video editing@

Download Video editing@

Post on 13-Jul-2015




3 download

Embed Size (px)


Slide 1

EDITING VIDEO1Video editing adalah gabungan antara seni dan teknik dari bahan dasar berupa potongan gambar dan suara atau populer dengan nama clip, yang dipadukan dan diolah sehingga mempunyai arti dan makna yang jelas.Proses seni dalam video editing terdiri dari apa saja bagian yang diambil, dihapus atau digabungkan dari berbagai sumber agar menjadi satu, masuk akal dan enak untuk dilihat.Proses teknik dari video editing meliputi kemampuan untuk mewujudkan ide dari seni itu sendiri, bagaimana hasil seni itu bisa dinikmati oleh orang lain, bisa berupam Film, Casset Video maupun piringan Cakram (Video CD DVD ).Pendahuluan2Linear editing hanya mengandalkan pada hasil gambar yang direkam kamera, dan sangat bergantung pada orang yang mengoperasikan kamera, biasanya dalam pengambilan gambar mengikuti urutan yang sudah direncanakan, karena dalam prosesnya gambar yang diambil berupa duplikat atau copy dari master shootingnya sehingga banyak terjadi penurunan kwalitas gambar akibat dari peoses editing.Jenis Video EditingNon-linear editingMetode editing ini menggunakan komputer untuk melakukan proses editing. Proses ini hampir seluruhnya dilakukan secara digital dan tidak menggunakan proses mekanik terkecuali dalam meng-import dan meng-eksport hasil akhir kedalam kaset atau CD. Editing ini pada dasarnya menggunakan metode cut and PasteLinear editing3Saat ini linear editing sudah banyak ditinggalkan karena sangat mahal, sebaliknya editing non linear sudah sangat murah dan kwalitas gambar dan suara yang cukup baik. Adanya standar membantu menjaga mutu gambar terutama setelah para pembuat komputer mengikuti format gambar DV (Digital Video) yang banyak dipakai oleh para pembuat kamera sehingga penurunan mutu gambar pada saat proses capturing bisa diminimalisasi.Pada saat ini proses untuk mentansfer gambar dari kamera ke komputer sudah sangat mudah karena adanya interface yang kadang sudah terintegrasi pada matherboard komputer bahkan notebook yaitu port firewire atau port 1394.Perangkat lunak atau sofeware editing sudah sangat banyak dan mudah digunakan dan tidak memerlukan hardware kecuali untuk external monitor.Linear atau Non Linear Editing ???4Konsep dan aturan dasar proses editing video adalah sama, tetapi bekerja pada lingkungan digital sehingga memungkinkan editor menjadi lebih kreatif dan bebas pada setiap langkah editing, seperti merevisi dan memperbaiki hasil editan tanpa menurunkan mutu gambar.Proses video editing menjadi lebih mudah , seperti memindahkan scene atau urutan gambar cukup dengan di cut and paste sekaligus menambahkan efek dan judul. Dengan editing digital, setelah video selesai bisa disimpan ke kaset untuk kemudian di tonton kembali atau di duplikat ke media lain seperti CD atau DVD . Komputer non-linear editing harus mempunyai kombinasi yang baik antara Ram, Hardisk dan OS, adanya konflik antara hardware, software dan komponen lainnya, dapat menyebabkan crash, hasil akhir yang direkam ke kaset dapat beragam, seperti lompat atau skipped frames (adanya frame yang hilang). Non-linear Editing5Kunci dasar untuk menjadi editor video yang sukses adalah waktu, kesabaran, pemahaman pada alat yang digunakan, dan selalu mencari ide-ide baru yang inovatif, ingat video editing adalah gabungan antara teknik dan seni yang dinamis. Perangkat Lunak EditingSaat ini perangkat lunak (sofware) editing sangat beragam dari yang kelas High end sampai yang Low end semua perangkat lunak ini mempunyai kelebihan dan kekurangannya masing-masing, sebagai user kita harus pandai dan tahu apa yang kita butuhkan. Dari sekian banyak perangkat lunak yang tersedia, yang mudah penggunaannya adalah Adobe Premiere, untuk itu dalam pelatihan ini saya akan menggunakan adobe premiere pro karena pada dasarnya kalau kita sudah memahami cara kerja perangkat lunak editing satu saja maka yang lain pasti akan mudah dipelajari6ADOBE PREMIERE PRO7Jalankan program Adobe Premiere Pro yang telah kita instal dengan cara pilih Start > All Programs > Adobe Premiere Pro. Tampilan awal program seperti gambar berikut.

Kotak Dialog Pembuka Memahami Tampilan Awal8Setelah menjalankan Adobe Premiere Pro maka langkah selanjutnya adalah membuat project baru dan mensetingnya, langkahnya : Membuat Project Baru dan Mengatur Seting Dasar1.KliktombolNewProjectyangterdapatpadakotakdialogpembuka.Makaakantampilkotakdialog New Project.

Tombol New Project9Kotak Dialog New Project

2.PadakotakdialogNewProjectaturAvailablePresetsdenganpilih-anDVPALStandard48KHz, 48KHz menyatakan rate audio ketika direkam.JikaDVCamcordermenggunakanformatvideoNTSC, pilihDVNTSCStandard48KHz. 3.LalupilihlahlokasipenyimpananfiledengankliktombolBrowse.4.IsikannamaprojectpadatextboxNamedengannamaBaru1.SelanjutnyakliktombolOK. Makaakantampil areakerjaAdobePremierePro.10Garis besar lingkungan kerja Adobe Premiere Pro terdiri dari 4 bagian utama, yaitu : 4.ToolsWindow,yangberadadisebelahkiribawah.

