehidupanSehari-Hari ............................... 162Rangkuman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 164Uj iKemampuan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 165Try Out . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 165Uj iKompet ensi . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 166Gl osar i. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 169Indeks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 172Daf t ar Pust aka. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 175Kunci Jawaban . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 177Ni l aiBeberapa Tet apan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 184Kimia untuk SMA dan MA kelas XIviiiTeori Atom dan mekanika Kuantum1Teori Atom dan MekanikaKuantumBab Si swamampumenerapkant eori atomBohrdanmekani kakuant umunt ukmenul iskankonf igurasielektrondandiagramorbitalsertamenentukanletakunsurdalamtabelperiodikKompetensiDasar1Kimia untuk SMA dan MA kelas XII1Kimia untuk SMA dan MA kelas XII 1Kimia untuk SMA dan MA kelas XIPeta KonsepAtom adalah partikel terkecil darisuatumateriyangsebenarnyatidakdapatkitalihatdengankasatmata, tetapi para ilmuwan tak pernahmenyerahuntukselalumempelajaridan berusaha mengetahui bagaimanamerekatersusun,berinteraksisatusamalain,baikketikasebagaiatomtunggalataupunketikamembentuksenyawa.Dengandidukungolehteori-teori yang semakin modern kitadapatmemperkirakanberbagaiben-tukorbitaldanbentukmolekulyangterjadiakibatinteraksidariorbitalatomtersebut.Apayangdisebutdengan orbital dan bagaimana bentukmolekuldenganadanyapengaruhawanelektronpadaorbital?Kimia untuk SMA dan MA kelas XI21.1.Mekanika Kuantum dan Model AtomBohrErwin Schrdinger (1926) mengemukakan pemikiran tentang partikel sub-atom,yangdikenalsebagaiteorimekanikagelombangataumekanikakuantum.Hasilpersamaan Schrdinger dinamakan fungsi gelombang, dengan simboly (psi), yangtidak memiliki makna fisik, tapi nilai y2 menjelaskan distribusi probabilitas elektron.Heissenberg, dengan asas ketakpastian Heissenberg, yang menyatakan posisi dankecepatansebuahelektrontidakdapatdiketahuisecaratepatpadawaktuyangbersamaan.SehinggapersamaanSchrdingertidakmemberitahukantepatnyakeberadaanelektronitu,melainkanmenjelaskankemungkinanbahwaelektronakanberadapadadaerahtertentupadaatom.PadamodelBohr,elektronberadapadagarisedartertentu,padamodelSchrdinger kemungkinan untuk tingkatenergielektronyangdiberikan.Misal-nya,elektronpadakeadaandasardariatom hidrogen memiliki distribusi kebo-lehjadianyangterlihatsepertiGambar1. 1dimanaintensitaswarnayangsemakinkuatmenunjukkansemakinbesarnilaiy2,yangmemilikimaknabahwa kemungkinan untuk menemukanelektronpadadaerahtersebutlebihbesar,danjugakerapatanelektronnyalebihbesar.1.2. Lintasan dan bilangan kuantumnyaPadamodelatomBohr,energielektronyangsama,tetapidengangarisedartertentu.PemecahanpersamaanSchrdingeratomhidrogenmenghasilkanbebe-rapafungsigelombangataukebolehjadianmenemukanelektrondantingkatanenergiyangterkait.Fungsigelombanginidisebutorbitaldanmempunyaikarak-teristikenergidanbentukorbitalelektron.Model atom Bohr menggunakan satu bilangan kuantum (n) untuk menerangkangarisedaratauorbit,sedangkanmodelSchrdingermenggunakantigabilangankuantum:n,ldanmuntukmenerangkanorbital.a. Bilangan Kuantum Utama n Mempunyainilai1,2,3danseterusnya Semakinnaiknilainmakakerapatanelektronsemakinjauhdariinti Semakinbesarnilain,makasemakintinggienergielektrondanikatankepadaintisemakinlonggarGambar1.1RapatkebolehjadianelektronpadahidrogenTeori Atom dan mekanika Kuantum3b. Bilangan kuantum Azimut l Memilikinilaidari0sampaidengan(n-1)untuktiapnilain,dimananadalah bilangan kuantum utama Dilambangkandenganhuruf(s=0,p=1,d=2,f=3) Menunjukkanbentukdaritiaporbitalc. Bilangankuantum magnetik(ketiga)m Memilikinilaibulatantara ldanl ,termasuk0 MenunjukkanarahorbitaldalamruangnyaContohnya, orbital elektron dengan bilangan kuantum utama 3 (misalnyan =3)akanmemilikinilaildanmsebagaiberikut:Tabel 1.1 Cara pemberian bilangan kuantum nl Penandaan mJumlah(bilangan kuantum (azimut) sub-kulit (magnetik) orbital pada utama)sub-kulit3 0 3s 011 3p-1,0,132 3d -2,-1,0,1,25Gabungan orbital yang memiliki nilai n yang sama disebutkulit elektron.Orbitalyang memiliki nilai n dan l yang sama terdapat pada sub-kulit yang sama.Maka: Kulitelektronyangketiga(n=3)terdiridarisub-kulit3s,3pdan3d Sub-kulit3sterdiridari1orbital,sub-kulit3pterdiridari3orbitaldansub-kulit3dterdiri5orbitalJadi, kulit elektron yang ketiga terdiri dari9 orbital yang berbeda, meskitiaporbitalmemilikienergiyangsama.Pembatasanpadanilaiyangmungkinuntuktiapbilangankuantumyangberbeda (n, l, m) menghasilkan pola-pola untuk mengukur tiap kulit yang berbeda: Tiap kulit dibagi menjadi bebe-rapasub-kulityangjumlahnyasamadenganbilangankuantumutama(misalnyakulitkeempatdibagi menjadi 4 sub-kulit: s, p,d,danf) Tiapsub-kulitdibagimenjadibeberapaorbital(meningkatdenganbilanganganjil)Tabel 1.2 Jumlah orbital pada subkulits, p, d dan fSub-kulit Jumlah Orbitals 1p 3d 5f 7Kimia untuk SMA dan MA kelas XI4Gambar1.3Bentuk orbital sGambar 1.4Bentuk orbital s dengan energi yanglebih tinggiGambar 1.2Tingkat energi orbital atom hidrogenGambar 1.5Arah orientasi orbital pBilangandanenergirelatifdarisemua orbital elektron hidrogen dengannilain=3dapatdilihatpadaGambar1.2.Padasuhunormalbiasanyaatomhidrogenberadapadakeadaandasar.Elektrondapatdinaikkankekeadaanyanglebihtinggidenganpenyerapanfotondengankuantumenergiyangsesuai1.3. Bentuk Orbitala.Orbital sBentuksuatuorbitaldigambarkandenganpermukaanmelewatidaerahpadaprobabilitas yang sesuai. Sebuah orbital s berbentuk bulat seperti ditunjukkan padaGambar1.3.Halinimenunjukkanbahwapadakeadaandasar,elektrontidakmungkin berada jauh dari inti.Energi yang lebih tinggi dari orbital s juga berbentukbola simetris, tetapi dengan perbedaan simpul pada distribusi kebolehjadian. Padaorbitalsyanglebihtinggiterdapatwilayahsimpuldimanakerapatanelektronmendekatinol(2smempunyai1simpul,3smempunyai2simpuldst).Ukuranorbitalakanmakinbesarjikanilainnaikb.Orbital pSebuahorbital pmemil ikiduabagianterpisaholehbidangsimpuldimanaprobabilitasnyanol.Terdapattiga orientasi yang mungkin, yaitu yangdisebutpz,pydanpx danditunjukkansebagaimanapadaGambar1.5disam-ping ini.Teori Atom dan mekanika Kuantum5Gambar 1.6 Bentukorbital Px, Py dan PzGambar1.7Arah orientasi orbital dGambar1.8Lima bentuk orbital dOrbital p adalah orbital yang berbentuk dua bola yang masing-masing memilikisetengahnya dari kerapatan elektron, dengan simpul pada inti.Ada tiga orbital pyangberbedadanberbedadalamorientasinya.Tidakadakorelasiyangtetapantara3arahgerakdengan3bilangankuantummagnetik(m)Sebuah orbital d memiliki lima orientasi. Probabilitasnya nol antara bola-bola.Sepertiditunjukkanberikut:Padakulitketigadandiatasnyaterdapatlimaorbitald,masing-masingmempunyaiarahyangberbedapadaruangnya.Mengertibentukorbitaladalahkunciuntukdapatmengertipembentukanmolekuldaripenggabunganbeberapaatom.Kimia untuk SMA dan MA kelas XI6Gambar 1.9Tingkatan energi orbital pada atomberelektronbanyakGambar1.10Pengisianorbitalberdasarkantingkatenergi1.4. Orbital pada Atom Berelektron BanyakSebuahatomyangmemilikilebihdarisatuelektrondisebutatomber-elektron-banyak. Meskipunbentukorbitalelektronuntukatomelektron-banyakadalahsamadenganbentukuntuk atom hidrogen, elektron yang lebihdari satu tersebut mempengaruhi tingkatanenergidariorbitalnya(karenatolakanelektron-elektron).Pada atom dengan elektron banyak,bilangankuantumutamamenentukanukuran,misalnyaorbital1slebihkecildari2syanglebihkecildari3s.Energidariorbitalditentukanolehbilangankuantum utama dan bilangan kuantumazimut,sedangkanurutankenaikanenergiditentukansebagaimanaterlihatpadaGambar1.9.Contohnya,orbital2smemilikienergiyanglebihrendahdaripadaorbital2ppadaatomelektron-banyak. 1.5. Konfigurasi elektronKetikamembentukkonfigurasielektron,penempatanelektrondalamorbitaldimulaidengantingkatenergiterendah. Untukhidrogenelektrontunggalnyamengisipadaorbital1s,yaitukeadaandenganenergiterendahuntukatomhidrogen. Untukatomberelektron banyak pengisian mengikutiaturan aufbau, yaitu dimulai dari tingkatenergiyanglebihrendahkemudianmengisi tingkat energi berikutnya yaitu2s, kemudian 2p, dan seterusnya sesuaidenganurutantingkatenergipadaGambar1.10.Penulisankonfigurasielektronberdasarkankenaikantingkatenergidapatdituliskansebagaiberikut:1s2s2p3s3p4s3d4p5s4d5p6s4f5d6p7s5f6d7pTeori Atom dan mekanika Kuantum7Gambar 1.11Diagram tingkat energi 4s dan 3d.Gambar 1.12 Diagram pengisian elektronSelain itu perlu diingat, bahwa ada 3 macam orbital p, 5 macam orbital d danorbital f ada 7 macam, dimana setiap orbital dapat diisi oleh dua elektron, sehinggakonfigurasielektrondenganjumlahelektronpadasetiaporbitalnyamenjadi:1s22s2 2p63 s2 3p64s23d104p65s24d105p66s24f145d106p67s25f14,6d107p6Tampakbahwaorbital4slebihduludiisidariorbital3d,halitudikarenakanenergiorbital4slebihrendahdariorbital 3d(lihatGambar1.11).Apakah yang menentukan di orbitalmana suatu elektron berada? Bagaimanacaraelektronmenempatiorbitalyangtersedia?UhlenbeckdanGoudsmit,menyata-kan bahwa elektron masih memiliki sifatkuantum yang lain, disebut spin elektron,atau yang dinamakan bilangan kuantumputaranel ektron, atauS Bil angankuantumS hanyadapatmemilikiduaharga(+dan-)untukitu,palingbanyak hanya duaelektron yang dapatmenempatiorbitalyangsama, danmempunyainilaiputaranmagnetikyangberlawanan.Putaran elektron sangat penting untuk dapat mengerti struktur elektron atomitu sendiri.Prinsip larangan Pauli (Wolfgang Pauli, 1925) menyatakan bahwa, tidakadaduaelektronyangterdapatpadasatuatomdapatmemilikiempatbilangankuantumyangsama(n,l,m,dans)Orbital1sdiisiduaelektron,inidi tunj ukkandengan1s2. Jikaatommemiliki elektron lebih banyak, elektronberikutnya mengisi pada tingkat energiyang lebih tinggi, misalnya