DiversifiedfarmingsystemtobeintroducedtoboostrainfedcultivationTIRUPUR, December 13, 2013 ‐ To maximise the farm returns from rainfed areas of the district, a diversified farming system would be implemented in the district for the cultivation of fruits and vegetables with emphasis given on water management. The project, which was conceptualised by the Department of Horticulture with the participation of various stakeholders, would be rolled out on a farmer‐centric approach and encourages the small and marginal farmers to take up livestock and fishery‐based composite farming along with the main crops. This was to insulate the farmer from any possible crop failure that mostly happen in rain fed areas. Subsidy  Subsidy ‐ “We will be extending Rs. 42.05 lakh worth of subsidy for the promotion of rainfed cultivation with the finance to be utilised to subsidise the costs of seedlings, water harvesting and management activities, creation of additional irrigation facilities, levelling and other field activities, and for setting up vermin composite units,” Deputy Director of Horticulture M. Tamilselvan told The Hindu . Under the water harvesting and management component, it has been planned to set up farm ponds in five clusters and also provisions to impound rainwater. Recharging of defunct borewells and setting up of water lifting devices are planned at 10 clusters spread over the district. “To promote the creation of vermin compost units, financial assistance would be given to subsidise the cost of as many as four permanent structures and four High Density Polyethylene woven vermin compost beds,” Mr. Tamilselvan said. He said that the selection of the beneficiaries would be completed shortly from among the small and marginal farmers in the rain fed areas.   

Farmersfindnewwaystopreventanimalsfromenteringfarmlands

UDHAGAMANDALAM, December 13, 2013 ‐ Even as the escalating wild animal menace in various parts of this hilly district has of late started topping the list of complaints in the monthly agriculturists’ grievances redress meetings conducted by the administration, farmers in some areas have started innovating 

to shield their crops from the animals. Adopting the ‘what‐can’t‐be‐cured‐has‐to‐be‐endured’ attitude they have put in place measures to keep the wild animals at bay. Among them is the use of discarded fish nets as fences. They are found to be quite effective though they are said to be hazardous to birds. The practice was steadily becoming popular, said M. Mahendra Pandiyan of Tirunelveli who has been cultivating strawberries and vegetables like carrots in Thambatty, and Mullainagar, near Kotagiri for the last about two decades. He said that since they resembled metal fences they deter animals like wild boar and Indian gaur, which are the main threat to crops, from coming near to the farms. It takes about Rs. 9 lakh to cultivate strawberries on an acre, he said. But a herd of Indian gaurs could cause a loss of about 70 per cent of the crop. Earlier farmers used to stay awake in small shacks put up inside their fields to drive away wild animals. Now the practice is followed only in a few places. The used fish nets are purchased in Gudalur for about Rs. 80 a kg. Farmers use sound emitting devices too to prevent animals from entering their fields. Another way to scare away wild animals is to place burning sticks or pieces of wood dipped in phenyle. Some use a combination of rotten eggs and water to keep the animals away. Animals like gaurs stray into the farms mainly during the dry season, said Mr. Pandiyan. If sufficient water and green vegetation were available in forests, they would not come out, he added. Joint Director of Horticulture N. Mani said that wild animals a lasting solution to end the problems created by wild animals continued to be elusive. P.J. Vasanthan, a conservationist, said that the answer was appropriate farm practices and not confrontation with wild animals.   

GulbargasugarunitshavenoduestofarmersGULBARGA, December 13, 2013 ‐ All six units that owe over Rs. 39 cr. to growers are outside district The total dues to farmers from sugar factories across the State is more than Rs. 39.56 crore. Of this, Rs. 28.24 crore belongs to crushing done in 2012‐13, and the remaining Rs. 11.32 crore is older. Deputy Commissioner N.V. Prasad, who presided over a meeting of the representatives of sugarcane growers and sugar factories here on Thursday, said that as per the latest information available with the government, only six factories out of the total 57 had defaulted in payment of dues to sugarcane growers. All the six sugar factories which had not cleared the dues were in Bidar, Belgaum and Bellary districts. Except for two factories in the cooperative sector, which were yet to settle the dues, the remaining four were in the private sector. While the Bidar Sahakari Sakkare Kharkane topped the list with its total dues of Rs. 16.68 crore (Rs. 14.44 crore of 2012‐13 and Rs. 2.24 crore old), the ISR Sugars at Hospet in Bellary district owed Rs. 9.23 crore (Rs. 15 lakh for 2012‐13 and Rs. 9.08 crore old), followed by 

Ghataprabha Sahakari Sakkare Kharkane at Gokak in Belgaum district with Rs. 9.15 crore for 2012‐13, Bhavani Sugars Ltd. in Bidar district with Rs. 2.06 crore for 2012‐13, Soubhagyalakshmi Sugars in Belgaum district Rs. 1.5 crore for 2012‐13, and Satheesh Sugars Ltd. in Belgaum district with Rs. 94 lakh for 2012‐13. As per the government records, none of the three sugar factories in Gulbarga and one in Yadgir districts had any dues to farmers during 2012‐13 or previous years. The representatives of sugar factories told the meeting that two factories, including NSK Sugars Ltd. at Aland and Ugar Sugars Ltd. at Jewargi had paid Rs. 100 more than the agreed price of Rs. 2,200 a tonne during 2012‐13 and none had defaulted in payment to farmers. Farmers, who pointed out that Renuka Sugar Factory, which had another unit at Belgaum, had paid Rs. 2,500 a tonne to cane suppliers at Belgaum and only Rs. 2,300 a tonne at Havalga in Afzalpur taluk of Gulbarga district, urged the district administration to direct the factory authorities to pay the difference of amount, immediately. The factory authorities told the meeting that as the sugar recovery percentage was more in Belgaum, the price was fixed at Rs. 2,500 a tonne and as it was was low in Gulbarga district, the price fixed here was less. The farmers, however, did not agree and insisted on the payment of the difference. The Deputy Commissioner told the farmers that the district administration had no power to direct factories to make extra payment. 

 �  Only six factories out of the total 57 had defaulted in payment of dues to farmers �  All these factories were in Bidar, Belgaum, and Bellary district 

    

FarmerssoreoverdenialofwaterforrabiELURU, December 13, 2013 ‐ The decision by the district Irrigation Advisory Board (IAB) to enforce a crop holiday in the delta area during the rabi to facilitate the modernisation works triggers protest in the coastal villages in Bhimavaram area in West Godavari district. A large number of farmers from a cluster of six villages staged a rasta roko on the Kattipudi‐Ongole National Highway‐214 at Gollavanitippa in the Bhimavaram‐Lakshmipuram on Thursday seeking water for rabi. People from Gollavanitippa, Tokatippa, Gutlapadu, Gondi, among others, falling under the Losari Main Channel took part in the protest. An extent of 10,000 acres coming under these villages will be denied water as part of the IAB’s decision to enforce crop holiday. The agitation was held under the banner of the Andhra Pradesh Rytu Sangham (APRS). The protesters lamented that the personnel of the Irrigation department were informing the ayacut farmers under the Losari Main Channel through tom‐toming and by way of serving notices that they would not release irrigation water for rabi after the farmers invested heavy amounts on raising nurseries. The people from the same villages staged a demonstration in the city sometime back and claimed to have secured an assurance from Collector Siddharth Jain for a `positive’ action’ on their requests. The agitators contended 

that the ayacut farmers were not consulted before the decision of the IAB in favour of a crop holiday. APRS district committee secretary B. Balaram, who led the agitation, said the Irrigation Department personnel could go ahead with the modernisation works under the Losari Main Channel in the lower reaches where there was no crop during the rabi for a period of three months and resume a similar exercise in the Gollapalem area after the harvest of the rabi crop upstream. The peasant leader informed that a delegation from the APRS met Social Welfare Minister Pitani Satyanarayana and Tourism Minister Vatti Vasantakumar from the district recently, pressing the demand release of water for rabi. The Ministers promised to depute the Collector to the areas opposed to the crop holiday on a fact‐finding mission, he said. Mr. Balaram informed that the APRS has decided to take up an agitation against what he called the unilateral decision of the IAB with the involvement of farmers all over the delta region shortly. 