Mengenal Area Kerja Adobe Premiere Pro1.ProjectWindow,yangberadapadasebelahkiriatas.2.MonitorWindow,yangberadapadasebelahkananatas.3.TimelineWindow,yangberadadisebelahkiribawah.11Project Window adalah tempat dimana Anda menyimpan clip/footage (sebutan bagi file yang digunakan dalam digital video production) yang berupa file image, audio, title dan video yang akan digunakan dalam proses editing. Project Window memiliki 2 bagian yaitu Tab Project yang berisi daftar clip dan Tab Effects yang berisikan daftar efek audio, transisi audio, efek video dan transisi video.

Tab Project di dalam Project Window

Tab Effects di dalam Project Window Project Window12Monitor Window terdiri dari Source Monitor Window dan Sequence Monitor Window, di sebelah kiri merupakan Source Monitor Window, sedangkan sebelah kanan merupakan Sequence Monitor Window. Source Monitor Window sangat berguna dalam proses trimming video nantinya, dan Sequence Monitor Window digunakan untuk melihat preview hasil editing pada Timeline.

Tampilan Monitor Window Monitor Window13Timeline Window adalah tempat untuk menyusun dan menempatkan clip/footage untuk kemudian diedit. Dinamakan timeline karena bekerja berdasarkan waktu (secara horisontal), sedangkan secara vertikal Timeline dibagi dalam track, yang terdiri dari track Video dan Audio. Adobe Premiere Pro menggunakan format SMPTE dalam satuan waktunya. SMPTE (Society of Motion Picture dan Television Engineers) adalah organisasi dari orang-orang film dan televisi internasional. Satuan format SMPTE adalah berdasarkan Jam:Menit:Detik:Frame. Misalnya posisi 00: 05: 15: 19 artinya kita berada pada posisi menit ke-5, detik ke-15 dan frame ke-19. Dengan format ini kita akan tahu durasi dari sebuah movie.

Gambar 2.19 Tampilan Timeline Window Timeline Window14Tools Window berisikan tombol Selection Tool, Track Selection Tool, Ripple Edit Tool, Rolling Edit Tool, Rate Scratch Tool, Razor Tool, Slip Tool, Slide Tool, Pen Tool, Hand Tool, Zoom Tool yang nantinya banyak digunakan dalam proses editing video.

Tampilan Tools Window Tools Window15MENGCAPTURE VIDEO DAN AUDIO Proses selanjutnya adalah mengcapture audio dan video sebelum kita memulai proses editing, proses capture berguna untuk memindahkan hasil rekaman yang disimpan dalam kaset MiniDV dari kamera ke dalam komputer untuk dijadikan sebuah file dengan format video.

Kaset Video Mini DV

Konektivitas DV Camcorder dengan PC lewat FireWire 16Sebelum memulai capture video Anda dapat mengatur tempat penyimpanan hasil capture dan file preview di dalam harddisk. Caranya, dari menu pilih Edit > Preferences > Scratch Disks.

Mengatur tempat penyimpanan file Mengatur Tempat Penyimpanan File17Dalam Scratch Disks terdapat banyak pilihan, Kita dapat mengatur pilihan Captured Video untuk menentukan lokasi penyimpanan hasil capture video, sedangkan Captured Audio merupakan pengaturan lokasi penyimpanan hasil capture audio. Begitu pula dengan pilihan Video Previews dan Audio Previews yang merupakan pengaturan lokasi penyimpanan hasil preview video dan audio, sedangkan Conformed Audio merupakan pengaturan lokasi penyimpanan file audio hasil penyesuaian dari setting project (misalnya audio yang diimpor memiliki sample rate 32.000 Hz, sedangkan setting audio project Adobe Premiere Pro adalah 48.000 Hz, maka file audio yang diimpor akan digandakan dan disesuaikan dengan sample rate project Adobe Premiere Pro). Kemudian untuk menentukan lokasi penyimpanan pada masing-masing pilihan dapat digunakan tombol Browse. 18

Mengatur tempat penyimpanan file 19Memulai Proses CapturePada latihan kali ini kita akan memulai dari awal proses capturing, berikut ini langkah-langkahnya : 1.TancapkankabelFireWirekedalamkameraDVkita.2.SelanjutnyakomputerakanmengenaliDVCamcorderkita secara otomatis3.KemudianmenggunakanmenupilihFile>Capture,atautekanF5.


Window Capture 4.SetelahituakantampilkotakdialogwindowCapture. Apabila PC terkoneksi dengan DV Camcoder dengan baik maka akan tampil gambar video yang ada pada DV Camcoder215.Kemudiankitaakanmenyetingmetodepenamaan otomatis clip-cliphasilcapturekita,caranyadidalam TabLogging padapilihanClipDatayangberadadi dalamwindowCapture disebelahkanan,ubahlahisian TapeNamedanClipName.

Property Clip Data 6.KemudianklikTabSettingyangberadadisampingTabLogging.

226. LalutentukantempatpenyimpananhasilcapturemelaluipilihanCaptureLocation.DidalamCaptureLocationterdapatduaisianyaituAudiodanVideo,Audiomerupakanpengaturanlokasipenyimpananhasilcaptureyangberupafileaudio,sedangkanpilihanVideomerupakanpengaturanlokasi penyimpananhasilcaptureyangberupafilevideo. CarapengaturaninijugadapatdilakukanlewatmenuEdit>Preferences>ScratchDisks.

Tab Setting 237.LaluAturDeviceControlyangletaknyamasihberadadi dalamtabSetting.KliktombolOptions.

Device Control

248.SelanjutnyaakanditampilkankotakdialogDVDevice ControlOp