pada litiummengisiorbital2skarenaunsurinimemiliki3elektron.Kitaakanmulaimeletakkanduaelektronpadaorbitaldenganenergiterendahataukeadaandasaryaitupada1s.Keduaelektrontersebutharusmemi li ki bil angankuantum spin magnetik yang berlawan-an.Kemudiankitaletakkanelektronketigadalamorbitaldengantingkatenergi selanjutnya yaitu orbital 2s (lihatGambar1.12).Kimia untuk SMA dan MA kelas XI8Tugas MandiriTanda panah ke atas menunjukkan nilai bilangan kuantum spin magnetik (m)+dankebawahuntuk.Pengisianorbitaldigambarkansebagai1s22s1Elektronyangmemilikispinberlawanandikatakanelektronberpasangan,sepertielektronyangmengisiorbital1spadaatomLi,sedangkanelektronpadaorbital 2s atom Li dikatakan takberpasangan berilium ditulis sebagai1s22s2.Padaboron,elektronberikutnyaditempatkanpadaorbital2p.yangketiganyamemilikienergiyangsama.Iniditunjukkansebagai1s22s2 2p1.Penulisan diagram orbital untuk beberapa atom di atas dapat dituliskan sebagai:Gambar 1.13 Diagram orbital atom H, He, Li, Be dan BDuaelektrondalamHemenunjukkanpengisianlengkappadakulitpertama.Sehingga,elektrondalamHedalamkonfigurasiyangsangatstabil.UntukBoron(5elektron),elektronkelimaharusdiletakkanpadaorbital2pkarenaorbital2ssudahterisipenuh.Karenaorbitalpketiganyamemilikienergiyangsama,makatidakmasalahdimanapundiletakkannya.Dalam pengisian orbital perlu juga memperhatikan Aturan Hund, yang menyatakandalam suatu subkulit tertentu, tiap orbital di isi oleh satu elektron terlebih dahulu sebelumada orbital yang memiliki dua, dan elektron-elektron dalam orbital tersebut spinnya paralelBagaimana dengan unsur berikutnya, karbon (6 elektron)?Apakah kita pasangkandengan elektron tunggal yang ada pada orbital 2p (tetapi dengan posisi berlawanan)?Atau kita letakkan pada orbital p yang lain?Bagaimana pula dengan nitrogen yangmemiliki elektron 7. Diskusikanlah dengan teman-temanmu sehingga diperolehdiagram orbital dan konfigurasi elektron untuk karbon dan nitrogen. Perhatikanpernyataan aturan Hund di atas!Gambar 1.14Diagram orbital O, F, Ne dan NaTeori Atom dan mekanika Kuantum9Tugas MandiriTugas MandiriPengisianelektronuntukorbitalyangterdegenerasi(orbitaldengantingkatenergiyangsama),energiminimumakantercapaiketikajumlahelektrondenganspin yang sama dimaksimumkan (penuh atau setengah penuh).Ne memiliki kulit n = 2 yang penuh, sehingga memiliki konfigurasi elektron yangstabil, bagaimana dengan kestabilan unsur nitrogen, apakah ada hubungannyadengan pengisian elektron pada orbitalnya? Jelaskan!Konfigurasi elektron dapat ditulis dengancara singkat dengan menggantikanurutandaripengisianorbitalolehlambangatomunsurgasmuliayangmemilikikulitterlengkappalingdekatsebelumunsurtersebut. KonfigurasielektronNa : 1s22s2 2p63 s1dapat ditulis sebagai [Ne]3s1 KonfigurasielektronLi :1s2 2s1 dapatditulissebagai[He]2s1Gas mulia argon memiliki 18 elektron terletak pada baris yang diawali oleh natriumpada sistem periodik unsur, sehingga memiliki konfigurasi elektron:ApakahunsurberikutnyayaituKdengan19elektronakanmengisiorbital3d?Sedangkan kita ketahui secara kimiawi kalium memiliki sifat yang sama denganlitium dan natrium yang konfigurasi elektronnya adalah:1.6.Konfigurasi Elektron dan Sistem Periodik UnsurSistemperiodikunsurdalambentukinimenunjukkankonfigurasielektronuntuksetiapunsur,dengankatalainbagaimanaelektronterdistribusidalamberagamkulitnya.Untuk setiap baris hanya kulit terluarnya yang ditampilkan karena kulit yanglebihdalamnyapenuh.Contohkonfigurasielektronbromadalah1s22s22p63s23p64s23d104p5, dalam bentuk penulisan singkat kulit yang penuh bisa diwakili olehlambang unsur gas mulia yang sesuai dengan kulitnya yang terisi penuh tersebut.KonfigurasielektronBromdapatditulissebagai[Ar]4s23d104p5.Elektronyangberadapadakulitpalingluar,yaitu4s23d104p5 adalahelektronvalensi.Kimia untuk SMA dan MA kelas XI10Dengankenaikanbilanganatomkulitdansubkulitdiisidengancarayangkonsisten,namunterdapatbeberapapengecualiansepertiyangterjadipadatembagayangseharusnyakonfigurasielektronnyaditulissebagai3d104s1,tapiditulis sebagai 3d94s2. Alasan untuk ketidakteraturan ini adalah disamping interaksiantar inti atom yang positif dan elektron dan adanya tolak menolak antar elektronyangbermuatannegatif,jugasebagaiakibatdariadanyapengisiantingkatenergiyang lebih menguntungkan dari segi energi, sesuai aturan pengisian elektron penuhdan setengah penuh yang menunjukkan senyawa dalam keadaan yang lebih stabil.Keadaan yang lebih stabil merupakan keadaan yang akan lebih dipilih oleh suatuunsur dialam.Gambar 1.14Sistem periodik unsur dengan konfigurasi elektron Kolom yang paling kiri termasuk didalamnya logam alkali dan alkali tanah,unsur-unsurtersebutelektronvalensinyaterdapatpadaorbitals. Sisi sebelah kanan, blok yang paling kanan enam kelompok unsur adalahgolonganunsuryangpengisianelektronnyaberakhirdiorbitalpKeduagolonganunsurtersebut(yangberakhirdisdanp)biasanyadisebutsebagaiunsurgolonganutama Padablokditengahsepuluhkolomberisilogamtransisi,elektronvalensinyaterletakpadaorbitaldTeori Atom dan mekanika Kuantum11Tugas Mandiri Dibawahkelompokiniadalahbarisdengan14kolom,yangbiasanyamengacu pada logam blok f.Dalam golongan unsur ini elektron valensinyapadaorbitalf.Halyangharusdiingat: 2,6,10dan14adalahjumlahelektronyangdapatmengisiorbitals,p,ddan f(denganbilangan kuantumazimut,l=0, 1,2,3) Subkulit 1s adalah subkulit s pertama, subkulit 2p adalah subkulit p pertamasubkulit3dadalahsubkulitdpertamadansubkulit4fadalahsubkulitfpertamaApa konfigurasi elektron Niobium (no atom 41) adalah:1s2 2s2 2p6 3s2 3p6 4s2 3d10 4p6 5s2 4d3Bagaimana susunan yang sebenarnya?Berikan pula alasannya!Sifatsuatuunsurditentukankonfigurasielektronnya,unsurdengankolomyangsamaakanmemilikielektronvalensiyangsama,sehinggaakanmemilikisifatyangmirip satusamalain.Sang IlmuwanNIELSHENRIKDAVIDBOHR(1885-1962)adalahorang yang pertama kali mengemukakan aturan aufbau,dariistilahaufbauprinziple.LahirdiCopenhagenpada7 Oktober 1885, anak dari Christian Bohr professor padaFisiologipadauniversitasCopenhagen,iamewarisikejeniusanayahnya.Iamasihberstatussebagaimaha-siswaketikaiadiberipenghargaanataspemecahanmasalahilmiah,tentangteganganpermukaan,yangberartipenjelasantentangosilasicairanpadajet.DibawahbimbinganJ.J.Thomson ia bereksperimen di Laboratorium Cavendish, kemudian pada musimpanas 1912 ia bekerja pada Rutherford di Manchester dan mempelajari tentangfenomena radioaktif.Hasil kerjanya tentang struktur atom dihargai denganhadiahNobelpadatahun1922.WOLFGANG PAULI(1900 1958) Ia merupakan orangyang mengemukakan prinsip larangan Pauli. Ia lahir dikota Vienna pada tanggal 2 April 1900. Setelah memper-olehgelardoktornya,iamenjadiasistenNielsBohrdiCopenhagen. Pauli banyak mendalami penelitian dalambidang kimia fisik, ia banyak menerbitkan artikel yangdiantaranyatentangteorirelativitas.Iajugamenerbit-Kimia untuk SMA dan MA kelas XI12 Erwin Schrdinger (1926) mengemukakan teori mekanika gelombang ataumekanika kuantum. Heissenberg, dengan asas ketakpastian Heissenberg,sehinggapersamaanSchrdingertidakmemberitahukantepatnyakeberadaan elektron itu, melainkan menjelaskankemungkinan bahwaelektronakanberadapadadaerahtertentupadaatom.PadamodelBohr, elektron berada pada garis edar tertentu, pada model Schrdingerkemungkinanuntuktingkatenergielektronyangdiberikan. Model atom Bohr menggunakan satu bilangan kuantum (n) untuk mene-rangkan garis edar atau orbit, sedangkan model Schrdinger mengguna-kantigabilangankuantum:n,ldanmuntukmenerangkanorbital Bilangan Kuantum Utama n, mempunyai nilai 1, 2, 3 dan seterusnya,semakin naiknilai nmaka kerapatanelektron semakinjauh dariinti,semakin tinggi energi elektron dan ikatan kepada inti semakin longgar Bilangan kuantum Azimut l ,memiliki nilai dari 0 - (n-1) dilambangkandenganhuruf(s=0,p=1,d=2,f=3),menunjukkanbentukdaritiaporbital Bilangan kuantum magnetik (ketiga) m,memilikinilai bulat antaral dan l , termasuk 0, menunjukkan arah orbital dalam ruangnyaBilangan kuantum putaran elektron, s hanya dapat memiliki dua harga(+ dan -) untuk itu, paling banyak hanya dua elektron yang dapatmenempatiorbitalyangsama,danmempunyainilaiputaranmagnetikyangberlawanan AturanHund,yangmenyatakandalamsuatusubkulittertentu,tiaporbital diisi oleh satu elektron terlebih dahulu sebelum ada orbital yang memilikidua, dan elektron-elektron dalam orbital tersebut spinnya paralel Bentuk orbital digambarkan dengan permukaan melewati daerah padaprobabilitasyangsesuai.Sebuahorbitalsberbentukbulat,orbitalpmemilikiduabagianterpisaholehbidangsimpuldimanaprobabi-litasnyanoldengantigaorientasiyangmungkin,yaituyangdisebutpz,pydanpx.Orbitaldmemilikilimaorientasi. Ketika membentuk konfigurasi elektron, penempatan elektron dalamorbitaldimulaidengantingkatenergiterendahmengikutiaturanaufbau,konfigurasielektrondenganjumlahelektronpadasetiaporbitalnya menjadi: 1s2 2s2 2p63 s2 3p6 4s2 3d10 4p6 5s2 4d10 5p6 6s24f14 5d10 6p6 7s2 5f14 6d10 7p6kanartikeltentangteorikuantumdanprinsipmekanikagelombang.Hasilkerja kerasnya dihargai orang dengan memberinya medali Lorentz pada tahun1930. Pauli meninggaldi Zurichpada tanggal15 Desember1958Teori Atom dan mekanika Kuantum131. Jelaskanapayangkamuketahuitentang:a. Bilangan kuantum utama b. Spinc. Aturanaufbau d. Teoridomainelektron2. Berapa banyak orbitalyang terdapat pada kulit atom ke empat? Ada berapabanyakelektronyangmengisitiaporbitaltersebut?3. Tuliskanperangkat-perangkatbilangankuantumuntuksatuelektrondalamatoma. Nitrogen b. Belerang4. Tentukanlahnamaunsuryangelektronterakhirnyaberakhirpada:a. 3p5b. 3d5c. 5s1d. 4f 35. Gambarkandiagramorbitaldariatom:a. Fosfor b. Klorc. Tembaga d. Besi1. Elektronthatputinoutershellinatom2. TheothernameofVESPR3. Nameofatomthathaveelektronconfiguration1S22s2, thanspeltitbackward4. Shape of