 �  Farmers from six villages stage rasta roko on NH‐214 �  Say IAB had not consulted them before declaring crop holiday 

   

Phailin‐hitfarmersworriedoverprocurementofpaddyBERHAMPUR, December 13, 2013 ‐ Peasants devastated by Phailin Cyclone and subsequent floods in Ganjam district are now worried over procurement of paddy which had survived the natural calamity. Through the Ganjam district Collector, the CPI (M) and the peasants’ organisation Ganjam Krushak Sabha have handed over a memorandum to Odisha Chief Minister Naveen Patnaik regarding problems of peasants of Ganjam district as well as procurement of salvaged paddy. They pointed out that the economic backbone of farmers in Ganjam district was completely damaged due to the recent natural calamities. “It will take several years for these peasants to get back to their past economic status,” said secretary of Ganjam Krushak Sabha, P. Harikrushna Reddy. But paddy crop in some pockets of the district had survived the cyclone and flood. Without proper active official mechanism to procure this paddy, the farmers are now worried whether they will get proper price for the remaining harvest or not, said State secretariat member of the CPI (M) Ali Kishore Patnaik. Mr. Patnaik added that the standard of paddy harvested from the fields that have sustained the cyclone and flood may be low. So, the CPI (M) and the Ganjam Krushak Sabha have demanded the State government to press upon the Centre so that the norms of the Fare Average Quality (FAQ) standards during paddy procurement could be relaxed during paddy procurement in Ganjam district. They felt strict imposition of FAQ norms during paddy procurement in Phailin‐devastated Ganjam district would only add to the woes of farmers as the salvaged paddy would be of lower quality than the FAQ standards. “This would only lead to distress sale of this salvaged paddy to unscrupulous traders at an extremely low price,” said peasants’ leader Kailash Sadangi. They also said that till now no mandi for paddy procurement had been opened up in the 

district which may promote distress sale of paddy by farmers. According to them mandis for paddy procurement should be opened in all blocks of the district with FAQ relaxation during procurement. Other demands They also came up with several other demands related to peasants of Ganjam district in their memorandum. These demands included compensation worth Rs. 25,000 per acre for crop loss in irrigated land and Rs. 15,000 for each acre of non‐irrigated land in Ganjam district. There was also demand for assessment of loss for insurance cover as per this year’s cropping pattern instead of taking average data of past three years.   

AlphaMatricconductscampaignonfarmsafety

CHENNAI, December 13, 2013 ‐ Students of Std V & VI of Alpha Matriculation Hr.Sec.School conducted an awareness campaign about agricultural safety. The students also put up a skit and distributed pamphlets and explained the same to the public. Pictures of the methods, tools, machines, fertilizers and pesticides used by the farmers were displayed. Through them they brought the difference between the old and the 

modern method of agriculture followed by the farmers. They also stressed the difficulties faced by the farmers in different countries.   

Semencollectionstoppedatbullfarm40 of 123 high quality bulls down with FMDThe ‘ban’ will be in force for 6 months  PALAKKAD, December 13, 2013 ‐ Collection of semen has been stopped at the Dhoni bull mother farm as 40 of the 123 high quality bulls there are down with foot‐and‐mouth disease (FMD). The ‘ban’ will be in force for six months impacting artificial insemination not only in Kerala but also in the other States which purchase frozen semen from the farm under the Kerala Livestock Development Board 

(KLDB). Manager of the Dhoni farm Balu Bhaskar told The Hindu here on Thursday that the disease‐hit bulls had been kept in isolation to avoid the spread of the virus. The disease was noticed on November 25. In 2003, there was an incidence of the disease and some bulls were affected but it was not as severe as now. Dr. Bhaskar said Palakkad was the worst hit by the disease this year. He said though vaccinated, the bulls had contracted the disease. Vaccination would not ensure total prevention as there could be changes in the virus that made the vaccination ineffective. He said the Dhoni farm had been recognised as one of the major centres of semen collection and worked under the strict standards of the Union Ministry of Agriculture. The frozen semen from the farm was being used by the Animal Husbandry Department across the State. It was also sold in Punjab, Orissa, Uttar Pradesh, Tamil Nadu, Puducherry, etc. He said the semen collected one month before the detection of the disease would be destroyed as a standard procedure. “The semen collection will resume in three months after the bulls are cured of the disease. The semen collection in Dhoni will be affected for six months,” he said. Dr. Bhaskar claimed the ban would not have much of an impact in the State as stocks of frozen semen were available. Besides, there were two other centres producing semen under the KLDB at Mattupetty and Kulathupuzha. On detecting the disease, follow‐up treatment to avoid secondary issues such as temperature and lesions had been started at the farm. “The disease is curable and the bulls can be brought back to good health. There is no need for culling of the affected bulls. It is not stipulated in the standards set by the Union Ministry of Agriculture. Steps have been taken to prevent the disease from spreading at the farm,” he said. 

 �  40 of 123 high quality bulls down with FMD �  The ‘ban’ will be in force for 6 months 

   

TNCSCtopurchasepaddywith20p.c.moistureTHANJAVUR, December 13, 2013 ‐ Heavy rain lashed Thanjavur and Tiruvarur districts on Thursday. In Thanjavur, Orathanadu, Vettikadu, Pattukottai, and Vallam experienced heavy showers while in Tiruvarur, Thirthuraipoondi, Needamangalam, Kodavasal, and Koradachery registered heavy rain. Agriculture department officials said that the rain augurs well for samba and thaladi crops. Keeping in view the rain in delta districts, Tamil Nadu Civil Supplies Corporation (TNCSC) has decided to purchase paddy with moisture content up to 20 per cent. A release issued here by N. Subbaiyan, Collector, said that paddy with moisture content up to 20 per cent would be purchased from December 11. 

There are 90 direct purchase centres in the district for this kharif season 2013‐14. Previously, paddy with moisture content up to 17 per cent was purchased. — Special Correspondent 90 DPCs set up in Thanjavur district for kharif   

CabinetnodforCauverywatertonewlayoutsBANGALORE, December 13, 2013 ‐ To meet the increasing demand for drinking water for Bangalore, the State Cabinet has given the green signal to the Bangalore Water Supply and Sewerage Board (BWSSB) to draw an additional 10 tmcft of Cauvery water to newly developed layouts in the city. Addressing presspersons here on Thursday, Minister for Law and Parliamentary Affairs T.B. Jayachandra said the Cabinet had decided to place the proposal before the Supreme Court. The Supreme Court is likely to hear the Cauvery water dispute on January 15, 2014. Currently, the BWSSB is drawing 17.64 tmcft water from the Cauvery. The government has decided to hold a meeting with its legal counsel Fali S. Nariman on December 16 in New Delhi to defend the State’s interests with regard to sharing of the Cauvery waters. He said the government had been exploring various options to meet the drinking water requirements of the city. Efforts were being made to bring water from Yettinahole project, Linganamakki reservoir and two tributaries of the Cauvery river in Kodagu district.   

WaterlevelsMettur ‐ The water level in the Mettur dam stood at 82.07 feet on Thursday against its full reservoir level of 120 feet. The inflow was 1,570 cusecs and the discharge 9,001 cusecs.  The water level in Papanasam dam on Thursday stood at 99.65 feet (the maximum level is 143 feet). The dam had an inflow of 386.94 cusecs and 1,003.80 cusecs were discharged from the dam.  The level in Manimuthar dam stood at 75.18 feet (118 feet), with an inflow of 129 cusecs and a discharge of 35 cusecs.  Kanyakumari The water level stood at 26.90 feet in Pechipparai dam, 60 feet in Perunchani, 12.89 feet in Chittar I, 12.98 feet in Chittar II, 4.60 feet in Poigai and 52.58 feet in Mamabazathuraiyaru.    

Weather

 INSAT PICTURE AT 11‐30 hrs. Observations recorded at 8‐30 a.m. on December 12. ANDHRA PRADESH Anantapur  33  17  0  51 Arogyavaram  30  20  0  182 Bapatla  31  21  0  583 Calingapatnam  28  21  0  990 Gannavaram  33  22  0  524 Hanamkonda  31  16  0  296 Hyderabad AP  31  14  0  253 Kakinada  30  24  0  712 Khammam  32  18  0  100 Kavali  33  20  0  557 Kurnool  33  17  0  99 Mahabubnagar  27  17  0  165 Machilipatnam  32  23  0  499 Narasapur  31  23  0  674 Nellore  33  23  0  439 Nizamabad  31  12  0  120 Ongole  34  22  0  535 Ramagundam  30  11  0  201 Tirupathi AP  33  24  0  369 Tuni  33  23  0  524 Vizag AP  31  23  0  716 Vizag  31  23  0  695 KARNATAKA Agumbe  30  8  0  626 Bangalore AP  28  18  0  198 Bangalore  28  17  0  244 

Bagalkote  30  11  0  — Belgaum AP  29  12  0  63 Bellary  32  16  0  63 Bijapur  29  7  0  113 Chitradurga  30  12  0  55 Chickmagalur  27  14  0  70 Gadag  29  14  0  88 Gulbarga  32  16  0  38 Hassan  29  8  0  116 Honavar  35  18  0  266 Karwar  36  17  0  167 Madikeri  26  9  0  205 Mangalore AP  34  17  0  344 Mysore  30  14  0  183 Mandya  30  15  0  185 Panambur  33  19  0  248 Raichur  31  12  0  103 Shirali  34  18  0  428 KERALA Alappuzha  31  24  0  412 Kannur  32  20  0  336 Kochi AP  32  22  0  605 Kottayam  33  22  0  513 Kozhikode  32  21  0  311 Punalur  33  20  0  705 Thiruvanantha ‐puram AP  32  24  0  476 Thiruvanantha ‐puram City  33  23  0  499 Vellanikkara  32  23  0  457 TAMIL NADU Adiramapattinam  34  25  tr 219 Chennai  31  25  3  426 Chennai AP  31  24  3  485 Coimbatore AP  33  20  0  144 Coonoor  22  12  0  551 Cuddalore  33  23  4  361 Dharmapuri  32  18  0  263 Kanyakumari  35  23  0  285 Karaikal  32  22  7  580 Kodaikanal  18  9  0  245 Madurai AP  34  24  0  220 Nagapattinam  32  23  9  563 Palayamkottai  33  24  0  317 Pamban  32  26  0  520 Puducherry  34  23  5  357 Salem  33  21  0  213 

