how am i supposed to organize a protein database when i can't even organize my address book?

17
How am I supposed to organize a protein database when I can't even organize my address book? Jeremy Yang UNM & IU CINF Flash session - ACS National Meeting, March 25, 2012 San Diego, CA

Upload: jeremy-yang

Post on 04-Jun-2015

235 views

Category:

Documents


1 download

DESCRIPTION

Presented at the Spring 2012 ACS National Meeting in San Diego, at the CINF flash session.

TRANSCRIPT

Page 1: How am I supposed to organize a protein database when I can't even organize my address book?

How am I supposed to organize a protein database when I can't

even organize my address book?

Jeremy Yang

UNM & IU

CINF Flash session - ACS National Meeting, March 25, 2012 – San Diego, CA

Page 2: How am I supposed to organize a protein database when I can't even organize my address book?

2

Alternate title (and take home message):

Cheminformatics is so great!

But is it too good to be

(transferably) true?

/ 17

Page 3: How am I supposed to organize a protein database when I can't even organize my address book?

How great is cheminformatics?

Example: Are these the same or different molecules?

3 / 17

Page 4: How am I supposed to organize a protein database when I can't even organize my address book?

How great is cheminformatics?

Example: Are these the same or different molecules?

Answer: Same, that’s easy, just use canonical graph algorithm via canonical SMILES:

CNC1C(O)C(O)C(CO)OC1OC2C(OC(C)C2(O)C=O)OC7C(O)C(O)C(NC(=N)NCNC(=O)C4=C(O)C(C3CC6C(=C(O)C3(O)C4=O)C(=O)c5c(O)cccc5C6(C)O)N(C)C)C(O)C7NC(N)=N

(TETRACYCLINOMETHYLSTREPTOMYCIN)

4 / 17

Page 5: How am I supposed to organize a protein database when I can't even organize my address book?

Thanks to…

? ?

5 / 17

Page 6: How am I supposed to organize a protein database when I can't even organize my address book?

Thanks to…

Harry Morgan

Actor, “MASH”

(Hmmm…?)

Dave Weininger

Daylight

(SMILES) 6

/ 17

Page 7: How am I supposed to organize a protein database when I can't even organize my address book?

Thanks to…

Harry Morgan

ACS CAS

(Morgan Algorithm)

Dave Weininger

Daylight

(SMILES) Et al., et al…. 7 / 17

Page 8: How am I supposed to organize a protein database when I can't even organize my address book?

Now about those proteins…

1YIN: ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEI

LMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTL

KSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDA

HRLHAPTS

3OS8:

SNAKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTRHDQ

VHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLN

SGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVP

SYDLLLEMLDAHRLHAPT

• Example: Are these the same or different proteins?

PAM250 alignment score: (gap: -3; extend: -10)

1156 (1156/1260 = 92%)

Ergo, um… Maybe. 8 / 17

Page 9: How am I supposed to organize a protein database when I can't even organize my address book?

Now about those proteins…

• Example: Are these the same or different proteins?

Answer: Same… but what does that even mean?

9 / 17

Page 10: How am I supposed to organize a protein database when I can't even organize my address book?

Why protein identification is hard

• Proteins are large, complex, dynamic

• PDB is database of crystallography experiments, not molecules

• Ligands, co-crystals, waters

• Protein crystallography & NMR is hard

• History, culture…

10 / 17

Page 11: How am I supposed to organize a protein database when I can't even organize my address book?

How about human identification? (Should be easier, may shed light…)

11 / 17

Page 12: How am I supposed to organize a protein database when I can't even organize my address book?

Human identification hard too, apparently…

http://forms.cybersource.com/forms/NAFRDQ12012whitepaperFraudReport2012CYBSwww2012

Credit card fraud Homeland security

12 / 17

Page 13: How am I supposed to organize a protein database when I can't even organize my address book?

(Which brings us to…)

My address book problems

How many Rob Yangs?

13 / 17

Page 14: How am I supposed to organize a protein database when I can't even organize my address book?

(Philosophical tangent:)

Are human entities actually identifiable?

One Harry Morgan or two? How can we know?

14 / 17

Page 15: How am I supposed to organize a protein database when I can't even organize my address book?

(Philosophical tangent:)

Are human entities actually identifiable?

One Harry Morgan or two? How can we know?

Individuality may be contextual.

15 / 17

Page 16: How am I supposed to organize a protein database when I can't even organize my address book?

Could I organize my address book using cheminformatics?

What would the algorithm look like?

16 / 17

Page 17: How am I supposed to organize a protein database when I can't even organize my address book?

Conclusions

• “CINF” (cheminformatics) is awesome.

• But some CINF-awesomeness is not readily transferable to other domains.

• Cannot automate logic if not logical (How many Harry Morgans?).

• Perhaps CINF-awesomeness can be used as an indexing approach for chem-related domains.

17 / 17 “Chester”