methanemolecule5. Thewaytoputelektroninorbital6. RfromVESPRis...7. Placeinorbitalthatnohavechangetofoundanyelektron8. Thelast quantumnumber9. Valenceelektron10. Shapeofmoleculethathaveeightbondpairs11. Shapeofwatermolecule12. Shapeofcarbonoxidemolecule13. Thekindofflaskthatweuseintitration14.We must fill orbital full in one spin than we make it in pair that is the statementfrom...Kimia untuk SMA dan MA kelas XI1415.If we combine twoormore atom in compoundso they we call.16. Thequantumnumberthattellusshapeoforbital17. Nameofatomthanwecalltin18. IfweseethesymbolfireinthebotllesofonekindsubtancethatmeanthatsubtanceiseasyTeori Atom dan mekanika Kuantum151. Ilmuwanyangmenjadipelopormunculnyateoriatommodernadalah..A. Pauli, NilesBohr dande BroglieB. Rutherford, Niels Bohr dan de BrogliC. Rutherford, de Broglie dan HundD. de Broglie, Schrodinger dan HeisenbergE. Dalton, de Broglie dan Heisenberg2. Berikutiniadalahkonfigurasielektrongolonganalkalitanahkecuali:A. 1s2 2s2D. 1s2 2s22p63s23p53d104s2B. 1s2 2s22p63s2E. 1s2 2s22p63s23p64s23d104p65s2C. 1s2 2s22p63s23p64s23.Ion X2-mengandung 16 protondan 16 netron konfigurasi elektronnya adalah:A. [Ne]3s23p2D. [Ne]3s23p6B. [Ne] 3s23p64s23d104p2E. [Ne]3s23p4C. [Ne]3s03p64. Kloryangmemilikinomoratom17akanmemilikijumlahorbital:A. 10 C. 9 E. 8B. 7 D. 65. Tembaga 29Cu,memilikikonfigurasielektron;A. [Ne] 3s23p64s23d9D. [Ne] 3s23p64s13d10B. [Ne] 3s23p53d104s2E. [Ne] 3s23p63d94s2C. [Ne] 3s23p63d104s16. Berikutinimerupakangambarbentukorbitald:Yangmerupakangambarbentukorbitaldx2y2adalah..A.1 C. 2 E. 3B. 4 D. 5Kimia untuk SMA dan MA kelas XI167. Suatuunsurterletakpadagolongan15periode3darisistemperiodik,konfigurasielektrondariatomunsurtersebutadalahA. [Ne]3s23p2D. [Ne]3s23p4B. [Ne]3s23p6E. [Ne]3s23p3C. [Ne]3s23p58. DiantarahargakeempatbilangankuantumdibawahiniyangmungkinpengisisanpadaorbitalpadalahA. n =3;l = 2;m = -1; s = + D. n =3;l = 2;m = 0; s = + B. n =3;l = 1;m = -1; s = + E. n =3;l = 2;m = +2; s = + C. n =3;l = 2;m = +1; s = + Ebtanas87/889. Diagramorbitalyangmenunjukkanadanyaeksitasidalamatom:A. D.B. E.C.10. Tabelpengisianelektronkedalamsubkulit:UnsurI 1s2 2s22p5II 1s2 2s22p53s2III 1s2 2s22p63s13p1IV 1s2 2s22p63s23p54s1V 1s2 2s22p63s23p64s23d5PengisianelektronyangbenarmenurutaturanaufbaudanHundadalah.A. I dan V D. IIIdanVB. IdanII E. IVdan VC. IIdan VEbtanas95/9611. Unsur X bernomoratom 8,maka harga keempat bilangan kuantum adalahA. n =2;l = 0;m = 0; s = - D. n =2;l = 1;m = -1; s = + B n =2;l = 1;m = 1; s = + E. n =2;l = 1;m = -1; s = - C. n =2 ;l = 1;m = 0; s = - Teori Atom dan mekanika Kuantum1712. KonfigurasielektronuntukionX2-adalah1s22s22p6.DalamsistemperiodikunsuratomXterletakpadaA. Periode2golongan2 D. Periode3golongan2B. Periode2golongan10 E. Periode3golongan8C. Periode2golongan1813. Konfigurasielektronempatunsuradalah:P :1s2 2s22p63s23p6R : 1s2 2s22p63s23p64s23d104p3Q :1s2 2s22p63s23p64s23d8S : 1s2 2s22p63s23p64s23d10Pernyataanyangbenartentangunsur-unsurtersebut:A. UnsurPterletakdalamgolongan8B. UnsurSterletakdalamgolongan13C. UnsurQterletakdalamperiode4D. UnsurSterletakdalamperiode3E. UnsurRterletakdalamgolongan314. Elektronterakhiratomsuatuunsurmemilikibilangankuantum,n=4;l=2;m=-1;s=+.DalamsistemperiodikunsurtersebutterletakpadaA. golongan 12 periode 5 D. golongan4 periode 4B. golongan 12 periode4 E. golongan 14 periode 4C. golongan4periode515. Suatuunsurmemilikikonfigurasielektron1s22s22p5.Pernyataanberikuttentangunsuriniadalahbenar,kecuali:A. Terletakdalamgolongan17dalamsistemperiodikB. CenderungmembentukionnegatifC. MemilikienergiionisasiyangbesarD. Jari-jari atom yang paling besar dibanding unsur lain dalam periode yangsama.E. Membentukmolekuldiatomikberikatantunggal16. NomoratomsuatuunsurM(nomoratom13)membentukM3+makaelektronterluarM3+adalah.A. 4s2D. 2s22p6B.2s2E. 3s23p6C. 6s22p617. Konfigurasielektronsuatuunsur1s22s22p63s23p63d54s1TingkatoksidasidariunsurtersebutadalahA. +2 B. +5 C. +7D. 3 E. +6Kimia untuk SMA dan MA kelas XI1818. DiketahuiunsurXdengannomoratom25,jumlahelektronpadaorbitaldadalah.A. 3 C. 4 E. 5B. 6 D. 719. Datapengisianelektrondalamorbitalsebagaiberikut:1s 2s2p 1s 2s2p1. 2.3. 4.Pengisianelektron yangtidakmengikutiaturanaufbau danHundadalahA. 1 dan 2 D. 1 dan 4B. 2dan 3 E. 2 dan 4C. 3dan 420. KonfigurasielektronunsurXsebagaiberikut:UnsurXterletakpada.A. periode3,golongan2 D. periode4,golongan2B. periode3,golongan3 E. periode4,golongan3C. periode4,golongan1Bentuk dan Interaksi Antar Molekul19Bent uk dan I nt er aksiAnt arMol ekulBab Siswamampumenjelaskanteorijumlahpasanganelektron di sekitar inti atom dan teori hibridisasi untukmeramalkanbentukmolekul. Siswamampumenjelaskaninteraksiantarmolekul(gayaantarmolekul)dengansifatnyaKompet ensi Dasar19Kimia untuk SMA dan MA kelas XII19Kimia untuk SMA dan MA kelas XII 19Kimia untuk SMA dan MA kelas XIPet a KonsepMolekul dibuatdari sejumlahatomyang bergabung bersama denganikatankovalen,dandapatsangatber-agam bentuk dan ukurannya.Ada yangsangatkecilsepertimolekuldiatomikhidrogenkadangsangatbesarsepertimakromelekulpadapolimer,proteinatau DNA.Beberapa manusia bisa sajamemilikiwajahserupa,tapitetapsajaberbedakarenamerekamemilikiDNAyang berbeda namun mirip, seperti yangterjadipadaanakkembar.RangkaianDNAinimemilikistrukturdoublehelix,yangterdiridariduapasang.KeduarangkaiankodegenetikDNAtersebutsalingterikatolehsuatugayayangsedikit lebih lemah dari ikatan kovalen,yaituikatanhidrogen.Kimia untuk SMA dan MA kelas XI202.1. Pembent ukkan mol ekuldan t eor ihi br i di sasi .Jikaduaatomhidrogencukupjauh(>10Angstrom)awanelektrontidakberinteraksi satu sama lain. (Gambar 2.1 (a)), tetapi ketika mulai mendekat, terjadiperubahan(lihatGambar2.1b).Gambar2.1Rapat kebolehj adiandit emukannyaelekt ronpadaat omhidrogen( a) saat berj auhan( b)saat int isalingmendekatJarak yang optimum akan dicapai dimana mereka saling tumpang tindih satusamalainpadaorbital1s.Terdapatkonsentrasipadarapatkebolehjadianditemukannyaelektronantaraduainti.Merekaakansalingberikatandenganadanya pembagian elektron. Jarak terpendek antara inti akan meningkatkan dayatolakantarduaintiyangbermuatanpositif.Gambar2.2Rapat kebolehj adiandit emukannyaelekt ronket ikaint iberikat anIkatandalammolekuldiatomikakanmembentukmolekulsimetridalambentuklinier,karenahidrogentidakmemilikielektronyangtidakdipergunakandalamikatan.Sepertitampaksebagaiberikut:1H:1s1,dengandiagramorbital:KetikamembentukmolekulH2,makapengisianorbitalmenjadi: Denganorbitalyangdiisiadalahorbitalmolekul,hasilgabunganduaatomH,dimanakeduaelektrontidakberadapadasalahsatusisiatom.Bagaimanabentukmolekulyangbukandiatomikdimanaelektronterluarberadabukanpadaorbitals.Sangatsulitmenjelaskanbentukmolekulpalingsederhanasekalipunjikamengunakanorbitalatom.PemecahandarimasalahinidiusulkanolehLinusPauling,yangmenyatakanorbitalterluarpadasuatuatomdapatmembentukorbitalatomhibrid.Bentuk geometri molekul BeF2 dapat dijelaskan, contoh dengan mengabungkanorbital 2s dari atom berilium dan dengan satu dari orbital 2p sehingga membentukorbitalhibridspyangterletakpadaposisiyangberlawanan,sebagaiberikut:Bentuk dan Interaksi Antar Molekul21Gambar2.3Bent ukorbit alspElektron yang berada pada orbital hibrid tersebut kemudian berikatan denganelektrontakberpasanganyangdimilikiolehF.Satudarielektronvalensiatomberiliumkemudiandiletakkanpadasetiaporbital tersebut, sehingga menimbulkan tumpang tindih dengan orbital 2 p sehinggaterbentukmolekulBeF2 yanglinier.Gambar2.4 bent ukorbit almolekuldalamsenyawaBeF2Cont ohsoal :TentukanbentukhibridisasiyangterjadipadasenyawaNH3!Jawab:1H :1s1,dengandiagramorbital: 7N : 1s22s22p3KetikamembentukNH39 F:1s2 2s22p5 2p2sx y zBeF2sp Kimia untuk SMA dan MA kelas XI22Tugas Mandi r iTugas Mandi r iTent ukan bent uk hi br i di sasiyang t er j adipada :( a) BCl3(b)CH4(c) PCl5(d)SF6Gambar2.6 Bent ukmolekul menurut t eori domainelekt ronGambar2.5bent ukbalonyangdigabungkanPenyusunandomainel ektronGeometridomainel ektronperkiraansudutikatanJumlahdomainel ektron234562.2 Bent uk Mol ekuldan Teor iDomai n El ekt r onKeberadaan elektron tak berikatan dan elektron valensi suatu atom menentu-kanbentukmolekulketikadiamembentukikatan.Teoriitudisebutdenganteoridomain elektron, yang merupakan pengembangan dari teori VSEPR (Valence ShellElektron Pair Repulsion).Untuk memahaminya kita gunakan balon, ketika diikatantara dua balon maka balon tersebut akan membentuk linier, jika tiga atau empatbalon,makabentukyangakankitaperolehadalahmenyusundanbentukyangmengatasihalanganstrerikseminimalmungkin(lihatGambar2.5).Pada teori domain elektron terdapatdua jenis domain, yaitu domain elektronbebasuntukpasanganelektronbebasdan domain elektron ikatan untuk elek-tron dalam ikatan.Satu pasang elektronbebasdianggapsebagaisatudomainelektron. Satu ikatan tunggal satu doma-inelektronikatan,satuikatanrangkapsatudomainelektronikatan,sebuahikatanrangkaptiga jugadianggapsatudomainelektron(lihatGambar2.6).Dengan menggunakan t eor idomai n el ekt r on i nicoba kamu t ent ukan bagai manabent uk geomet r imol ekuldar iSnCl3 dan O3Linier 1800segitiga 1200datartetrahedral 109,50trigonal 900bipiramid 1200Oktahedral 900Bentuk dan Interaksi Antar Molekul23Gambar2.8 Bent ukmolekuldenganadanyapasanganelekt ronbebasLangkahyangdiambildalammenentukanmodeldomainelektronadalah:1. Tentukan jumlah elektron valensi dari masing-masing atom yang berikatan2. GambarkanstrukturLewisnya3. Hitung berapa jumlah total pasangan elektron yang berada pada atom pusat.BentukmolekuldapatdiperkirakandenganmenggunakanstrukturLewis.MisalnyastrukturLewisamoniak:Gambar2.7 St rukt urLewisamoniakDengantigapasanganelektronyangberikatandansepasangelektronbebas,maka menurut domain elektron, akan tersusundalam bentuk tetrahedral, tapi itukurangtepatkarenabesarnyatolakanantaratomH,dengantolakanantaraatomH dan pasangan elektron ternyata tidak sama besar, maka pasangan