Thanjavur  32  25  0  229 Tiruchi AP  33  23  tr 340 Tiruttani  33  24  1  320 Tondi  30  25  0  322 Tuticorin  31  24  0  297 Ooty  20  8  0  259 Valparai  27  11  0  368 Vellore  34  23  tr 103 LAKSHADWEEP Amini Divi  33  24  0  203 Minicoy  32  26  0  174 OTHER STATIONS Kolkata (Alipore)  28  15  0  523 Mumbai  33  22  0  73 New Delhi  25  12  0  73 The columns show maximum and minimum temperature in Celsius, rainfall during last 24 hours (trace) and total rainfall in mm since October 01, 2013. RAIN LIKELY IN COASTAL A.P. CHENNAI: Isolated rainfall occurred over Tamil Nadu, coastal Andhra Pradesh and Rayalaseema.  Dry weather prevailed over Telangana, Kerala, Lakshadweep and Karnataka. The chief amounts of rainfall recorded in centimetres are: Moderate cold wave conditions prevailed over parts of north interior Karnataka. FORECAST VALID UNTIL SATURDAY MORNING : Rain or thundershowers would occur at many places over Tamil Nadu and Puducherry and at a few places over south interior Karnataka, Rayalaseema  and south coastal Andhra Pradesh.  Isolated rain or thundershower may occur over  north  coastal Andhra Pradesh and Kerala.  Mainly dry weather will prevail over Telangana,  Lakshadweep, coastal and north interior Karnataka. HEAVY RAINFALL WARNING: Isolated heavy rain would occur over coastal Tamil Nadu and Puducherry during next 24 hours.         

 

WeatherChennai ‐ INDIA 

Today's Weather 

    Partly Cloudy 

Friday, Dec 13  Max    Min 29o  | 23o 

  Rain: 0  Sunrise: 06:21   Humidity: 94  Sunset: 05:43   Wind: normal  Barometer: 1011  

 

 Tomorrow's Forecast 

 Partly Cloudy 

Saturday, Dec 14 Max    Min 29o  | 22o 

   

Extended Forecast for a week     

Sunday Dec 15   

 

Monday Dec 16   

 

Tuesday Dec 17   

 

Wednesday Dec 18   

 

Thursday Dec 19   

              

                                 30o | 23o  26o | 25o  26o | 23o  25o | 23o  25o | 23o   Cloudy  Cloudy      Overcast    Overcast  Overcast      

  

States'agriculturallawsfuelfoodinflation:RajanKOLKATA: Reserve Bank of India (RBI) governor Raghuram Rajan on Thursday made it clear that he is not comfortable with high consumer price inflation and the low level of growth. He also blamed the Agricultural Produce Marketing Control (APMC) Acts of different states for high food inflation.  Speaking after the board meeting of the central bank, Rajan said, "The growth number will be weaker than what we would like and the inflation will be higher than what we have expected."  He, however, said RBI was yet to get all relevant data to reach a conclusion. "We have the 

CPI data ... The wholesale price index ( WPI) numbers are yet to come. We have to take all the data into account," Rajan said.  With the Consumer Price Index (CPI) at 11.25%, Rajan said policymaking was always difficult with high inflation and low growth. "It is easy to take care of high inflation with high growth or low inflation with low growth. But it is difficult when inflation is high and growth rate is low. We have to make some trade‐offs," he said.  According to Rajan, both fiscal and monetary policies needed to tackle this situation. "The finance minister has already taken some fiscal measures like decontrolling of diesel price. In the short term, there might be inflation but in the long run, that will be good for the economy," he said.  The RBI governor also said that some of the features of the APMC Acts of different states were resulting in a high‐cost distribution system for vegetables. The RBI board discussed the issue on Thursday. "We shall look at the details of APMC Act(s) and could accommodate the best of these for a model one," he said.  The centre had come out with a model APMC Act to stimulate organized retail and contract farming in 2010 but a lot of states, including West Bengal, did not accept the law, which is in the concurrent list.  On new banking licences, Rajan indicated that the January deadline for identifying new players may not be met. "It could be a few weeks here and there," he said. Rajan also said that RBI had not yet taken the call on the numbers of the licences to be issued.  

 

DistrictcollectortomeetfarmerstodayNASHIK: District collector Vilas Patil will conduct a meeting with farmers at Dindori on Friday to negotiate deals for land acquisition for industries.  The Maharashtra Industrial Development Corporation (MIDC) has notified 361 hectares land at Talegaon and Akrale villages in Dindori tehsil. The collector will hold meeting with the concerned farmers for acquisition of their land.  Speaking to TOI, an official from the MIDC said, "The land measurement is yet to begin at Talegaon and Akrale villages, owned by around 300 farmers. Friday's meeting will be held to convince the farmers to let go of their land."  Last week, the collector had held meetings with the farmers for the acquisition of the land at three locations in the district ‐ Gonde, Yeola and Sayane in Malegaon tehsil.  The MIDC has marked 128 hectares land at Gonde village near Igatpuri and 494 hectares at Sayane near Malegaon. Besides, 109 hectares has been earmarked at Yeola for the proposed textile park. Last Saturday, Patil had finalized rates for acquisition for the 

proposed textile park after getting consent of the concerned farmers.  The MIDC has earmarked around 5,000 hectares of land at various locations for the industries, which are in different stages of acquisition. The meetings of the collector with the farmers from Sayane, Gonde and Yeola were part of speeding up the land acquisition process.   

‘Usegroundwaterfromrealtysitesforagriculture’NOIDA: An expert committee set up to consider various aspects on groundwater extraction beyond its natural levels in Noida has recommended that it should be diverted for agriculture or artificial recharge of water tables. The report, recommending methods for dewatering and control of groundwater at construction sites, was presented by Noida Authority to National Green Tribunal on Thursday.  The five‐member committee that compiled the report has also highlighted the need to form a special panel at Noida Authority to evaluate and approve 'dewatering management plans' before implementation of projects. The committee prepared its report—a copy of which is with TOI — after conducting surveys in Noida. Apart from officials of Noida Authority, the committee also comprised a former member each from Central Ground Water Board and UP Groundwater Department.  As part of dewatering plans, the committee has recommended geo‐technical investigations and hydrological analysis of project sites prior to commencement of construction to determine soil status and characteristics and exact positions of groundwater level. "Dewatering can be done after purification to designated discharge points, which may be sewers, streams, infiltration or recharge ponds or injection well recharge system," the expert committee has recommended.  The committee compiled the report after the tribunal issued directions to the Authority for preparing a detailed plan highlighting methods for judicious use of groundwater and its recharge in Noida. The tribunal had issued the directions while hearing a case in which it was alleged that indiscriminate extraction of groundwater in Noida is fast depleting its levels, besides threatening shortage in the long term.    

DholiagriculturalcollegeclosedsinedieMUZAFFARPUR: Tirhut College of Agriculture, Dholi, about 25 km from here, closed sine die on Thursday and all its hostels were vacated by order of its principal, K N Pathak.  Pathak said the college was closed due to tension between students and the people of adjoining villages following a clash between the two sides on December 9. The principal informed that the college has no boundary wall from some sides and, as such, villagers have got an easy access to the campus to reach local markets or bus stand ever since the college was opened 50 years ago. The principal clarified that only teaching work has been suspended for an indefinite period, but research work was going on as usual. Students would be called back as soon as the situation improves.  A sixth year student of the college, Damrudhar said the college administration announced sine die closure when the students staged indefinite dharna on the campus to seek protection from villagers who not only assaulted half‐a‐dozen students on the campus but also misbehaved with the girl students on December 9.  Following the eviction of students from hostels, all students including 100 girls and 150 boys, were safely transported to Samastipur railwaystation by college buses under the guidance of some senior teachers in a Bolero jeep on Thursday. Students, particularly girls, had to face serious problems of accommodation in trains to reach their native places. Students informed that the next examination, scheduled from December 18, have been postponed for an indefinite period.  The villagers have lodged an FIR with Sakra police in connection with the last clash alleging that the students of the agriculture college are going the way of MIT, clashing with the villagers very frequently over trifle issues. No FIR had been lodged with the police on behalf of students so far because the principal of the college turned down the request of the students to lodge an FIR against the villagers. On Thursday, the students faxed a complaint letter to Muzaffarpur SSP and DM against the dangers from villagers due to open boundary walls.      

  

Post‐Verkahike,dairyfarmersincreasemilkpricesbyRs2akgLudhiana, Wed Dec 11 2013 ‐ A day after Milkfed, the state co‐operative, hiked prices of milk being sold under Verka brand by Rs 2 a litre, the Ludhiana Dairy Farmers' Association on Tuesday announced a hike in milk prices by Rs 2 a kg. Milkfed's reasoning for the price hike — the fourth in a year — is: they have started giving more prices to the farmers by Rs 2 a litre from whom they purchase milk and in return the same has been passed onto the consumer. However, the local dairy association's reasoning for the hike is that they are getting fodder at much higher prices from the market and hence they have no other option but to hike the prices. Straw which was priced at Rs 250 a quintal last year is now being sold at Rs 500 a quintal while green fodder is now priced at Rs 250 a quintal against Rs 100 a quintal last year, according to Narinder Sharma, president of the Ludhiana Dairy Farmers' Association. "In the given circumstances, we have no choice but to hike the prices," he said. While Verka milk prices will now be Rs 38 a kg against Rs 36 a kg for 4% fat, the loose milk being sold by Ludhiana dairy farmers in various areas is already in the range of Rs 40‐44 a litre. Hence, these prices would now be in the range of Rs 42‐ 46 a litre, said D S Oberoi. He added that straw being used as food for cattle was being used as a source of fuel by dyeing factories while cardboard units were making cardboard from straw, so cattle were getting feed at a much higher price.  