elektron bebasdiperhitungkan dengan cara terpisah, sehingga bentuk yang tepat adalah piramidatrigonal.Jumlah geometri jumlah jumlah geometridomain domain domain domain molekulelektron elektron ikatan elektronbebas 220LinierLinier 3 3 0Segitiga datar Segitiga datar2 1Bengkok4 4 0 TetrahedralTetrahedral3 1Trigonal piramid2 2BengkokKimia untuk SMA dan MA kelas XI24Tugas Mandi r iGambar 2.9Bent ukmolekuldenganadanyapasanganelekt ronbebasunt uk t rigonal bipiramida danokt ahedral4. Gambarkan geometri molekulnya, dengan mengambil bentuk paling dekatdari lima bentuk dasar, linier, segitiga datar, tetrahedral, trigonal bipiramidaatauoktahedral.5. Ubahsudutikatanakibatpengaruhpasanganelektronbebas.BentukgeometrimolekulyangakanterbentukakibatpengaruhpasanganelektronbebasdapatdilihatpadaGambar2.8.Gambar kanl ahbagai manakemungki nanbent ukmol ekul dar i met ana, amoni akdan ai rdengan menggunakan t eor idomai n el ekt r on i ni . Apa kesamaan dasardanapa penyebab per bedaannya? Di skusi kanl ah ber sama t eman-t emanmu bagai manapengar uhadanyapasanganel ekt r onbebaspadabent ukmol ekul dar i senyawamet ana,amoni ak dan ai r.Senyawayangmemilikibentuktrigonalbipiramiddanoktahedralbiasanyaterbentuk dari atom pusat yang memiliki orbital d, yaitu untuk unsur-unsur yangmemilikikulitpadan=3ataulebihbesar,sehinggamemilikikemungkinanuntukmemilikielektronvalensilebihdari4pasangelektron.Bentuk dan Interaksi Antar Molekul25Tugas Mandi r iTugas Mandi r iGambar2.10I nt eraksiiondipolAdanya pasangan elektron bebas menimbulkan perubahan sudut ikatan, karenatolakan antar pasangan elektron bebas lebih besar dari tolakan pasangan elektronyang dipergunakan dalam ikatan. Bentuk-bentuk yang akan terjadi akibat pengaruhpasanganelektronbebastersebutdapatkamulihatdalamGambar2.9:Car i l ah masi ng-masi ng sat u cont oh senyawa dengan bent uk mol ekulokt ahedr al ,pi r ami da dan segiempatdat ar.Kamu dapatmenggunakan penget ahuanmu at audat at ent angj uml ahi kat anyangbi sat er bent ukdanpasanganel ekt r onbebasyang di mi l i ki nya.2.3.I nt er aksiI on-di polAntara ion dan ion terjadi interaksikarenaadanyagayatarikantaraionpositifdanionnegatif.Padainteraksiantaraionbermuatandenganmolekulpolar(yaitu molekuldengan dipol)ter-jadi gaya tarik antara kation ujung nega-tif dipol atau anion dengan ujung positifdipol.Gayaiondipoladalahpentingdalam terjadinya larutan dalam pelarutpolar, misalnya larutan garam dalam air.(lihatGambar2.10).Coba kamu car icont oh senyawa dan pel ar ut nya yang meni mbul kan adanya i nt er aksii on di poli ni ! Apa semua pel ar utakan ber i nt er aksidengan gar am yang di l ar ut kannya?dan apa pengar uhnya?2.4.I nt er aksiant armol ekulMolekul netral (bukan ion) memiliki gaya elektrostatik, diantaranya: (1) Gayadipol-dipol,(2)GayadispersiLondondan(3)IkatanhidrogenGayadipol-dipoldangayadispersitermasukkedalamgayavanderWaals.GayavanderWaalsmunculdarifaktayangmenunjukkangayatersebutmenimbulkanpenyimpangansifatgasdarigasideal.a. GayaDi pol -di polGayadipol-dipolmerupakangayayanglebihlemahdarigayatarikmenarikion-dipol.Gayadipol-dipolmeningkatsesuaidengankenaikankepolaranyangKimia untuk SMA dan MA kelas XI26dimilikiolehmolekulnya.Molekulpolarsalingmenariksatusamalain,ketikabagianyangpositifpadamolekulberadadidekatujungdipolmolekullainyangbermuatan negatif.Molekul polar haruslah sangat dekat pada jarak yang signifikanuntukterjadinyagayatarikmenarikantaradipol-dipolGambar2.11 I nt eraksidipoldipolPengaruh interaksi dipol-dipol ini dapat kita amati dari kenaikan titik didih untukmolekul polarpada massa yang serupa,tetapi memiliki dipol yangsemakin besar.Tabel2. 1Ti t i k di di h senyawa yang ber i nt er aksidi pol - di polZat Massa Molekul (sma) Momen Dipol, u (D) Titik Didih (K)Propana 44 0.1 231Dimetil eter 46 1.3 248Metil klorida 50 2.0 249Asetaldehid 44 2.7 294Asetonitril 41 3.9 355b. Gaya Di sper siLondonAtom bukan sesuatu yang diam saja, kerapatan elektron berfluktuasi di sekitaratom.Pada satu titik mungkin saja kerapatan elektron pada salah satu sisi atom lebihbesardibandingkansisiyanglainnya.Sehinggatimbuldipolsesaat.Atom-atompadakeadaandinginakanbergeraktidakterlalucepat,sehinggaatomakanterpengaruhi oleh adanya dipol ini, dan mengkutub dengan sendirinya sebagai respon.Gayatarikantaraatom,yaituinteraksiantaradipolsesaatdandipolterinduksiinitidakterlalukuat,tapitetapada.Gambar2.12I nt eraksidipolsesaat -dipolt erinduksiMedan listrik luar dapat menyebabkan adanya induksi dipol dimana elektronakanterdistribusidanmenyebabkanmolekulterpolarisasi.Kemampuansuatumolekuluntukdiganggudistribusielektronnyadisebutkebolehpolaran.Bentuk dan Interaksi Antar Molekul27Tabel2. 2 Ti t i k di di h hal ogenGas halogen Jumlah elektron Titik didih(0C)F218 -188.1Cl234 -34.0Br270 59.5I2106 185.2Kebolehpolaran yang lebih besar pada suatu molekul akan mempermudahnyauntuk terinduksi membentuk momen dipol dan semakin kuat gaya dispersi.Atomyanglebihbesarakanmemilikikebolehpolaranyanglebihbesar,karena:z Elektronnyaberadajauhdariinti(distribusitidaksimetrismenghasilkandipolyanglebihbesarsehinggaterjadipemisahanlebihbesar)z Jumlahelektronnyalebihbanyak(menimbulkankemungkinandistribusitidaksimetrisyanglebihtinggi)Molekulbesarjugacenderungmemilikikebolehpolaranlebihbesar,karenamemiliki jumlah elektron yang lebih banyak. Gaya dispersi hanya kuat ketika atomtetangganyabenar-benardekat.Perha-tikandatatitikdidihsenyawahalogenpadaTabel2.2.Salah satu konsekuensi dari adanyagayainiadalahbentukfasasuatuzat.Jikatidakterdapatgayatarikmakakumpulan molekul atau atom suatu zatakan berwujud gas walaupun tidak adakenaikan suhu atau penurunan tekanan.Gayaantarmolekulpadaumumnyalemahdibandingkandenganikatankovalen.Untuk memutuskan gaya tarik antar molekul HCl, hanya diperlukan 16kJ/mol,sedangkanuntukmemutuskanikatankovalenantaraatomHdanClpadamolekulHCldibutuhkan431kJ/mol.Kekuatangayaantarmolekulmenjelaskansifatfisikpadazatsepertititikleleh, titik didih dan tekanan uap. Suhu pada titik didih merupakan energi kinetikyangdiperlukanuntukmengatasigayatarikantarmolekulBeberapa unsur membentuk senyawa dengan hidrogen, atau disebut hidrida.Jikatitikdidihsenyawahidridadarigolongan14dialurkan,tampakkenaikantitikdidihsemakinkebawahsemakinbesar,sepertipadaGambar2.13.Gambar2.13Grafikt it ikdidihunsurgolongan14Kenaikantitikdidihterjadikarenamolekulnyasemakinmembesardengansemakinbanyaknyaelektron,sehinggagayavanderwaalssemakinmembesar.Alur titik didih senyawa-senyawa hidrida pada unsur-unsur golongan lima belas,enambelasdantujuhbelas,menunjukkankecenderunganyangsamadenganKimia untuk SMA dan MA kelas XI28golongan empat belas. Namun untuk unsur pertama pada setiap golongan memilikititihdidihyangmalahlebihtinggidariyanglainnya. Gambar2.14 Grafikt it ikdidihunsur golongan15,16dan17DalammasalahNH3,H2OdanHFtentuadagayalainyangmenyebabkanpenyimpangantersebut,dangayatersebutadalahikatanhidrogen.c. Ikat an Hi dr ogenPadamolekulyangmemilikiikatanhidrogenmemilikikelebihanpasanganelektronyangtidakdigunakanuntukberikatan:Gambar 2.15Pasanganelekt ronbebaspadasenyawaberikat anhidrogenPada air, ikatan oksigen-hidrogenadalah polar, oksigen merupakan unsuryanglebihelektronegatifsehinggamolekulnyamenjadipolar(bentukmolekultidakliniertapiberbentukV).Inidisebabkanadanyapasanganelektronyangtakberikatanpadaatomoksigen.Salahsatuujungbermuatannegatif sedangkan hidrogen yang relatifbermuatanpositifakanmenarikujungoksigendarimolekullainyangbermu-atannegatif.Aksiantarmolekulinidinamai dengan ikatan hidrogen ini danbertindaksepertilayaknyalemyangmenahanmolekulairuntuktetapbersama-sama(lihatGambar2.16).Gambar2.16I kat anhidrogenant armolekulairBentuk dan Interaksi Antar Molekul29Tugas Mandi r iTugas Mandi r iIkatanhidrogendalamairini,menimbulkansifatfisikyangsangatmengherankan,titikdidihair,sebagaicontoh,jauhlebihbesardibandingsenyawayanglebihberattapitidakmemiliki ikatan hidrogen.Untuk itulahseluruhumatmanusiaseharusnyabersyukuratasterciptanyaikatanhidrogen,karenakalautidakmakaairakan berwujudgas padasuhu kamar.Senyawa-senyawa apa saj a yang memi l i kii kat an hi dr ogen? Dapat kah kamu memi ki r -kan si f atf i si k l ai n yang mungki n akan di pengar uhiol eh adanya si f atseper t il emdar ii kat an hi dr ogen?Ikatan hidrogen dianggap sebagai interaksi dipol-dipol khusus.Ikatan antarahidrogendanatomyangelektronegatifsepertiF,OdanNadalahsangatpolar:Gambar 2.17Arahpengkut ubanpadaunsuryanglebihelekt ronegat ifAtomhidrogentidakmemilikielektronbagiandalam,satu-satunyaelektronyang ada adalah elektron yang dipergunakannya untuk berikatan.Muatan positifakan menarik muatan negatif pada atom elektronegatif molekul tetangga terdekat.Karenaatomhidrogendalamikatanpolarakanmemilikikekuranganelektronpadasatusisi,makaatomhidrogenakansangatdekatdenganatomtetanggayangsangatelektronegatif,danberinteraksidengansangatkuat(ingatsemakindekatsemakinkuatgayaelektrosatisnya).Cobakamucar i st r ukt ur DNA, i kat anapasaj adangayaant ar mol ekul apaaj ayang ada dal am DNA,ser atbagi an mana dar iDNA yang ber per an dal am t i mbul nyagaya ant armol ekult er sebut . Di skusi kanl ah ber sama t eman-t emanmu,l al u kamucoba pr esent asi kan di depan t eman-t emanmu yang l ai n.Kekuatan ikatan hidrogen beragam dari sekitar 4 kJ/mol hingga 25 kJ/mol,jadimasih lebih lemah jika dibandingkan dengan ikatan kovalen, tetapi lebih kuat darigaya tarik dipol-dipol dan dari gaya dispersi. Ikatan hidrogen memiliki peran pentingdalampengaturanmolekulbiologis,terutamadalammenentukanstrukturprotein.Tabel2. 3 Ti t i k di di h ai rdansenyawa yang l ebi h ber atSenyawa Massa Titik didihmolekul relatif(oC)H2O 18 100H2S 34 -65H2Se 81 -45H2Te 130 -15Kimia untuk SMA dan MA kelas XI30Kekuatanrelatifpadajenisinteraksiikatannon-kovalenyangberbeda,danketerkaitan antara jarak yang terbentuk oleh adanya interaksi dari molekul tersebutdengan kekuatan gaya yang ada ditunjukkan sebagaimana terlihat pada Tabel 2.4.Tabel2. 