ExpertsnowScepticalofStepstoPreventFMDBy Saritha S Balan | ENS ‐ THIRUVANANTHAPURAM Published: 13th December 2013 09:03 AM  The situation in Kerala following the outbreak of Foot‐and‐ Mouth Disease (FMD), which led to the death of nearly 1,500 bovines, continues to be grave, as experts are of the view that there are no preventive measures that work. 

The situation in the State following the outbreak of Foot‐and‐ Mouth Disease (FMD), which led to the death of nearly 1,500 bovines, continues to be grave, as experts are of the view that there are no preventive measures that work. “There are no preventive measures as it is an air borne disease. It is spread by a micro virus. Therefore, the immunity through vaccination may not be proper. It has also been found that 

the immunity attained through high quality virus has the life of only four months. But vaccination is normally given once in every six months,” said Jacob Alexander, veterinarian of the Thiruvananthapuram Zoo. As many as 15,000 animals have been infected after the outbreak which began in August. FMD has proved fatal for 1500 animals, as per the details available from the disease control wing of the animal husbandry department. The department had been on its toes after the outbreak, as controlling it continues to be a Herculean task. The disease hit the whole of South India and transmitted to the state from animals brought from Karnataka and Tamil Nadu via border check posts. Wayanad, Idukki and Palakkad were the districts which were initially affected. The disease soon spread to other parts of the state. At Devikulam in Idukki two bisons were fatally affected by the disease. Kottayam was the last district to be affected by it and situation in Palakkad and Kottayam still continue to be serious. The animal husbandry department has been carrying out ‘ring vaccination’ ‐ which brings an entire panchayat under vaccination so that the disease wont spread outside it ‐ for better results. The department has issued strict guidelines for slaughter houses, which are functioning in highly unhygienic conditions. “Slaughter houses are fast spreading the disease. The animals there have been identified and vaccinated,” said J Chandramohan, Goraksha project coordinator (animal disease control). Vaccination was also undertaken in routes were cattle are transported.    

  

Prolongedmonsoonhitscocoaproduction

Mangalore, Dec. 12:  Continuous rainfall during the South‐West Monsoon has affected cocoa production this year. The South‐West Monsoon runs from June 1 to September 31. Suresh Bhandary, Managing Director of the Central Arecanut and Cocoa Marketing and Processing Cooperative (Campco) Ltd, toldBusiness Line that continuous rainfall had affected the flowering in cocoa plantations. In some parts of the growing 

regions such as Karnataka and Kerala, the rainfall continued till September‐end, he said. This affected the cocoa production during November‐December. Cocoa harvesting takes place two times in a year. The first crop is harvested during March‐April and the second during November‐December. Bhandary said that the total cocoa production was about 12,000 tonnes a year. Nearly 4,000‐5,000 tonnes of cocoa are from the November‐December crop. Campco, a manufacturer of chocolates in the cooperative sector, gets around 1,000 tonnes of cocoa from the domestic market during November‐December. However, hardly 10 per cent of the crop was available this year during the period, he said. With the crop being affected severely, growers are expecting early arrival of the first crop, he said. Usually, growers get the first crop during March‐April. But, this year they are expecting the harvest in February, he said. PRICE The shortage of cocoa in the market has helped growers get good price. Bhandary said that Campco is offering Rs 190‐200 a kg for dry cocoa beans now. It was around Rs 175 a kg during the same time last year, he said.   

Vegoilsimportsurges35%inNovemberaspricesdrop

Mumbai, Dec. 12:  Vegetable oil imports increased 35 per cent in November to 9,44,309 tonnes against 7,00,371 tonnes in the same period a year ago, according to data released by the Solvent Extractors’ Association. Imports surged as sunflower oil prices dipped by $30 a tonne. Also, the price difference between refined and crude palmolein dropped to less than $10 a tonne, making refined oil imports more 

attractive Besides, traders expect the Government to mark up import duty on vegetable oil imports. Of the total imports, edible oil accounted for 9,27,111 tonnes and non‐edible oils 17,198 tonnes. Import of refined oil was up by 172 per cent at 2,08,076 tonnes against 76,519 tonnes in November last year. Crude oil shipments were also rose 20 per cent to 7,19,035 tonnes (5,99,715 tonne). Palm oil import increased to 7,74,207 tonnes from 6,14,574 tonnes while that of soft oils moved up to 1,52,904 tonnes (61,660 tonnes). Refined and crude palm oil prices moved up substantially to $880 and $881 against $835 and $830 registered in October. Crude sunflower oil fell to $995 ($999 in October). 

On an average, rupee in November depreciated to 62.52 against dollar from 61.61‐level registered in October. Non‐edible oil imports were down 29 per cent to 17,198 tonnes against 24,137 tonnes recorded in the same period last year. Palm fatty acid distillate and crude palm kernel oil were the major non‐edible oils imported. As of December 1, edible oil stock available at various ports was estimated at 5,90,000 tonnes, including 320,000 tonnes of crude palm oil, 1,30,000 tonnes of refined palmolein, 35,000 tonnes of de‐gummed soyabeanoil, 1,00,000 tonnes of crude sunflower oil and 8,000 tonnes of canola/rapeseed oil. Another 8,80,000 tonnes of imports are in the pipeline. Inventories Total stock, both at ports and in pipelines, has increased by 70,000 tonnes to 14,70,000 tonnes.   

GlobalbuyersbidforIndianwheatathigherthanfloorpriceThailand‐based Phoenix offers highest price among 22 bidders 

 Gaining steam: The trend indicates the growing interest in Indian wheat as supplies from Russia and Ukraine are seen dwindling with the onset of winter. New Delhi, Dec. 12:  The three wheat tenders floated by State trading entities PEC Ltd and MMTC have evoked good response. The tenders, for exports totalling of 2.1 lakh tonnes, were opened 

on Thursday. Almost all the 22 bids were priced above the floor rate of $260 a tonne. The buyers included global players Phoenix, Emmsons and Cargill. Thailand‐based Phoenix Commodities put in the highest bid price of $287.10 a tonne for the 35,000 tonnes of wheat offered by PEC Ltd from Vizag port. PEC received six bids for wheat, offered from Food Corporation of India’s godowns in Vizag port. The bid prices ranged from $272.35 to $287.10 a tonne. Emmsons International made the highest bid at $285.41 for the 1.2 lakh tonnes wheat offered by PEC from Kandla port. For this tender, PEC received 10 bids ranging from $265‐285.41 a tonne. Phoenix also emerged as the highest bidder for the 55,000 tonnes of wheat offered by MMTC from Pipavav port. Phoenix quoted a price of $283.1 a tonne. MMTC received six bids ranging from $265.75 to $283.1 a tonne for its tender. Growing interest 

The rise in the number of bids from global buyers indicates the growing interest in Indian wheat in the current market scenario as supplies from Russia and Ukraine are seen dwindling with the onset of winter. Wheat offered through these tenders have to be shipped between December 22 and January 25. Tenders for export of another 4.4 lakh tonnes of wheat will be opened on December 16 and 23. State entities PEC, MMTC and STC have floated tenders for 6.5 lakh tonnes of wheat for export this month as pressure builds up on the Government to create storage space for the new crop. On Wednesday, Agriculture Minister Sharad Pawar said the country was heading for a record high production of foodgrain this year. In the earlier tender, opened on November 18, buyers had quoted prices up to 10 per cent higher than the floor price of $260 a tonne, largely in line with the prevailing global prices. Trimming surplus The Government has decided to ship out about two million tonnes of wheat to cut surplus stocks and create space for other cereals, such as rice, for which paddy procurement is currently on in Punjab and Haryana. On December 1, India’s wheat stocks stood at 31 million tonnes, three times the mandated quantity for the October‐December quarter. The State entities had exported 4.2 million tonnes of wheat, valued at $1.4 billion, in fiscal 2012‐13. The average price fetched by Indian wheat last fiscal was $311.38 a tonne.   

Globalblackteaoutputup9.18%Coonoor, Dec. 12:  Global black tea production has increased by 9.18 per cent so far this calendar over last year, according to an analysis of the latest data available with Tea Board and traders’ bodies. “According to our compilation, global black tea production rose to 1,860.32 million kg (mkg) from 1,703.85 mkg,” Rajesh Gupta, publisher of ‘Global Tea Digest 2013’ told Business Line. This increase of 156.47 mkg marks a growth of 9.18 per cent. All countries except Uganda have posted an increase in production over last year. Even Uganda has posted only a marginal shortfall of 0.73 mkg till October to produce 45 mkg. India tops the black tea table with a massive output of 1,028.68 mkg till October (up 76.23 mkg over last year) despite South India posting a fall of 0.16 mkg to dip to 195.77 mkg as North India’s production has risen by a whopping 76.39 mkg to produce 823.91 mkg. The increase of 76.23 mkg posted by India was the highest gain achieved by any country. Kenya posted the second highest increase of 66.33 mkg to produce 354.52 mkg. Sri Lanka came third producing 278.25 mkg (up 8.30 mkg). Bangladesh, Indonesia, Malawi and Tanzania follow with higher output.    

NendranbananapricesseenrulingstableÇoimbatore, Dec. 12:  The price of the Nendran banana is expected to remain stable, between Rs 38 and Rs 40 a kg over the next two months, say Tamil Nadu Agricultural University experts. After analysing the price movement of the variety over the past decade, the Back Office of Agro Marketing Intelligence and Business Promotion Centre (AMI &BPC) functioning at the varsity said that the price might not increase significantly during the festival season in January. “It is hovering around Rs 36‐38 a kg in Coimbatore at present. This could go up by Re 1‐Rs 2 to Rs 38‐40/kg in January and stabilise around that level till end February,” a source at the centre said. This banana variety is cultivated in Tamil Nadu and quite popular among consumers in Kerala. It is grown mainly in Coimbatore, Erode, Tiruchi and Kanyakumari districts. It is planted during April‐May, besides October‐November for the harvest to coincide with the Onam festival. The area under banana in Tamil Nadu is 1.25 lakh hectares and the State tops in productivity at 65.8 tonnes/hectare. The acreage under Nendran is, however, not available.   

SpotrubbermayrecovermoderatelyKottayam, Dec.12:  Spot rubber closed firm on Thursday. According to traders, the market is now moving up on the optimism that the Government will take some measures to save producers. International prices are also ruling above domestic rates and the scenario is favourable for a moderate recovery in the market. Sheet rubber improved to Rs 152 (Rs 151.50) a kg, as quoted by the traders. The grade firmed up to Rs 151.50 (Rs 151) and Rs 148.50 (Rs 148) respectively, according to the Rubber Board and dealers. The trend was mixed. December futures recovered marginally to Rs 153.50 (Rs 152.50), January to Rs 155.49 (Rs 154.46), February to Rs 157.69 (Rs 156.85) and April to Rs 164.75 (Rs 162.50) while the March futures remained inactive on the National Multi Commodity Exchange. RSS 3 (spot) bounced back to Rs 159.41 (Rs 157.47) at Bangkok. December futures closed at ¥ 279.4 (Rs 167.80) on the Tokyo Commodity Exchange. Spot rubber rates (Rs/kg): RSS‐4: 152 (151.50); RSS‐5: 143 (142.50); Ungraded: 138.50 (138.50); ISNR 20: 144 (143.50) and Latex 60%: 109 (109).    

Short‐coveringboostsjeerafuturesRajkot, Dec. 12:  Jeera futures shot up on Thursday on the back of short covering by traders. On the spot, the spice remained almost stable. According to market analysts, jeera futures increased, after hitting a contract low early on Thursday, on short‐covering, but the ongoing sowing and hopes of increased output weighed on the market. On the NCDEX, jeera December contracts gained Rs 85 at Rs 12,730 a quintalwith an open interest of 2,748 lots. NCDEX March contracts increased by Rs 

67.50 to Rs 12,732.50 with an open interest of 6,777 lots. At Unjha Mandi in Gujarat, jeera declined by Rs 5 to Rs 2,025‐2,726 for a maund of 20 kg. In Unjha mandi 5,000 bags arrived and the offtake was 4,500‐4,800 bags. At Rajkot, jeera was traded atRs 2,150‐2,335. Angel Commodities said in a research note that jeera March futures may trade mixed to positive supported by overseas demand. However, no major gains are seen as higher sowing this season may keep prices under check. Spice Board data pointed out that export of jeera between April and September was 67,500 tonnes against 35,018 tonnes during the same period last year.   

HugecarryoverstocksdragmustardIndore, Dec. 12:  Mustard oil prices ruled flat as buying support declined for soyabean and its oil. In Indore, mustard oil ruled steady at Rs 682, while it was Rs 675 at Neemuch and Rs 685 in Morena respectively. Besides slack demand in soyabean and its oil, the sluggish trend in mustard oil is attributed to reports of higher sowing this year, prompting stockists and traders to go for stock clearances, said Kailash Agrawal, a local mustard oil trader . Given the favourable weather conditions, a rise in sowing area and adequate carryover stocks, the outlook for mustard 

oil appears to be bearish. However, it may witness a rise in demand during winter, said Vinod Choudhary, an Indore‐based broker. Plant deliveries of mustard oil for Jaipur line in the past one week have also declined by Rs 70‐80 on slack demand from the crushers with prices on Thursday declining to Rs 3,740‐45 a quintal (Rs 3,815‐20 a quintal last week). Similarly, mustard seeds prices in the physical market have also declined by Rs 200 in the past one week with prices on Thursday being quoted at Rs 4,700‐4,900 (Rs 4,900‐5,100). Similarly, raida has also declined to Rs 3,200 (down Rs 150 from last week). In futures, however, mustard seeds traded higher on improved buying with December and January contracts on the NCDEX closing at Rs 3,670 (up Rs 47) and Rs 3,745 (up Rs 28) respectively. Arrival of mustard seeds across the mandis in country on Thursday declined to 80,000 bags (90,000 bags last week).   

CyclonesproveTN’sundoing;raindeficitmountsto32%Thiruvananthapuram, Dec. 12:  Three cyclones in as many weeks have failed to guarantee adequate rainfall for Tamil Nadu as a busy North‐East monsoon prepares to sign off. In fact, these away‐going cyclones are now believed to be squarely responsible for leaving the State dry in what was projected to be a bountiful season to start with. RAIN BELT What they managed to do was take away the heavy rain belt along and pour it down elsewhere – Andhra Pradesh, Odisha and even parts of central India. This has left Tamil Nadu high and dry with a 32 per cent deficit thus far during the season (until Wednesday). There is no hope of making up this deficit by any significant level since the rain belt is now descending to the southern hemisphere in line with the movement of the Sun. The maritime continent (Indonesia, etc) and, to a limited extent, Sri Lanka, will be the major beneficiaries, an outlook from the Climate Prediction Centre of the US National Weather Services said. The European Centre for Medium‐Range Weather Forecasts is of the view that a weather‐friendly trough will start growing in the Arabian Sea during this period. TROUGH GROWING It could bring in some wet weather along the West Coast, which has already received normal rainfall during the season compared with the deficit in Tamil Nadu. This is likely the handiwork of erstwhile cyclone Madi, a ‘pulse’ from which is headed into the Arabian Sea off the Kerala coast. The resultant rain wave is forecast to be active over south‐east Tamil Nadu and adjoining interior and Kerala through the weekend. Sri Lanka too is seen benefiting from the wave. From Tuesday (December 17), the wave is forecast to quit the mainland entirely and take rains to Sri Lanka and further south to equatorial Indian Ocean. SYSTEM RECALIBRATED 

Meanwhile, India Met Department recalibrated erstwhile cyclone Madi to a depression over south‐west Bay of Bengal, lying 90 km east off Nagapattinam on Thursday afternoon. Earlier, the Met had said that the system had weakened into a well‐marked low‐pressure area over the waters and was weakening further into a low‐pressure area. The depression would move west‐southwestwards and cross coast between Vedaranyam and Pamban by Thursday midnight or Friday morning only. Global models had indicated this denouement as far as three to four days back, which was reported in these columns.   

UptrendcontinuesinpepperKochi, Dec. 12:  The uptrend in pepper prices continued on Thursday following good demand amid tight supplies. No trading on the spot was reported, market sources told Business Line. They said that growing areas are experiencing a cloudy weather and if it continued it might delay the drying of recently‐harvested pepper. Upcountry demand continued to surge, they said. There were more sellers of ungarbled pepper at Rs 525 a kg but buyers have withdrawn for the time being. Meanwhile, there was no trading in December contracts on the National Multi Commodity Exchange. On the regional exchange, IPSTA, also no trading was reported. January and 

February contracts on the NMCE increased by Rs 250 and Rs 238 respectively to Rs 54,200 and Rs 54,240 a quintal. Total turnover decreased to 10 tonnes, while the net open position increased to 15 tonnes. On the IPSTA, there were buyers for December at Rs 53,500 and January at Rs 54,000 but there were no sellers. Spot prices rose by Rs 200 to a new high of Rs 51,200 (ungarbled) and Rs 53,200 (garbled) a quintal. Export prices moved up further to $9,225 (c&f) for the Europe and $9,425 a tonne (c&f) for the US, they said. All the other origins were also reportedly firm. Overseas trend Prices quoted were Brazil ASTA at $8,200 (f.o.b) and Vietnam ASTA at $8,600‐$8,650 c&f New York, but sellers were limited.  