4Kekuat an ber bagaij eni s i nt er aksiJeni s Reaksi E D j arak Energi(kJ/ mol )Ion-Ion D 1/ r 20Ion - di pol D 1/ r212-30Ikat an H (Di pol- Di pol ) D 1/ r312-30Ion - Di polt er i nduksi D 1/ r45Di pol- Di polt er i nduksi D 1/ r52Di polt er i nduksi- Di polt er i nduksi D 1/ r61Sang I l muwanJohannes Diderik van der Waals(1837-1923) lahir pada23 Nopember 1837 di Leiden, Belanda.Pada tahun 1864ia mengajar di sekolah menengah di Deventer. Pada tahun1873 ia menyelesaikan program doktornya dengan tesisyangberjudulOverdeContinuteitvandenGas-enVloeistoftoestand(Kontinyuitaskeadaangasdancairan).VanderWaalstertarikpadatesisR.Clausiusyangmembahas panas sebagai fenomena gerak, dan menjelas-kantentangeksperimenyangdilakukanT.Andrew(1869) yang menunjukkan keberadaan "suhu kristis".Van der Waals denganmenghitungvolumemolekuldangayaantarmolekulnyaPETERJOSEPHUSWILHELMUSDEBYE(1884-1966)Adalah ilmuwan keturunan Amerika-Belanda, yangmemberikanbanyakteorilarutanelektrolit.Iajugamempelajarimomendipolmolekul,dengankeluasanpengetahuannyatentangsusunanatomdalammolekuldan jarak antar atom.Pada tahun 1916 ia menunjukkanbahwa zat padat dapat digunakan dalam bentuk serbukuntukstudistrukturkristalnyadenganmenggunakansinar-x,sehingga tahaptersulityaitu penyiapansampledalam pengujian dapat dihilangkan.Debye memperoleh hadia Nobel dalambidangkimiapadapadatahun1936,untuksumbangannyaterhadapperkembangansainsmelaluipenelitiannyapadamomendipoldandifraksisinar-xdanelektrondalamgas.Sumber:http://www.geocities.comBentuk dan Interaksi Antar Molekul31z Jika dua atom cukup jauh (>10 Angstrom) awan elektronnya tidak berin-teraksi satu sama lain ketika mulai mendekat mulai beriteraksi dan padajarakoptimumterjaditumpangtindihorbital.Ikatandalammolekuldiatomik membentuk molekul simetri dalam bentuk linier. Untuk molekulnondiatomikdiusulkanolehLinusPauling,yangmenyatakanorbitalterluarpadasuatuatomdapatmembentukorbitalatomhibrid.z Keberadaanelektrontakberikatandanelektronvalensisuatuatommenentukanbentukmolekulketikadiamembentukikatan.Teoriitudisebut dengan teori domain elektron, yang merupakan pengembangandariteoriVSEPR(ValenceShellElektronPairRepulsion).z Bentuksuatumolekuldiantaranyalinier,segitigadatar,tetrahedral,trigonal bipiramid, oktahedral, dengan adanya pengaruh domain elektronterdapat bentuk bengkok, trigonal piramid, jungkitan, bentuk T, piramiddansegiempatdatar.z Interaksiion-dipolmencakupinteraksiantaraionbermuatandenganmolekulpolar.Kationakantertarikpadaujungnegatifpadadipolsedangkananionakantertarikpadaujungpositifdaridipolz GayainteraksiantarmolekulterdiriGayaDipol-dipol,GayadispersiLondon, Ikatan Hidrogen. Gaya dipol-dipol dan gaya dispersi termasukke dalam gaya van der Waalsz Gaya dipol-dipol ada antar molekulpolar yang netral. Gaya dipol-dipolmeningkatsesuaidengankenaikankepolaranyangdimilikiolehmolekulnya.z Gaya dispersi timbul karena fluktuasi kerapatan elektron di sekitar atomyangmenimbulkaninteraksiantaradipolsesaatdandipolterinduksidi-mana elektron akan terdistribusi dan menyebabkan molekul terpolarisasi.z Gayadispersihanyakuatketikaatomtetangganyabenar-benardekat.Salah satu konsekuensi dari adanya gaya ini adalah bentuk fasa suatu zatz Kekuatangayaantarmolekulmenjelaskansifatfisikpadazatsepertititik leleh, titik didih dan tekanan uap. Suhu pada titik didih merupakanenergi kinetik yang diperlukan untuk mengatasi gaya tarik antar molekulz Antaraksi antar molekul yang memiliki hidrogen dan atom yang elektro-negatifsepertiF,OdanNyangmemilikikelebihanpasanganelektronyang tidak digunakan untuk berikatan dinamai dengan ikatan hidrogenz KekuatanikatanhidrogenakanmenyebabkankenaikantitikdidihbeberapasenyawasepertiH2-O,HF,NH3.z Sedangkan pengaruh gaya van der Waals pada kenaikan titik didih diten-tukan ukuran molekul senyawa tersebut, semakin besar ukuran molekulsemakinbesartitikdidih,karenagayavanderWaalsnyasemakinbesarKimia untuk SMA dan MA kelas XI321. BagaimanabentukhibridisasiyangterjadidalamH2O,NH3danCH4?Bagaimanabentukmolekulnya?Apakahsamaatauberbeda,jikaberbedajelaskanletakperbedaannya?2. Tentukanbentukmolekulyangmungkindari:a. BF3b. NF3c. CO2d. SnCl43. Apayangkamuketahuitentang:a. Gayainteraksiantarmolekulb. Gayavanderwaalsc. Ikatanhidrogend. Titikdidih4. Kelompokkancampuransenyawaberikutsebagaiyangmengalamiinteraksiion-dipolatauinteraksiantarmolekul:a. Ba(OH)2dalamlarutanairb. HCldalamairc. Larutan asamcukad. Alkohol30%5. Sebutkanjenisinteraksiantarmolekulyangterjadidalam:a. Penyublimangashidrogenb. Pelarutanetanoldalamairc. Larutanamoniakdalamaird. Cairankloroform6. Jelaskanmengapatitikdidihgolongan17memilikiurutanHF>HI>HBr>HCl7. JelaskanmengapaantaraHF,H2OdanNH3danCH4memilikiurutantitikdidihH2O>HF >NH3>CH4Bentuk dan Interaksi Antar Molekul331. VanderWaals2. Molecularinteraction3. Hydrogenbonding4. Leyden5. Boilingpoint6. DNAFindthesewords7. Diderik8. Deventer9. Doublehelix10. Protein11. Water12. AmmoniumKimia untuk SMA dan MA kelas XI341. Suatu senyawa memiliki jumlah domain elektron ikatan 3 dan domain elektronbebas0,bentukmolekuldarisenyawatersebutadalah..A. Linier D. OktahedralB. Tetrahedral E. BipiramidasegitigaC. Segitigadatar2. Dipolpermanenakanterdapatpadamolekul..A.CH4D. CCl4B. PCl3E. BCl3C.BeCl23. Berikutadalahdatadaribeberapajenisgas:MolekulgasyangmemilikigayadisperseLondonterbesaradalah...A. P D. QB. R E. SC. T4. CH4mempunyaistrukturtetrahedral,denganempatbuahdomainelektronikatanpadaempatarahyangsama.MakabentukhibridisasiyangterjadipadaCH4adalah..A. sp D. sp2B. sp3E. sp3dC. sp3d25. Diantarasenyawaberikut:(1)NH3(2)H2S(3)H2O(4)HCl (5)HFyangdapatmembentukikatanhidrogenadalah:A. (1)dan(2) D. (2)dan(3)B. (1),(3)dan(5) E. (1)dan(3)C. (3)dan(5)Zat Cair Jumlah elektron Titik didih(0C)P 106 185.2Q 34 -34.0R 70 59.5S 18 -188.1T 44 - 43Bentuk dan Interaksi Antar Molekul356. DiberikanDatasebagaiberikut:Zat Cair Titik didih (0C)P -83Q -40R - 59S -20T 20Gayatarikmenarikantarmolekulyangpalingkuatterjadipadamolekul.A. P D. QB. R E. SC. T7. TitikdidihH2S(Mr=34)lebihrendahdarititikdidihH2O(Mr=18),karena:A. MassamolekulrelatifH2SlebihbesardariH2OB. H2OmembentukikatanhidrogensedangkanH2StidakC. H2Slebihmudahterionisasi,dibandingH2OD. IkatankovalenH2OlebihkuatdariH2SE. GayavanderWaalsH2SlebihbesardariH2O8. Diantara keempat hidrogen halinida yang paling tinggi titik didihnya adalahHidrogenflourida,karena:A. HidrogenflouridamemilikimassamolekulrealtifterkecilB. HidrogenflouridamemilikimassamolekulterbesarC. Hidrogen flourida membentuk ikatan hidrogen antar sesama molekulnyaD. HidrogenflouridamemilikigayavanderwaalsE. IkatanantaraHdanFsangatpolar9. Pasanganyangtidakmungkinterjadiantarabentukhibridisasidanbentukmolekulsuatusenyawaadalah:A. sp-linier D. sp3-tetrahedralB. sp3 - linier E. sp3-trigonalbipiramidC. sp3-bentukbengkok10. Interaksiantaratomgasmuliayangtimbulakibatadanyakedekatanjarakdanfluktuasikerapatanelektron,disebut:A. GayadispersiLondon D. Gayadipol-dipolB. ikatanhidrogen E. GayavanderwaalsC. Gayaion-dipolKimia untuk SMA dan MA kelas XI3611. Antara unsur B (nomoratom5) dengan F(nomor atom 9) dapat membentuksenyawaBF3.BentukmolekulBF3adalahA. D.B. E.C.Ebtanas95/9612. UnsurXdanYmasing-masingmempunyainomoratom16dan9.Keduaunsur ini membentuk senyawa dengan rumus XY6.Bentuk molekul senyawaXY6adalahA. Linier D. SegitigasamasisiB. Tetrahedral E. TrigonalbipiramidC. Oktahedral13.BentukmolekulNH3adalahA. Linier D. OktahedralB. Bujursangkar E. PiramidatrigonalC. TetrahedralEbtanas93/9414. Suatu senyawa mempunyai bentuk molekul bipiramidal trigonal, maka jumlahpasanganelektronterikatdalamsenyawatersebutadalah..A. 2 D. 5B. 3 E. 6C. 4Ebtanas91/92Bentuk dan Interaksi Antar Molekul3715.JikaunsurPdengannomoratom5bersenyawadenganunsurQdengannomoratom17,makabentukmolekulnyaadalah.A. linier D. segiempatplanarB. segitigaplanar E. tetrahedralC. piramidasegitigaEbtanas92/9316.Bentukhibridadaribeberapasenyawa:No. Rumus senyawa Bentuk hibrida1. CH4sp22. HCl sp3. H2O dsp24. NH3sp3d25. Ag(NH3)2+d2sp3Daridatatersebutyangmerupakanpasanganyangtepatadalah.A. 1 D. 4B. 2 E. 5C. 3Ebtanas89/9017. Unsur Xe dengan nomor atom 54 dan unsur F dengan nomor atom 9 pembentuksenyawaXeF4.Yangbentukmolekulnyaadalah...A. linier D. TetrahedronB. segitigadatar E. bujursangkarC. OktahedronEbtanas90/9118. Jumlah pasangan elektron terikat dan pasangan elektron bebas suatu senyawa3dan1.Bentukmolekulsenyawaituadalah...A. Segitigaplanar D. PiramidasegitigaB. BentukV E. tetrahedronC. segiempatdatarEbtanas90/9119.SenyawaNI3mempunyai3pasanganelektronyangterikatdan1pasanganelektronbebas.Bentukgeometrimolekultersebutadalah...A. piramidasegitiga D. segitigadatarB. piramidabujursangkar E. segiempatdatarC. oktahedronEbtanas88/89Kimia untuk SMA dan MA kelas XI3820.Menurutteoritolakanpasanganelektron,datatentanghubunganjumlahpasanganelektronyangtidakbenaradalah.A. 1 dan 2 D. 1 dan 4B. 2 dan 3 E. 4 sajaC. 