 

Riceseenflatonamplestocks,steadydemand

Karnal, Dec. 12:  The rice market is likely to rule without much change on account of steady demand and ample stocks in the coming days, said trade experts. With not much trading taking place in the market, prices of almost all the varieties remained unchanged on Thursday. Amit Chandna, Proprietor of Hanuman Rice Trading Company, told Business Line that the market is moving at snail’s pace. Trading has been lukewarm since the beginning of this week. According to trade experts, market sentiments are low and any major alteration in the market is unlikely. In the physical market, Pusa‐1121 

(steam) sold at Rs 8,800 , while Pusa‐1121 (sela) quoted at Rs 7,750‐7,800 a quintal. Pure Basmati (Raw) quoted at Rs 12,500 . Duplicate basmati (steam) sold at Rs 7,500 . Sharbati (Steam) sold at Rs 5,000‐5,100 while Sharbati (Sela) quoted at Rs 4,650 . Permal (raw) sold at Rs 2,350 while Permal (sela) was at Rs 2,400. PR‐11 (sela) sold at Rs 3,200 while PR‐11 (Raw) quoted at Rs 3,000. PR14 (steam) sold at Rs 3,300. Paddy arrivals About 10,000 bags of PR paddy arrived and quoted at Rs 1,300, around 20,000 bags of Pusa‐1121 arrived and sold at Rs 3,750‐4,250, while 5,000 bags of Sharbati arrived and sold at Rs 2,100‐2,200. Some 500 bags of Pure Basmati sold at Rs 5,800, about 2,000 bags of DB sold at Rs 4,100 while around 5,000 bags of Sugandha‐999 was at Rs 2,700 a quintal.      

Turmerictradersoptforqualityproduce

Erode, Dec. 12:  Spot turmeric prices dropped on Thursday, but the demand for the hybrid variety increased on quality arrivals. “On Thursday, quality hybrid finger variety arrived for sale. Traders quoted higher price and purchased all the 15 bags that arrived. But they were reluctant to buy other varieties as their quality was poor. Overall 2,300 bags arrived for sale, but only 40 per cent was sold,” said R.K.V. Ravishankar, President, Erode Turmeric Merchants Association. He said that traders and exporters have received limited upcountry orders and sales were poor. Usually during winter, arrivals and sales drop, but this year arrivals have been low compared with previous years. Similarly, 

demand and sales are low. Growers said that they are holding huge stocks with poor sales adding to their woes. They hope that next year sales and prices will rise. At the Erode Turmeric Merchants Association sales yard, the finger variety was sold at Rs 4,196‐5,945 a quintal; the root variety at Rs 3,750‐5,434 a quintal. Salem Hybrid: The finger variety fetched Rs 5,569‐7,211; the root variety Rs 5,111‐5,811. Of the 511 bags that arrived, only 35 were sold. At the Regulated Market Committee, the finger variety was sold at Rs 4,889‐5,917 and the root variety at Rs 4,398‐5,559. Of the 425 bags put up for sale, 356 were traded. At the Erode Cooperative Marketing Society, the finger variety quoted Rs 5,069‐5,969 and the root variety Rs 4,939‐5,569. All the 309 bags found takers. At the Gobichettipalayam Agricultural Cooperative Marketing Society, the finger variety fetched Rs 4,741‐5,969; the root variety Rs 4,569‐5,469. All the 39 bags on offer were picked up.           

  

Cardamomdown1.6%onprofit‐booking

 Cardamom futures prices fell by Rs 10.20 to Rs 592 per kg today after speculators booked profits at prevailing higher levels amid sluggish spot demand.  Sufficient stocks position in the physical market also influenced the prices of the spice.  At the Multi Commodity Exchange, cardamom for December contract eased by Rs 10.20, or 1.69%, to Rs 592 per kg, with a business turnover of five lots.  The spice for delivery in January fell by Rs 4.80, or 0.66%, to Rs 712.30 per kg, with a trading volume of 505 lots.  Marketmen said besides profit‐taking by speculators at existing prices, fall in demand in spot market also put pressure on cardamom prices at futures trade.   

Potatodown1.1%onadequatestocks,lowdemand

Potato prices fell by 1.19% to Rs 913 per quintal in futures trade today as speculators offloaded their positions due to low demand in spot markets.  The trading sentiment weakened further as a result of easy availability of potato in the spot markets following fresh arrivals from producing regions.  At the Multi Commodity Exchange, potato prices for 

April contract fell by Rs 11, or 1.19%, to Rs 913 per quintal, with a business volume of 24 

lots.  The potato for delivery in March declined by Rs 8.30, or 0.89%, to Rs 923 per quintal, with a trading volume of 81 lots.  Market experts said traders offloaded their holdings at existing higher levels, tracking a weak spot market trend on fresh supplies, mainly pulled down potato prices.   

Crudepalmoilup0.7%onspotdemand

Crude palm oil rose by Rs 4.30 to Rs 568.20 per 10 kg in futures trade today as speculators enlarged positions on strong spot demand.  Besides, a firming trend in Asian region on speculation that output in Malaysia, the world's second‐largest supplier, will drop as rains disrupt harvesting also supported the trend.  

At the Multi Commodity Exchange, crude palm oil prices for delivery in January rose by Rs 4.30, or 0.76%, to Rs 568.20 per 10 kg with a trading volume of 86 lots.Likewise, oil price for delivery in December rose by Rs 3.40, or 0.68%, to Rs 561.90 per 10 kg, with a business volume of 74 lots.  Analysts said firming trends in both global and spot markets supported the upside in crude palm oil futures prices here. Meanwhile, palm oil prices rose 1% to $823 per tonne on the Malaysia Derivatives Exchange.   

Corianderdown0.8%onprofit‐booking

Coriander prices fell by 0.80% to Rs 7,775 per quintal in futures trade today as speculators booked profits at existing higher levels amid fall in spot market demand.  At the National Commodity and Derivatives Exchange, coriander prices for delivery in January fell by Rs 63, or 0.80%, to Rs 7,775 per quintal with open interest of 30,170 lots. 

 The price for December delivery declined by Rs 19, or 0.26%, to Rs 7,426 per quintal with an open interest of 1,680 lots.  Market analysts said besides profit‐booking by speculators at existing higher levels, sluggish demand in the spot market led to the fall in coriander futures prices.   

Chanaup0.8%ongooddemandChana prices rose by 0.88% to Rs 2,852 per quintal in futures trade today as traders enlarged their holdings on account of good demand in the spot market.  At the National Commodity and Derivatives Exchange, chana for December delivery rose by Rs 25, or 0.88%, to Rs 2,852 per quintal, with an open interest of 4,180 lots.  Similarly, chana for delivery in January increased by Rs 

20, or 0.66%, to Rs 3,047 per quintal, with an open interest of 93,910 lots.  Traders said speculators increasing their holdings on hopes of a rise in spot market demand due to marriage season, mainly pushed up chana prices.  They said enquiries by millers at lower levels against fall in supply from the producing regions of Rajasthan and Madhya Pradesh further supported the uptrend.   

Vegetableoilimportsup35%to9lakhtonnesinNovember

India's vegetable oil imports rose 35% in November to 9.44 lakh tonnes because of higher shipments of cheaper sunflower oil, says latest industry data.  Import of edible and non‐edible vegetable oils stood at over 7 lakh tonnes in the same month last year.  India's vegetable oil imports rose 4.77% to a record 10.68 million tonnes in the 2012‐13 marketing year 

(November‐October) against 10.19 million tonnes in the previous year due to stagnant domestic output and rising consumption.  

"Import of vegetable oils during November 2013 is reported at 9,44,309 tonnes as compared to 7,00,371 tonnes in November 2012, up by 35%," Solvent Extractors' Association said in a statement.  Edible oils import rose to 9,27,111 tonnes in November from 6,76,234 tonnes in the year‐ago period. Imports of non‐edible oils fell to 17,198 tonnes from 24,137 tonnes.  SEA attributed the surge in import to higher shipments of sunflower oil, which was cheaper by $30 per tonne as compared to soyabean oil.  Sunflower oil import jumped to 1,20,197 tonnes in November 2013 from 47,500 tonnes in the same month last year.  Moreover, it said that spread between RBD Palmolein and Crude Palm Oil reduced to less than $10 per tonne, making RBD Palmolein attractive over crude palm oil.  "In anticipation of likely increase in import duty, palm oil shipments were higher during the month," SEA said.  The current stock of edible oils as on December 1, 2013 at various ports is estimated at 590,000 tonnes and about 880,000 tonnes in pipeline.  During November 2013, the import of refined oil has gone up by 172% at 2,08,076 tonnes as compared to 76,519 tonnes in November 2012.  Import of crude oil is also up by 20% at 7,19,035 tonnes as compared to 5,99,715 tonnes in November 2012.   

Barleydown1.7%onincreasedsellingBarley prices dropped Rs 25.50 to Rs 1,453 per quintal in future trading today following increased selling by traders in line with weak physical markets sentiment.  Marketmen said falling demand amid ample stocks position on regular supply from growing regions in spot markets mainly led the fall here in futures trading.  At the National Commodity and Derivatives Exchange, 

barley for June contract dipped by Rs 25.50, or 1.72%, to Rs 1,453 per quintal, with an open interest of 30 lots.  Most active January contract fell by Rs 4.50, or 0.31%, at Rs 1,437.50 per quintal, having an open interest of 5,650 lots.  

Risingimportofrefinedoilmakesdomesticrefiningindustryintojittery

Increasing share of refined oil in the overall vegetable (veg) oilimport basket has hit five‐year high in November due to narrowing spread between crude and refined oil in global markets.   Data compiled by the Solvent Extractors’ Association (SEA) showed that the share of refined oil (refined, bleached and diodized or RBD) jumped to 22% in November this year as compared to 11% in the 

corresponding month of previous year. Barring oil year (November – October), the contribution of RBD in the overall imports of veg oil was ranging between 11‐16%. Last year, however, the share of RBD shot up to 21% on narrowing of price spread gradually.   “The spread between crude palm oil (CPO) and RBD currently stands at $10 a tonne. Considering premium, import duty levied by India and export duty by Indonesia where most of CPO getting imported, import of RBD works out to at least $30 a tonne cheaper than CPO. On the top of that, import of CPO requires refining and packing in local units which makes edible oil sell through imported CPO costly. Hence, for Indian processing industry, import of RBD makes more business sense than import of CPO,” said Pradeep Choudhry, managing director of Gemini Edibles & Fats India Pvt Ltd, a Hyderabad‐based subsidiary of Ruchi Soya Industries Ltd.   Average price of RBD worked out to $880 as against $881 of CPO in November, resulting into the spread becoming negative by $1 a tonne. Opportunistic buyers, however, negotiate bilateral trade resulting into the spread working out to $10 a tonne. In the corresponding month previous year, however, the spread was prevailing at $69 a tonne with the price of RBD and CPO at $840 and $771 a tonne respectively.  

Ratio of refined and crude oil(tonnes) 

           

Year (Nov – Oct)  Refined oils     Crude oils     Total 

November ‘13  2,08,076  22  7,19,035  78  9,27,111 

November ‘12  76,519  11  5,99,715  89  6,76,234 

2012‐13  22,23,265  21  81,61,474  79  1,03,84,739 

2011‐12  15,77,356  16  84,04,110  84  99,81,466 

2010‐11  10,81,686  13  72,89,773  87  83,71,459 

2009‐10  12,13,409  14  76,09,929  86  88,23,338 

2008‐09  12,40,018  15  69,43,342  85  81,83,360 

Source: SEA  

“Increasing import of RBD has proved a ‘death knell’ proving disastrous for the domestic processing industry. Since, the government reduced duty differential between RBD and CPO at 5% by levying 2.5% import duty on the latter, the import of the former has increased significantly. Consequently, the domestic refining industry has reduced its operational capacity to less than 30% now from over 40% about six months ago,” said Atul Chaturvedi, Chief Executive Officer of Adani Wilmar Ltd, one of the largest refiners and producer of “Fortune” brand edible oil.   Interestingly, the government of Indonesia has promoted its refining industry by keeping the duty differential at 6% (9% on CPO and 3% on RBD) which helped them build enormous capacity over the last few years. India’s overall veg oil imports in November surged by 35% to 944,309 tonnes this year as compared to 700371 tonnes in the corresponding month previous year.   “Reduction in the duty differential between CPO and RBD has led to large scale imports of Refined Palmolein in the past few months, thereby resulting in further underutilization of capacity of the refining Industry in India. Refining industry in India is bleeding and urgent intervention of the government is needed to save the industry that provides direct and indirect employment to over 5 lakh citizens of India,” said Dinesh Shahra, Founder and Managing Director, Ruchi Soya Industries Ltd.   According to Choudhry, import of RBD will continue to rise going forward until the government brings the duty differential level of at least 7.5% as recommended by the Ashok Lahiri Committee.   

Risingglobaldemandgivesaboosttospiceprocessingsector

The spices processing market in India has seen an increase in volumes, owing to the huge global demand for processed Indian spices such as oleoresins and seasonings, primarily from the UAE, the US, the European Union and the Asia‐Pacific.  India is the largest producer and exporter of spices. India's estimated spices production stood at 5.9 million tonnes (mt) in 2012‐13, while imports of 0.1 mt were 

recorded, Rabobank said in a report.  Though the sector hasn't seen new players, as the initial investment is very high, many existing companies have ramped up capacities to meet the growing demand, both in the domestic, as well as the export market. “Two years ago, I processed about 4,000 tonnes of spices. Now, I am processing 6,000 tonnes due to growing demand for processed spices. In the last 10 years the (spices) processing industry has seen tremendous growth,” said Jojan 

Malayil, chief executive of Bafna Enterprises, a Kerala‐based spices producing company.  Through the last 10 years, the environment in this space has changed. Now, consumers prefer ground spices to whole spices. The urban domestic market has also started opting for readymade spices, and this has led to the emergence of various brands in this segment.  Overall spices consumption in the domestic market is 5.3 mt. In value terms, 20 per cent of this is accounted for by the branded segment. Rabobank sees this segment growing at a compounded annual rate of 12‐15 per cent through the next four‐five years.  "The demand for oleoresins and seasonings has led many players to focus on research and technology to manufacture innovative products. Revenue realisations on exports of value‐added products have been quite high," Rabobank said in the report.  India has now started to face the heat from Vietnam as it is now emerging as a new spices exporting hub, but so far India still continues to remain the global leader.   

Inthelandoftheholycow,furyoverbeefexportsSymbols of India's emergence as an economic powerhouse line the four‐lane highway to Jaipur out of New Delhi: a factory owned by the world's biggest motorbike maker, glass towers housing global call centres, shopping malls for India's burgeoning middle class.  One night in August here, an angry mob ran amok, burning trucks and government property and forcing traffic to halt and factories to shut.  The rioters were incensed over an issue arguably as old as India itself: the eating of beef, which the country's majority Hindus have considered sacrilegious for at least a thousand years.  Perhaps surprisingly in a country where so many people view cows as sacred, India could soon become the world's biggest beef exporter, according to the United States Department of Agriculture (USDA).  Most, though not all, of the beef India exports is buffalo, an animal less venerated than the hump‐backed indigenous Indian cow. But the trade, even in buffalo beef, still evokes revulsion among Hindu nationalists. The sharpest criticism comes from the Bharatiya Janata Party (BJP), the main opposition in parliament. Its candidate for prime minister in next year's elections, Narendra Modi, has slammed what he calls the government's "pink revolution," (a play on the original agricultural or "green" revolution in India) and its "secret agenda ... for export of beef."  India's vegetarian traditions and the Hindu aversion to beef mean only 2.1 million tonnes 

(mt) of beef are consumed domestically a year. That compares with 11.5 mt a year in the United States, which has just a quarter India's population.  But exports of beef from India are likely to hit close to 1.8 mt in 2013, second only to Brazil, according to an April forecast by the USDA. The value of India's exports has nearly doubled from $1.9 billion in 2010‐11 to $3.2 billion in 2012‐13, according to the government's Agricultural and Processed Food Products Export Development Authority (APEDA). That's about one percent of India's $300 billion annual exports last financial year.  While beef is unlikely to emerge as a major issue ahead of next year's election, Modi has made his opposition to the trade clear. In a blog on his website in 2012, he attacked the current government's policies and called for a halt to the beef trade.  "Our ancient Indian ethos and values doesn't teach us to kill mother cow ... sadly, the (government) seems unbothered about this rich ethos of our culture. It wants to make India the biggest exporter of beef!" he wrote in August last year. "Our future generation is not getting sufficient milk and this government wants to kill cows that provide us a 'ladder for life.' I'm sure that you will contribute your might in stopping such an insane act."  Modi has not commented on the trade in recent months, perhaps because he is trying to downplay his Hindu nationalism ahead of national elections to be held by next May. The BJP has won sweeping victories in local state elections this month, sending the stock market to a record high on expectations Modi, widely seen to be more business‐friendly than the current Congress Party‐led government, will lead his party to power.  In India, the beef issue can even stir sectarian divisions. Beef production is dominated by Muslims, a minority in the country. Many Muslims mistrust the BJP and Modi, because he ran the state of Gujarat during anti‐Muslim riots there in 2002. Modi denies any role in the riots or bias against Muslims.  This year's unrest along the Delhi‐Jaipur highway shows how quickly beef can stir anger. Passers‐by reported a foul smell coming from a truck that had broken down; rumours spread that it was loaded with cow meat. Slogan‐shouting youths swept through the town of Dharuhera, some 40 km (25 miles) from Delhi, ransacking the truck and tearing out its cargo of ice‐covered meat. By the time police calmed the riot, 74 trucks and buses had been burned.  In the end, the cargo turned out to be buffalo meat, not cow. But Sailesh Soni, a member of the Rashtriya Swayamsevak Sangh, a powerful Hindu nationalist group that backs the BJP and wants stricter enforcement of a ban on cattle killing, said all Hindus should be ready to defend all cattle.  "If somebody targets my mother, what would I do? I will stand and save her, isn't it? Likewise, you should get up, gather and save our mother cow," he said.  In a cavern under the well‐swept courtyard of a Hindu temple off the narrow streets of Old 

Delhi, a calf blinks as it takes in the world for the first time and nuzzles for its mother's udder. 

This is a goshala, a shelter for cows brought there by Hindus as thanks to the gods for good fortune, or simply pulled in off the streets where they wander, disrupting traffic and feeding on rubbish.  Hindus believe that Nandi, a bull, is the steed of powerful deity Lord Shiva, and that Lord Krishna was born as a cow‐herd.  Many rural households in India, the world's biggest producer of milk, own at least one cow or buffalo. Female buffaloes, in particular, are prized for their creamy milk, while the males are used for pulling carts and ploughs, and their dung keeps home fires burning in villages that have little or no access to power.  