3 dan 4Ebtanas87/88No. Jumlah pasangan Jumlah pasangan Bentuk Molekulelektron tak terikat elektron terikatpada atom pusat pada atom pusat1 1 3 Piramida trigonal2 0 6 Oktahedron3 2 2 Planar bentukV4 0 3 Bipiramidal trigonalTermokimia39Ter moki mi aBab Siswamampumendeskripsikanperubahanentalpisuatureaksi,reaksieksotermdanreaksiendoterm Siswamampumenentukan'Hreaksiberdasarkanpercobaan,hukumHess,dataperubahanentalpipembentukanstandar,dandataenergiikatan.Kompet ensi Dasar39Kimia untuk SMA dan MA kelas XII39Kimia untuk SMA dan MA kelas XII 39Kimia untuk SMA dan MA kelas XIPet a KonsepGeysermerupakanpancaranairpanas.Panas yang dimiliki geyserinidiyakiniberasaldaripanasbumi,dan aliran sungai dalam bumi melewatisumber panas ini. Panas merupakan ben-tuk energi, energi panas yang ada dalambumi ditransfer pada air, dan panas darigeyser ini, terutama uapnya bisa dijadi-kan sumber energi oleh manusia denganmenciptakanpembangkitlistriktenagauap, bahkan tenaga pancarannya dapatdipakaiuntukmemutarturbinyangdigunakansebagaipembangkitlistriktenagaair.Termokimiamempelajaritentangpanasyangmenyertaisuatureaksi kimia. Untuk itu mari kita pelajaribagaimanapanasatauenergiterlibatdalamsuatureaksi.Kimia untuk SMA dan MA kelas XI403.1 Per ubahan Ent al pi , ReaksiEksot er m dan Endot er mPada kondisi tekanan tetap (pada umumnya proses biologis berlangsung padatekanantetap)panasyangdiserapatauditerimasistemdisebutdenganentalpi.Kitatakdapatmengukurentalpisecaralangsung,tetapiyangdiukuradalahperubahanentalpi('H).Perubahanentalpiadalahbanyaknyakaloryangdilepaskanatauyangdiserapolehsistempadatekanantetap.'H=qpReaksi kimia ketika terjadi dalam suatu wadah yang terbuka, pada umumnyaakan mengalami pertambahan energi atau kehilangan energi dalam bentuk panas.Jika suatu reaksi yang terjadi dalam sistem menghasilkan panas, maka terasa panasbila sistem disentuh.Reaksi eksoterm adalah reaksi yang disertai dengan pelepasanenergi/panaskelingkungan.Contoh:Padareaksiantarasodaapi(NaOH)danasamlambung(HCl),kalaukitapegangwadahreaksinyaakanterasapanas.Panasmengalirantarasistemdanlingkungansampaisuhuantarakeduanyasama.Ketikareaksikimiaterjadidimanasistemmenyerappanas,makaprosestersebutdisebutreaksiendoterm,ditunjukkandengankeadaansistemyanglebihdingin.Reaksiendotermadalahreaksiyangdisertaidenganpenyerapankalor/panas dari lingkungan. Contoh, pada reaksi antara barium oksida dan ammoniumkloridakalaukitapegangwadahakanterasadingin,karenaadanyaalirankalordarilingkungankesistem.Perubahanentalpi('H),menunjukkanselisihantaraentalpisistemsebelumreaksidansetelahreaksiberlangsung.'H=HakhirHawalSehingga: Pada reaksi endoterm, sistem memiliki entalpi yang lebih besar pada akhirreaksi, Hakhir > Hawaldan 'H positif('H = +) Padareaksieksotermsistemmemilikientalpiyanglebihrendahpadaakhirreaksi,Hakhir>Hawaldan'Hbernilainegatif('H=-).Kitajugadapatmenggambarkan'Huntukreaksidenganmembandingkanentalpiuntukhasilreaksidansebelumbereaksi:'H =H(hasilreaksi)-H(pereaksi)Gambar3.1Diagram reaksi ( a) eksot erm ( b)endot ermsdTermokimia41Tugas Mandi r iPerubahanentalpiyangberhubungandenganreaksidisebutentalpireaksi('Hreaksi).Biasanyanilai'Hreaksi,disertakandenganpersamaanreaksiyangsudahdisetarakan:2H2(g)+O2(g)o2H2O(g)'H=-483,6kJPerhatikan hal-hal berikut ; 'Hbernilainegatif,menun-jukkan reaksi melepaskan panas(eksoterm) Reaksimemberikanenergisebanyak 483,6 kilo joule energiketika 2 mol dari H2 bergabungmembentuk1molO2untukmenghasilkan 2mol H2O.Entalpirelatifzathasilreaksidanpereaksidapat jugaditunjukkandalamdiagramenergidisampingini.Cont oh: Berdasarkanreaksi:2H2(g) + O2(g) o 2H2O(g) 'H = -483,6 kJBerapapanasyangdihasilkanjikakitamereaksikan11,2litergashidrogenpadakeadaanSTP.Jawab: Karena pada keadaan STP 1 mol suatu gas memiliki volume 22,4 liter,maka11,2 liter gas hidrogen=11, 222, 4=0,5 molSedangkanpanas483kJituuntuk1molgasoksigenyangbereaksidanuntuk 2 mol gas hidrogen (lihat persamaan reaksi), makapanas untuk 0,5molgashidrogenadalah:0, 52 u 483 kj =120,75 kjBer dasar kanr eaksi :CH4(g) +2O2(g) oCO2(g) +2H2O(g)'H= -802kJBer apa panas yang di l epaskan j i ka ki t a membakar4, 5 gr am met ana?Gambar3.2Diagramenergireaksipembent ukkanairKimia untuk SMA dan MA kelas XI42Reaksiendot er m,eksot er m dan per ubahan ent al piAl atyang di gunakan : kal or i met er t ekanant et ap, gel aski mi a250mL,bat ang pengaduk,l abu Er l enmeyer250 mLBahan yang di gunakan : HCl 0, 5M, NaOH0, 5M, Ba(OH)20, 25MdanNH4Cl0, 5MBukt i kanGambar3.3Kalorimet erKamu l akukanl ah l angkah ker j a ber i kut:1. Si apkanal at -al at kal or i met er dal amkeadaan ber si h.2. Masukkan100mLl ar ut anHCl 0, 5Mke dal am kal or i met er.Ukursuhunya.3. Sement ar a i t u,sedi akan pul a 100 mLl ar ut anNaOH0, 5Mkedal aml abuEr l enmeyer.Ukurpul a suhunya.4. Tuangkan l arut an NaOH ke dal am l arut anHCl .Kemudi an cat atsuhunya set i ap sat umeni t . Pencat at andi l akukanhi nggadi per ol eh suhu yang r el at i ft et ap.5. Tent ukan ni l aikal or yang di serap at au di l epas berdasarkan dat a yang kamu perol eh6. Ul angil angkah di at as unt uk l ar ut an Ba(OH)2 0, 25 M dan NH4Cl 0, 5M7. Buat l ah kesi mpul an dar ihasi lper cobaanmuCat at an: Unt uk hasilpercobaan yang l ebih akuratl angkah percobaan dapatdiawal idengan penent uan t et apan kal ori met er3.2.Jeni s-j eni s Ent al piReaksiPerubahanentalpireaksimerupakanperubahanentalpiuntukreaksiyangterjadi,reaksidisiniadalahreaksisecarakimiayangmencakupperubahansuatuzatmenjadizatlainyangberbedadenganzatsemulabukanperubahansecarafisiksepertipadapelelehan,penguapanataupunpelarutan.Adaberbagaijenisentalpireaksiataukalorreaksi,diantaranya:1. Ent al pipembent ukan ('Hf)Entalpipembentukanadalahkaloryangdilepaskanatauyangdiserapolehsistem pada reaksi pembentukan 1 mol senyawa dari unsur-unsurnya. PerubahanentalpipembentukandilambangkandenganUHf.fberasaldariformationyangberartipembentukan.Cont oh: a.C + O2 o CO2UHf = -395,2kj/molb.C + 2SoCS2UHf=+117.1 kj/molTermokimia43Tugas Mandi r iTugas Mandi r iContohsoal :Diketahuireaksi:H2+I2o2HI UH = +53,0 kj/molTentukan'Hpembentukannya!Jawab :UHfadalahperubahankaloryangdilepaskanatauyangdiserapolehsistempada reaksi pembentukan 1 mol senyawa dari unsur-unsurnya,sedangkan UH= +53,0 kj/mol untuk pembentukan 2 mol HI, maka:UHpembentukannya: H2+ I2oHI UH = +26,5kj/molBer dasar kan per samaan r eaksiber i kut:C + O2 o CO2 UHf = -395,2 kj/molTent ukanl ah ener giyang di per l ukan unt uk pembent ukkan 0, 25 molCO22. Ent al pipengurai an ('Hd)Entalpi penguraian adalah kalor yang dilepaskan atau yang diserap oleh sistempada reaksi penguraian 1 mol senyawa menjadi unsur-unsurnya.Perubahan entalpipembentukan dilambangkan dengan UHd. d berasal dari decompotition yang berartipenguraian.Contoh: a. CO2 oC + O2UHd = 395,2 kj/molb. AlBr3 oAl+1Br2 UHd = +511 kj/molBer dasar kan per samaan r eaksiber i kut:Al +1Br2oAlBr3UHf = -511kj/molTent ukanl ah ener giyang di per l ukan unt uk mengur ai kan 2, 5 molAl Br33. Ent al pipembakaran('Hc)Entalpipembakaranadalahkaloryangdilepaskanolehsistempadareaksipembakaran 1 mol unsur/senyawa.Perubahan entalpi pembakaran dilambangkandenganUHc.cberasaldaricombutionyangberartipembakaran.Contoh: a. C +O2o CO2UHc=-395,2kj/molb. C2H2 +O2 o2CO2+H2O UHc=-1298kj/mol4. Ent al pipenet ral an('Hn)Entalpipenetralanadalahkaloryangdilepaskanolehsistempadareaksipenetralan1molsenyawabasaolehasam(OH-+H+oH2O).PerubahanKimia untuk SMA dan MA kelas XI44entalpipenetralandilambangkandengan'Hn.nberasaldarinetrallizationyangberartipenetralan.Cont oh:NaOH+HCl oNaOH+H2O 'Hn = - 57,7 kj/mol3.3. HukumHessEntalpiadalahsuatufungsikeadaan,yanghanyatergantungpadakeadaanawaldanakhirdaripereaksidanhasilreaksitanpamemperhatikanjalannyaperubahanzatpereaksimenjadihasilreaksi.Walaupun reaksidapat melalui berbagai langkah mekanisme berbeda, secarakeseluruhanentalpireaksitetapsama.HukumHess,menyatakanjikareaksidilakukan melalui beberapa tahap, 'H untuk reaksi tersebut akan sama dengan jumlahdari perubahan entalpi untuk masing masing tahap reaksi.Sehingga perubahan entalpisuatureaksimungkinuntukdihitungdariperubahanentalpireaksilainyangnilainya sudah diketahui. Hal ini dilakukan supaya tidak usah dilakukan eksperimensetiapsaat.Kitadapatmenggunakaninformasidarisejumlahreaksi-reaksilainuntukmenentukan'Hyangbelumdiketahui.Penentuan'Huntukreaksi;12 2( ) ( ) ( ) Cs O g COgosecaraeksperimendapatdilakukan:2 2( ) ( ) ( ) 393, 5 Cs O g CO g H kJo '12 2 2( ) ( ) 283, 0 COg O CO g H kJo 'Kita dapat membalikkan reaksi ke 2 (sehinggga menjadi reaksi endoterm danmemilikiCO(g) sebagaihasil reaksi.Inimenggambarkan dekomposisiCO2untukmenghasilkan COdan O2.12 2 2( ) ( ) ( ) 283, 0 CO g COg O g H kJ o'Sehinggakeduareaksidapatdijumlahkanmenjadi:2 212 2 212 2 2 2 2( ) ( ) ( ) 393, 5( ) ( ) ( ) 283, 0( ) ( ) ( ) ( ) ( ) ( ) 110, 5 o 'o'o 'Cs O g CO g H kJCO g COg O g H kJCs O g CO g CO g COg O g H kJpembuanganduazatyangsamapadakeduasisiakanmenghasilkanpersamaanreaksi:12 2( ) ( ) ( ) 110, 5 Cs O g COg H kJo 'Cont oh:Karbonmembentukduajenis:grafitdanintan.Entalpipembakarangrafitadalah3939,5kJsedangkanintan395,4kJTermokimia45Tugas Mandi r iC(grafit)+O2(g)oCO2(g) 'H= -393.5kJC(intan)+O2(g) oCO2(g) 'H= -395.4kJHitunglah'Huntukmerubahgrafitmenjadiintan.Jawab : Yangkitainginkanadalah'Huntukreaksi:C(grafit)oC(intan)C(grafit) +O2(g) oCO2(g) 'H=-393.5kJCO2(g)oC(intan)+O2(g) 'H = +395.4 kJC(grafit)oC(intan)'H=+1.9kJBer dasar kan per samaan r eaksiber i kut:2FeO(s)o2Fe(s)+O2(g) 'H=544, 0kJ2Fe2O3(s)o4Fe(s)+3O2(g) 'H=1648, 4kJFe3O4(s)o3Fe(s)+2O2(g) 'H=1118, 4kJt ent ukanl ah 'H Reaksi nya :Fe3O4(s)oFeO +Fe2O3Denganmenggunakanhukumkekekalan energi, kita pun dapat meng-gunakannyadalambentukdiagramenergisuatureaksi.Contohpembakar-an metana untuk menghasilkan gas H2OdankemudianpengembunangasH2Ountukkeadaanpadat.DalamdiagramenergitampaksebagaimanaterlihatpadaGambar3.4.Sehingga, untuk mengetahui entalpireaksi:CH4(g)+ O2(g) o CO2(g) +2 H2O(l)Nilainya akan sama dengan'H1='H2+'H3untukmengetahuientalpireaksi:CH4(g)+ O2(g) o CO2(g) +2 H2O(g)Nilainya akan sama dengan'H2='H1-'H3untukmengetahuientalpireaksi:2 H2O(g))o2H2O(l)Nilainya akan sama dengan'H3='H1-'H2Gambar3.4Diagramperubahanent alpireaksipembakaranmet anaKimia untuk SMA dan MA kelas XI46Tugas Mandi r iBer dasar kan di agr am ener giber i kut:t ent ukanl ah'HReaksi nyapeng-uapan 36 gr am ai r.3.4. Penent uan 'H Reaksidar i'HPembent ukan St andarBerdasarkan hukum Hess kita bisa menentukan perubahan entalpi suatu reaksidenganmelihatdataentalpireaksiyanglain,dataentalpiyangmenjadidasarpenentuan tersebut adalah data perubahan entalpi pembentukan standar.Entalpipembentukan standar merupakan entalpi reaksi pembentukan suatu senyawa yangdiukurpadatekanan 1atm,suhu25oC.Jikakita memilikireaksiseperti:a W+b Xoc Y+ d Zmakaberdasarkanperhitunganperubahanentalpireaksiadalah:'Hreaksi ='H(hasil reaksi)- 'H(zat pereaksi)menjadi:'Hreaksi =(c x 'Hf Y+d x 'Hf Z)-(a x 'Hf W+b x 'Hf X)Apakahbenarsepertiitu?Marikitabuktikanbersama.Kitamengetahui12 2 2( ) ( ) 283, 0 COg O CO g H kJo 'sedangkan 'HfCO= -110,5kJ/moldan'HfCO2 =-393,52kJ/moljikapernyataandiatasbenarmaka12 2 2283.0 (1 ) (1 ) kJ x H CO x H CO H O '' 'karena, oksigenmerupakan unsur maka'Hf O2=0.283, 0 (1 393, 52 ) (1 110, 5 0)283, 0 393, 52 110, 5283, 0 283, 02kJ x kJ x kJkJ kJ kJkJ kJ

hanyaterjadisedikitperbedaan,yangmenunjukkancarainicukupakuratuntukdigunakandalampenentuan'Hsuatureaksi.Contoh:'Hf CO= -110,5 kJ/mol'HfCH3OH=-239,0kJ/molTermokimia47Tugas Mandi r iTentukanlahperubahanentalpireaksiantarakarbonmonoksida(CO)danhidrogen(H2)untukmembentukmetanol(CH3-OH).Jawab:Persamaanreaksinyaadalah:CO(g)+2H2(g)oCH3OH(l)Maka :'Hreaksi=(1 x 'Hf CH3OH) (1 x 'Hf CO+

2

x 'Hf H2)= (1 x 239,0 kJ/mol) (1x 110,5 kJ/mol+ 2

x 0)= -239,0 kJ/mol+ 110,5 kJ/mol= -128,5 kJ/mol'HfH2bernilainolkarenaH2-merupakanunsur.Unt ukper samaan r eaksiber i kut:4NH3(g)+5O2(g)o4NO(g)+6H2O(l )Dengan mel i hatdat a ent al pipembent ukkan st andarpada t abel4. 1,t ent ukanl ah'HReaksi nya!Berikutadalahdataentalpipembentukanbeberapasenyawa:Tabel 3.1Ent alpi pembent ukan 'Hf, dalam kJ/ mol pada suhu 25oCAgCl(s) -127,07AgCN(s) 146,00AlBr3(s) -511,12AlCl3(s) -705,63CH4(g) -74,81C2H2(g) 226,70C2H4(g) 52,60C2H6(g) -84,68C6H6(g) 48,99CH3NH2(g) -23,00CH3OH(g) -201,10CH3OH(l) -239,52CO(g) -110,50CO2(g) -393,52CS2(g) 117,10ClF(g) -54,48CaO(s) -635,13Ca(OH)2--986,17CaCO3(s) -1207,00CaCl2-795,80CaCl2H2O -1109,00CaCl22H2O -1403,00Fe2O3(s) -824,20SO3(g) -395,70Zat 'HfoZat 'HfoKimia untuk SMA dan MA kelas XI48SO2(g) -296,83O3(g) 143,00NO2(g) 33,20NO(g) 90,25NaCl(aq) -407,10NaCl(s) -411,00NH4I(s) -201,40NH4F(s) -463,96NH4Cl(s) -314,40NH4Br(s) -270,80NH3(s) -46,11LiF(s) -616,93H2SO4(l) -813,99H2S(g) -20,20H2O2(l) -187,80H2O2(g) -136,10H2O(l) -285,83HCN(g) 135,00HI(g) 26,50HF(g) -271,10HCl(g) -92,31HBr(g) -36,403.5. Ener giI kat an dan Penent uan'H ReaksiSuata proses yang penting dalam menafsirkan reaksi kimia adalah pemutusanikatandalam molekulmenjadi atom-atompembentuknyadan membentukikatanyangbarudenganatomyanglain.Misalnyareaksi:CH4(g)+ Cl2(g) oCH3Cl(g)+HCl(g)Terjadidalambeberapatahap:Pemutusanikatan dalam molekulklor :Cl-Cl(g) o Cl(g) + Cl(g) Pemutusan ikatan dalam molekul metanaH3C-H(g)o H3C(g) + H(g) PengabunganatomklorpadaCH3H3C(g) + Cl (g) o H3C-Cl(g) PengabunganatomklordenganatomhidrogenH(g) + Cl (g) oH-Cl(g)Sehinggauntukmenentukan'Hreaksi,kitadapatmengunakandatadarienergiyang diperlukan untuk memutuskan ikatan tersebut, sedangkan data energi yangdiperlukanadalahreaksikebalikandaripemutusanikatan.DataenergipemutusanikatantersebutdapatdilihatdalamTabel3.2.Termokimia49Tabel3.2Energi disosiasi ikat anIkatan Energi (kJ/mol) Ikatan Energi (kJ/mol)H -H 436,0 H - F 567,6N N 945,3 H - Cl 431,6O - O 498,3 H - Br 366,3F - F 157,0 H - I 298,3Cl -Cl 242,6 Cl - F 254,3Br- - Br 193,9 Cl - Br 218,6I - I 152,6 Cl - I 210,3C -C 347,0 O = O 498,0C = C 612,0 O -H 464,0C C 835,0 C - O 358,0C - H 413,0 C = O 749,0Contoh:Tentukanlah'Hreaksi:H2C = CH2(g) + H2(g)o H3C-CH3(g)Jawab:DiketahuienergidisosiasiikatanC -C adalah347 kj/mol C = Cadalah612 kj/molC - H adalah 413 kj/mol H - H adalah 436 kj/molReaksidapatdituliskansebagai:Zat pereaksi terdiri dari 1 ikatan C = C, 4 ikatan C-H dan 1 ikatan H-H, sehingga:'H(pemutusan)= 1(614)+4(413)+1(436) = 2702 kJSedangkanhasilreaksiterdiridari1ikatanC-Cdan6ikatanC-H,maka:'H(pembentukan)= 1(348)+6(413) = 2826 kJkarena'Hreaksi ='H(pemutusan)- 'H(pembentukan)= -124Kimia untuk SMA dan MA kelas XI50Tugas Mandi r iBer dasar kandat aener gi di sosi asi i kat anpadat abel 3. 2 Tent ukanl ahper ubahanent al piunt uk r eaksi:4NH3(g)+5O2(g)o4NO(g)+6H2O(l )Bandi ngkanhasi l nyadenganpeker j aanmusebel umnya, yai t umengunakandat aent al pipembent ukkan st andar.Sang I l muwanJAMESPRESCOTJOULE(18181889)lahirdiManchesterInggris.Penelitiannyadimulaidilabola-torium ayahnya. Pendidikan dasar Joule di rumah, denganayah dan ibunya sebagai guru. Minatnya pada penelitianmuncul pertama kali ketika ia sedang bekerja untuk meng-gantikan mesin uap dengan motor listrik untuk keper-luankeluarganya.Iamembandingkanjumlahpanasdengankerjamekanikmenggunakaneksperimenkincir angin. Ia menghabiskan masa bulan madu dengan mempelajari kincirangin dan ia menemukan suhu air di dasar air terjun lebih tinggi dibandingdengan yang berada di atasnya. Ini menunjukkan energi air terjun telah diubahsebagianmenjadipanas.Joulebanyakmemberisumbanganpadailmupengetahuanterutamayangberhubungandenganpanas.GERMAINHENRIHESS(1802-1850)Hesssangatberperandalampengembanganilmupengetahuan,terutama dalam termokimia, studi tentang termokimiaia mulai pada tahun 1839. Pemikirannya tentang keter-libatanpanasdalamreaksikimiakitakenalsebagaihukumHess,yangmerupakanhukumyangbersifatempirik. Hal ini dijelaskan dalam teori termodinamika,yangmenunjukkanbahwaentalpisebagaifungsikeadaan. Para ahli kimia mengunakan hukum ini secara luas untuk mengetahuipanaspembentukkansuatusenyawayangtidakdapatdilakukansecaralangsungdariunsur-unsurpembentuknya.Sumber:http://www.chemistry.co.nzTermokimia51z Perubahan entalpi adalah energi yang diserap atau diterima sistem padatekanantetap.z Sistem yang memiliki entalpi yang lebih besar pada akhir reaksi, sehinggamenyerap panas dari lingkungan, reaksinya merupakan reaksi endoterm,sehinggapadareaksiendotermHakhir>Hawaldan'Hpositif('H=+).z Sistemyangmemilikientalpiyanglebihrendahpadaakhirreaksi,sehinggamelepaskanpanaskelingkunganselamareaksi,makapadareaksieksotermHakhir>Hawaldan'Hbernilainegatif('H=-).z Entalpi reaksi atau kalor reaksi, terdiri dari entalpi pembentukan, entalpipenguraian,entalpipenetralandanentalpipembakaran.z Entalpi pembentukan adalah kalor yang dilepaskan atau yang diserap olehsistempadareaksipembentukan1molsenyawadariunsur-unsurnya.z Entalpi penguraian adalah kalor yang dilepaskan atau yang diserap olehsistem pada reaksi penguraian 1 mol senyawa menjadi unsur-unsurnya.z Entalpipembakaranadalahkaloryangdilepaskanolehsistempadareaksipembakaranunsur/senyawa.z Entalpi penetralan adalah kalor yang dilepaskan oleh sistem pada reaksipenetralan 1 mol senyawa basa oleh asam (OH- + H+oH2O).z Entalpi pembentukkan standar suatu zat adalah perubahan entalpi untukreaksi pembentukan suatu zat dari unsur-unsurnya pada keadaan standar(tekanan 1 atm, suhu 298 K).z Hukum Hess, menyatakan jika reaksi dilakukan melalui beberapa tahap,'H untuk reaksi tersebut akan sama dengan jumlah dari perubahan entalpi untukmasing masing tahap reaksi.z untukmenentukan'Hreaksi,kitadapatmengunakandatadarienergiyangdiperlukanuntukmemutuskanikatantersebut,sedangkandataenergiyangdiperlukanadalahreaksikebalikandaripemutusanikatanKimia untuk SMA dan MA kelas XI521. Apadefinisidariistilahberikut:a. endoterm b. perubahanentalpic. entalpipenguraian d. energidisosiasiikatan2. Tuliskanlahreaksi:a. pembentukanH2O b. penguraian Al2O3c. pembakaranC2H6d. penetralanBa(OH)2olehHCl3. DenganmenggunakanhukumHess,hitunglahperubahanentalpireaksipembakaranasetilena:C(s) + O2(g)o CO2(g)H2(g) + O2 oH2O(l)2 C(s) + H2(g)o C2H2(g)dengan'Hr masing-masingreaksiadalah393,52;-285,83dan226,7kJ.4. Denganmenggunakandatadaritabel3.1.hitunglah'Hrdarireaksi-reaksiberikutini:a. H2(g)+N2(g)o2 NH3b. C2H2(g)+ 2H2(g) o C2H6(g)c. 2 C2H6(g)+ 7 O2 o 4 CO2(g)+6 H2O(l)5. Denganmengunakandataenergiikatandaritabel3.2.hitunglah'Hrdarireaksi-reaksiberikutini:a.H2(g) + N2(g)o2 NH3b. C2H2(g)+2H2(g) o C2H6(g)c.2 C2H6(g)+ 7O2 o 4 CO2(g)+6 H2O(l)Termokimia53Filltheblankwiththeanswerofthisquestion!Vertically:1.NameofscientistthathisnameweuseasunitofenergyHorizontally2. 'Hf,fistakenfromword.1. Whencallorimeterusewithconstantpressurewecangetthis..2. NameofscientistGermainHenri3. 4,2caloryis1.4. macromoleculewith17kJ/mol eburn values5. FirstnameofHenryHess6. Reactionwithnegativechangeofenthalpy7. Weusethebond..energytocalculateenthalpyofthereactionKimia untuk SMA dan MA kelas XI541. yangdimaksuddenganentalpipembentukkanadalahA. KaloryangdilepaskansaatsuatusenyawaterbentukB. Kalor yang dibutuhkan untuk mengubah senyawa menjadi unsur-unsurnyaC. Kalor yang terlibat dalam pembentukkan 1 mol senyawa dari unsur-unsurnyaD. KaloryangdibutuhkanuntukmenetralkansuatuasamE. Kaloryangdilepaskanpadapembakaran1molsuatusenyawa2. Untukreaksi:2 C(s) +O2(g)o 2 CO DH= -221 kJPernyataanberikutadalahbenarkecuali:A. ReaksiberjalansecaraeksotermB. Entalpipembakaran =110,5 kJC. EntalpipembentukkanCO=-221kJD. ReaksitersebutadalahreaksipembakaranE. Entalpi penguraian CO = 110, 5 kJ3. Perhatikandiagramberikut:makanilaikaloryangdipergunakanuntukmenguapkan1molairnilainyasamadengan:A. 'H1D. -'H2B. 'H2E. -'H3C. 'H34. Diketahuiuntukreaksi:2 Al(s)+3 Br2(g)o 2 AlBr3'H=-1022,2 kJmakaentalpipenguraianAlBr3adalah:A. 1022,2kJ D. +511,1 kJB. +1022,2kJ E. 2044,4kJC. -511,1kJTermokimia555. Diketahui :S(s) +O2(g) o SO2(g)'H = -296,83 kJ/molS(s)+1O2(g)oSO3(g)'H = -395,70 kJ/molPerubahan entalpiuntuk reaksiSO2(g)+ O2(g)o SO3(g)adalah.A.98,70kJ D. 692,53kJB. +98,70kJ E. +692,53kJC. 197,4kJ6. Manakahreaksipenguraianberikut,yangentalpinyatidaksamadenganentalpipenguraianstandar:A. H2O2oH2+O2D. CH3OH oC+ 2 H2 + O2B. H2Oo H2+ O2E. CaCO3oCaO + CO2C. CO2oC + O27. Diketahui 'Hof (Fe3O4) = + 266 kkaldan 'Hof (H2O(g)) =+ 58 kkal.Berapakahkalorreaksireduksi:3Fe(s)+ 4H2O(g) oFe3O4(s) +4H2 (g)A. 34 kkal D.498kkalB. 208 kkal E.34kkalC. 324kkal8. Pembakarangaspropanamengikutipersamaanreaksi:C3H8(g) +5 O2(g) o 3 CO2+4 H2OJika 'Hof (C3H8(g)) =-a kkal, 'Hof (CO2 (g)) = + b kkal='Hof (H2O) = +c kkalMakaentalpipembakaranasetilenaditentukansebagai:A. ( b + c a ) kkal D. ( 3b + 4c + a) kkalB. (b + c + a) kkal E. (-a-3b 4c)kkalC. ( 3b + 4c a) kkal9. Jika1molgasasetilenadibakarsesuaidenganpersamaanreaksi:C2H2(g) +2 O2 o2 CO2+H2OMelepaskankalorsebesar1082kJ.Dandiketahui'Hof(CO2(g))=-394kJ='Hof(H2O)=-242kJ.Makaentalpipembentukkangasasetilenaadalah.A. 52kJ D. +446 kJB. 446kJ E. +1718 kJC. + 52 kJ10. Diketahuidataenergiikatan: HH = 436,0kJ/molH F = 567.0kJ/molF F = 157,0 kJ/molKaloryangdiperlukanuntukpembentukan2molasamflouridaadalah..A. 52kJ D. -105kJB. 26kJ E. 541kJC. 13kJKimia untuk SMA dan MA kelas XI5611. Jikaenergiikatan:C = C =a kkal C C = b kkalC H =ckkalH H = dkkalUntukreaksi: C2H4 +H2 o C2H6Nilaiperubahanentalpireaksiakansamadengan:A. a + d - b - 2c D. b + 2c - a + dB. a + d - b + 2c E.b + 2c - a - dC. a + b c + d12. Darideretanreaksiberikut,manayangnilaientalpipembentukkannyaberdasarkanselisihenergiikatanbernilainol:A. C2H5OH+ HBr oC2H5Br +H2OB. H2OoH2+ O2C. 2 CH3OH + 3 O2 o2 CO2+4 H2OD. H2O2oH2+O2E. CH3OH + HCOOHoCH3OOCH +H2O13. PerhatikandiagramreaksipembentukkangasCO2dariunsur-unsurnyaPerubahanentalpi('H)padapembentukkan1molCO2dariCOadalah..A. 26,4kkal D. 67,7kkalB. 26,4kkal E. 94,1kkalC. 67,7kkalEbtanas93/9414.Diagramtahapreaksidantingkatenergi,reaksipembentukangasSO3Berdasarkandiagramdiatas,'H3adalah.A. 1384,2kJ D. 196,6kJB. 780,4kJ E. -196,6kJC. 593,8kJEbtanas92/93CO2Termokimia5715.Dataenergiikatanrata-rataberikut:C H =99 kkal C = C =164 kkal C Cl = 79 kkalC C =83 kkal H Cl=103 kkalBesarnyaperubahanentalpidarireaksi:CH3 CH= CH2+ HCl o CH3 CH CH3 | ClA.36kkal B. 8kkal C. +6 kkalD. 6 kkal E. 8 kkalEbtanas91/9216. Diketahuientalpipembakaran1molCH4=-18kkal,energiikatanO =O= 119 kkal mol-1C = O= 173 kkal mol-1dan O H = 110 kkal mol-1MakaenergiikatanCHmenjadi:A. 6,75kkal B. 11,05kkal C. 33,13kkalD. 66,2kkal E. 132,5kkalEbtanas90/9117. BerikutiniadalahdiagramtingkatenergipembentukkangasCO2.Berdasarkandatadiatas,makaharga'H2adalah.A. 'H2 = 'H3+ 'H1D. 'H2 = 1/3 ('H1- 'H3)B. 'H2 ='H3 -'H1E. 'H2= ('H1-'H3)C. 'H2 ='H1 -'H3Ebtanas89/9018. Diketahuienergiikatanrata-rata:C H : 99 kkal mol-1 C O: 85 kkal mol-1C = O: 173 kkal mol-1O H: 111 kkal mol-1Kalorreaksipadapembakaran1molmethanolmenurutreaksi: H |H C O H + 1 (O = O)oO = C = O+ 2(H O H) | HAdalah.Kimia untuk SMA dan MA kelas XI58A. 67 kkal B.103,5kkal C. 118,5kkalD. 415,5kkal E. 474,5kkalEbtanas89/9019. Pada suatu reaksi suhu dari 25o C dinaikkan menjadi 75oC.Jika setiap kenaikan10oCkecepatan menjadi 2 kali lebih cepat, maka kecepatan reaksi tersebutdiatasmenjadi..kalilebihcepat.A.8 B. 10 C.16D. 32 E. 6420.Diketahui entalpi pembakaran 1 mol Propana = -365 kkal = C H = 99 kkalmol-1 energiikatanO =O= 119 kkal mol-1C = O= 173 kkal mol-1dan O H = 110 kkal mol-1MakaenergiikatanCHmenjadi:A.166kkal B. 83 kkal C. 132.5kkalD. 192 kkal E.150kkalLaju Reaksi59Laj u ReaksiBabKitaseringmelihatmotoratauterkadangmobilmelajudengancepatdilintasanbalap,danyangmemilikiwaktutersingkatuntukmencapai garis finish atau menyelesai-kan putaran, dikatakan memiliki lajuyangtercepat.Berdasarkanilmufisika laju adalah besarnya jarak yangditempuh persatuan waktu. Lalu apayangdimaksuddenganlajureaksi?Perubahanapaterhadapapayangmenjadipatokanlajureaksiberjalancepat atau lambat? Untuk itu mari kitakajibersamabahasanberikutini. Si swamampumendeskripsi kanpengert ianlajureaksidenganmelakukanpercobaantentangfaktor-faktoryangmempengaruhilajureaksi Memahami t eori t umbukan(t abr akan)unt ukmenjelaskanfaktor-faktorpenentulajudanordereaksi,danterapannyadalamkehidupansehari-hari.Kompet ensi Dasar59Kimia untuk SMA dan MA kelas XII59Kimia untuk SMA dan MA kelas XII 59Kimia untuk SMA dan MA kelas XIPet a KonsepKimia untuk SMA dan MA kelas XI604.1. Ungkapan Laj u ReaksiLajubeberapakegiatan, misalnya, berlari, membaca, memasak, dsb,menyatakan jumlah tertentu yang kamu selesaikan terhadap waktu.Dengan carayang sama kita juga dapatmengukur laju reaksi kimia.Contohreaksikimiasederhana: A Bmarikitaasumsikanreaksiinitidakterjadisecaratiba-tiba,tapiberlangsungdalamselangwaktutertentu.Lajureaksidapatdinyatakansebagaiukuranperubahan jumlah molekul A ke molekul B persatuan waktu.Jumlah molekulnyadapatdinyatakandalamsatuanmol,sedangkanwaktunyadalamdetik.

- =Perubahanjumlah mol BLaju reaksi rata rataPerubahan waktu

( ) ( )- A=AA=Amol Btmol AtVolumereaksibiasanyatetapkonstan.Untukmengontrollajureaksiseringdigantikan dengan penggunaan konsentrasi, sehingga satuannya menjadi M/detikatau M/menit. = =Pertambahan konsentrasi B Pengurangan Konsentrasi ALaju reaksiPerubahan Waktu Perubahan Waktu4.2. Fakt or -f akt oryang Mempengar uhiLaj u ReaksiLajureaksikimiadapatberlangsungcepat,ataulambatdandapatjugameningkatdipengaruhiolehberbagaifaktor.Apasajayangmempengaruhilajureaksi?Cobakamulakukanpengujiansebagaiberikut:Fakt or -f akt or yangmempengar uhi l aj ur eaksiAlat yang digunakan : gelaskimia,gelasukur,batangpengaduk,termometer,pemanaslistrik,timbangan,stopwatch.Zat yang digunakan : seng granul, serbuk seng, HCl encer, HCl pekat,indikator universal.Lakukan langkah kerja berikut :Bukt i kanLaju Reaksi61Reaksipembandi ng Timbang 1,7 gram serbuk seng Ambil25mLHCl0,5Mdanmasukkankedalamgelaskimia1,tambahkanindikator universal catat warna dan suhunya Bersamaandenganditekannyatombolst opwat chmasukkanserbuksengkedalam gelas kimia yang berisilarutan HCl. Matikanst opwat chketikalarutanberubahwarnamenjadihijaudancatatwaktunya.Pengubahan konsent rasi: Timbang 1,7 gram serbuk seng Ambil 25 mL HCl5 M dan masukkan kedalam gelas kimia 1, tambahkan indikatoruniversal catat warna dan suhunya Bersamaandenganditekannyatombolst opwat chmasukkanserbuksengkedalam gelas kimia yang berisilarutan HCl. Matikan stopwatch ketika larutan berubah warna menjadi hijau dan catat waktunya. Catatlah semua data yang diperoleh, dan buat kesimpulanPengubahan l uas permukaan : Timbang 1,7 gram seng granul Ambil25mLHCl0,5Mdanmasukkankedalamgelaskimia1,tambahkanindikator universal catat warna dan suhunya Bersamaan dengan ditekannya tombol st opwat ch masukkan serbuk seng kedalamgelas kimia yang berisilarutan HCl. Matikan st opwat ch ketika larutan berubah warna menjadi hijau dan catat waktunya. Catatlah semua data yang diperoleh, dan buat kesimpulanPengubahan t emperat ur : Timbang 1,7 gram serbuk seng Ambil25mLHCl0,5Mdanmasukkankedalamgelaskimia1,tambahkanindikator universal catat warna dan suhunya Panaskan penangas air sehingga mencapai suhu 50oC Bersamaan dengan ditekannya tombol st opwat ch masukkan serbuk seng kedalam gelas kimia yang berisilarutan HCl. Masukan kedalam penangas yang suhunya relatif konstan 50oC. Matikan st opwat ch ketika larutan berubah warna menjadi hijau dan catat waktunya. Catatlah semua data yang diperoleh, dan buat kesimpulanKimia untuk SMA dan MA kelas XI62Berdasarkan data percobaan berikut :Buatlah grafik berdasarkan data tersebut dan apa yang dapat kamu simpulkanmengenai hubungan antara laju reaksi dan kenaikan suhu berdasarkan grafik yangdiperolehBerdasarkanteoritumbukansuatufaktorakanmempengaruhilajureaksidapatdijelaskansebagaiberikut:1. Konsent rasiUntuk beberapa reaksi baik reaksi dalam fasa gas, cair ataupun padat kenaikankonsentrasimeningkatkanlajureaksi.Contohreaksiantaraasamkloridayangditambahkan pada natrium tiosulfat, endapan kuning terbentuk yang menunjukkanpembentukkanbelerang.Na2S2O3(aq)+2 HCl(aq)2 NaCl(aq)+H2O(l)+S(s)+SO2(g)Jika larutan natrium tiosulfat dibuatsemakin encer, pembentukkan endapansemakinmembutuhkanwaktuyanglama.Denganasumsibahwareaksiterjadiantaraduapartikelkarenaterjadinyatumbukan,tumbukanyangmenghasilkan reaksi disebut tumbukanefektif.Iniberlakuuntukreaksipadafasaapapun,baikuntukfasagas,cairatau pun padat.Jika konsentrasi tinggimaka kemungkinan terjadinya tumbuk-ansemakinbanyak.Anggaplah pada suatu waktu kamupunyasatujutapartikelyangmemilikicukupenergiuntukmengatasienergiaktivasinyasehinggadapatbereaksi,atauE>Ea.Jikakamupunya100jutamakaakanbereaksi100juta,makahasilreaksibiasanyamengikutikelipatanzatpereaksiyangditambahkan.Tugas Mandi r iSUHU WAKTU00C 1 detik100C 2,44200C 5,58300C 12,11400C 25500C 49,42SUHU WAKTU600C 1 menit 33,7 detik700C 2 menit 51 detik800C 5 menit 2,3 detik900C 8 menit 37,2 detik1000C 14 menit 18 detikGambar4.2Pengaruhkonsent rasipadaj alanreaksimolekul airencerpekatencerpekatsalahsatupereaksipadatanLaju Reaksi632. Luas Per mukaanJikakitagunakanpadatandalambentukserbukbiasanyahasilreaksiakanlebih cepat diperoleh.Hal itu dikarenakan zat dalam bentuk serbuk memiliki luaspermukaanyanglebihbesar.Memperbesarluaspermukaanpadatanakanmeningkatkanpeluangterjadinyatumbukan.Bayangkansebuahreaksiantaralogammagnesiumdanasamkloridaencer.Reaksiakanmencakuptumbukanantaraatommagnesiumdanionhidrogen.Mg(s) +2 H+(aq) Mg2+(aq)+ H2(g)Gambar4.3Pengaruhluaspermukaanpadaj alanreaksi3. Temperat urDanpadaumumnyareaksiakanberlangsung dengan semakin cepat jikadilakukandenganpemanasan.Pema-nasanberartipenambahanenergikine-tikpartikelsehinggapartikelakanber-geraklebihcepat,akibatnyatumbukanyangterjadiakansemakinseringTumbukan akan menghasilkan hasilreaksijikapartikelyangbertumbukanmemilikienergiyangcukupuntukmelakukannya.Energiminimuminidisebutsebagaienergiaktivasiuntukbereaksi.Hal itu digambarkan sebagai-manapadaGambar4.4.Gambar4.4Energiakt ivasireaksiKimia untuk SMA dan MA kelas XI64Gambar4.5Pengaruhsuhupadaj alanreaksiHanya partikelpada daerahenergitinggi (daerah hijau) yang dapat meng-atasienergiaktivasisehinggamenga-lamitumbukkanefektif.Partikeltidakdapatbereaksikarenatidakmemilikienergiyangcukup,sehinggasetelahbertumbukankembaliberpisah.Untukmempercepatreaksi,jumlahpartikeldengan energi yang cukup untuk bereaksiharus ditingkatkan. Meningkatkan tempe-ratur berar