Statistically, there are enough cows and buffalo in India for every rural household to have about two. But once cows are past their productive life, owners will often simply turn them out, unwilling to spend on fodder for no return.  Buffaloes and cows are increasingly ending up in abattoirs mushrooming across the country, according to industry participants and officials Reuters spoke with. Buffalo makes up by far the bulk of India's beef exports. Cow meat is banned from export, but animal rights groups say some finds its way abroad.  In all, India has half the buffaloes in the world, according to the Indian Council of Agricultural Research, and the largest number of cattle, with 327 million head, according to the USDA. The United States has around 89 million cattle.  Sitting in his airy ground‐floor office in an abattoir about 8 km (5 miles) from the town of Aligarh, Mahendra Singh says business is booming. His production of buffalo meat has increased to 150 tonnes a day from 100‐120 tonnes around a year ago.  His employer, Hind Agro industries Ltd, has sought the local government's permission to lift its daily output limit to 250 tonnes to meet rising demand.  "Earlier there was only our plant but now there are more than five more units in this area alone," Singh, the plant's General Manager, said.  One of the company's leading suppliers is Salim Qureshi, who cuts an imposing figure dressed all in white as he strides between boot‐polish‐black buffalo at Gulaothi animal market.  Men greet him warmly, addressing him as Haji Salim in respect for his three pilgrimages to Mecca, and calling him over to see their animals.  Qureshi casts his eye over a large bull and weighs the beast by sight, judging it to be about 

300 kg (660 lbs), worth as much as $650. The beast is skin and bone compared to American steers, which can weigh more than twice as much.  "I have around 100 suppliers working for me," Salim says as he settles the price. "There were just 30 animal suppliers a few years back but now every plant has around 30 to 40."  Striking deals conforms to a long‐standing tradition among Muslim traders, and highlights the way the industry works on both trust and secrecy.  Standing slightly apart from the crowd, one supplier speaks in whispers to the owner of a hefty‐looking buffalo. He puts a one‐rupee piece into the other man's palm as a token of good faith.  "I bought 70 heavyweight buffalo," says Mohammad Sheikh, one trader. "I hope I have estimated the weight correctly or I'll make a big loss," he says, replacing his wallet in the pocket of his brown wool waistcoat.  Qureshi outlines plans for his own slaughter house as he offers snacks in the salon of his eye‐catchingly colourful house outside Aligarh. The dates are as plump as the velvet cushions and the cashews are perfect crescents.  "This business is profitable," he says.  A dull thud announces the arrival of another black carcass on the conveyor belt and, 30 seconds later, a buffalo hangs from an overhead hook through its foreleg, swaying gently as it waits in line to be stripped to white, slippery flesh.  The abbatoir's conveyor belt moves slowly, taking the body past a succession of men who each remove some part of the animal. Skin, hooves, ears, head; every bit is stripped from about 1,500 buffalo a day.  Hind Agro sells most of its meat to the Middle East and Southeast Asia, but the government says India's biggest beef buyers are Vietnam, Malaysia, Thailand and Egypt.  China, where beef consumption is growing rapidly, could soon be on the official customer list after the two countries signed a framework deal earlier this year.  China may already be buying huge amounts of Indian beef via Vietnam, according to industry experts who would speak only on condition of anonymity. According to Vietnam's customs data, the country imports no buffalo meat from India.  Global demand for exports of buffalo ‐ leaner and cheaper than cow meat ‐ is growing at around 30 per cent a year. The lack of growth hormones in Indian beef provides an additional attraction for health‐conscious consumers, said M Kalim Khan, vice‐president of exports and marketing at Hind Agro.  India might not be able to increase supplies quickly enough to meet that demand given the 

lack of dedicated buffalo farms or rearing facilities. Analysts at Credit Suisse say about 10.5 million animals are likely to be slaughtered in India in the financial year 2013‐14, but add that there's a limit.  "It is hard to see this number rising much higher, as ... of the 105 million buffaloes in 2007, only 20 million were males, and less than 2 million were females beyond reproductive age," they said in a research note.  The rapid expansion of the sector, rising prices and demand have encouraged cattle smuggling, animal activists and officials say.  "Abandoned animals are picked up from the streets for slaughter. No one is bothered because everyone, including the police, get their share from the agents," says Arvind Shah, a founder of Karuna, a charity for animal welfare in the city of Mumbai.  Shah, whose tall and thin physique has made him a well‐known figure among residents near his tiny office, describes violent clashes between truck drivers and animal rights activists.  "Stopping trucks on highways in the middle of the night is a very risky business. I was chased by masked men and threatened," the 49‐year‐old activist says.  Activists get tip‐offs from villagers and even rival suppliers about the route and timing of vehicles carrying meat or animals, and then they work out a strategy to stop them.  "We go in a group of 30 to 40 people and carry wooden sticks. Most of the time, we succeed in stopping the trucks and releasing the animals," says Brijesh Shah, a 34‐year‐old member of Jiv Rakshak Dal, which literally means animal protection group. "Sometimes ... they attack us with iron rods and other sharp weapons."  The group has stopped 120 trucks since 2002 and saved around 8,000 animals, he says.  Truck drivers, for their part, have stories of beatings and robberies.  "We are fed up of paying bribes to policemen and getting beaten up by animal rights people and political party members," said Mohammad Gulfam, a driver at the Gulaothi market.  While government regulations on the transport of animals are strict, implementation is often weak and cattle are squeezed into trucks to cut costs. Animals often make the journey to the slaughter house without food or water and are sometimes left in the baking heat while drivers take their breaks.  Even beef producer Qureshi admits the rules are flouted. The law allows transport of only seven animals in a 22‐foot‐long vehicle. Suppliers load around 14 animals to save the transportation charges, he said. Most have their own trucks to transport animals.  And there are dangers for beef traders even when they are operating legally.  

"On my way to make a delivery at Hind Agro, our truck was stopped by about 15 people belonging to some political party," said Mohammad Yusaf, a driver waiting to load up at Gulaothi market. "They beat me and my co‐worker and robbed us of Rs 25,000," he added.  While Modi's heartland of Gujarat is not on any of the main routes to ports, Qureshi no longer lets his trucks travel there even if it's a shortcut for some deliveries.  "It's the most troubled route. We face a lot of problems in Gujarat ... The chief minister himself is against this trade," he said.  Gujarat's BJP government says the state bans the slaughter of cows and transportation of beef but that buffalo meat is not banned. However, a Home Department official said local "cow protection committees" stop vehicles ferrying meat and pressure police to act. "They take legal action if the vehicles are found to be ferrying beef, but many times even genuine firms have to suffer," the official said.  After the outbreak of violence outside New Delhi, Muslim elders and clerics decided that preserving the peace was far more important than eating beef.  Anyone killing cows, including the ones left to stray, will now be fined Rs 115,000, they announced. Since then, tensions have eased in the area, where Hindus and Muslims live side‐by‐side and chat in each other's front yards.  "This wasn't such a problem before, but some people are trying to create trouble between the communities," said Mohammad Shaikh, a young cleric at a local mosque. "We have told our people not to do anything provocative at this time."    

Increasingmilkexportscancausevolatilityindomesticprices:Dairyboardchief

While increasing milk exports can give higher returns in some years, fluctuations in global supply and demand could lead to substantial volatility in prices back home, felt Amrita Patel, chairperson of the National Dairy Development Board(NDDB).  As our dairy sector integrates itself increasingly with the global one, the volatility in international markets is likely to be transmitted to a large extent to our domestic 

market, the chairperson said.  

She added, “I fear that all too often when we think of our position in the global market and the steady growth in our milk production, we see ourselves as growing exporters of dairy commodities, and believe this could also improve returns to our milk producers. While this may be so, we need to appreciate that pursuing this path without ensuring that the domestic market is met would result in competition between the domestic and export markets and an increase in prices for domestic consumers.”  She claimed the rise in feed costs from an increase of nine per cent in 2011‐12 to 27 per cent in 2012‐13 is also leading to higher production costs and therefore higher milk prices. At some stage, the rise in price of milk could erode the ability of many families to purchase milk.  About seven per cent of total world milk production is traded. Developed countries account for about three‐fourths of exports and developing countries account for about three‐fourths of the imports.  Currently, the organised sector handles only about 30 per cent of the marketable surplus. Patel feels in the interest of both producers and consumers, it is necessary to increase the share of the organised sector comprising cooperatives, producer companies and private companies. The National Dairy Plan has set this target over the next 15 years at 65 per cent.    "But to achieve this, private companies would need to collect milk directly from producers as is being done by cooperatives and producer companies. Alternatively as is the case abroad, private companies need to explore sourcing their requirement of milk from cooperatives and producer companies.Further, since the sale of liquid milk is likely to contribute to much of the trade in milk in India for quite some years, private companies need to enter the liquid milk market in addition to marketing products," Patel said.    She mentioned that in future it would be desirable that the private sector and cooperatives work together to ensure that exports take place after meeting the domestic demand of both. If a higher price needs to be paid to match export prices, then this should be paid, said Patel.      Meanwhile, she also said that the growth in milk production in our country, as reflected in the rate of inflation, appears to be satisfactory when compared to other protein foods like eggs, meat and fish. The per capita availability of milk of 290 gm per day is slightly more than world average.   According to Patel, over the last five years, India’s milk production has increased by about 25 million tonnes compared to an increase of about 6.6 million tonnes in the US, 5.4 million tonnes in China, 2.7 million tonnes in New Zealand and 1.6 million tonnes in the EU.   ‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐‐