4 salika m. shakir - journal of bacteriology · 2009. 11. 13. · shakir et al. a...
TRANSCRIPT
Regulatory Interactions of a Virulence-Associated Serine/Threonine 1
Phosphatase-Kinase Pair in Bacillus anthracis 2
3
Salika M. Shakir1, Katie M. Bryant
1, Jason L. Larabee
1, Elaine E. Hamm
1, Julie Lovchik
2, C. 4
Rick Lyons2
and Jimmy D. Ballard1*
5
6
7
1Department of Microbiology and Immunology, The University of Oklahoma Health Sciences 8
Center, Oklahoma City, Oklahoma 73104, 2Department of Internal Medicine, University of New 9
Mexico Health Sciences Center, Albuquerque, NM, 87131 10
11
Running title: A virulence-associated B. anthracis ser/thr phosphatase-kinase pair 12
13
14
15
*Address Correspondences to: Jimmy D. Ballard, University of Oklahoma Health Sciences 16
Center, BRC-362A. 975 NE 10th
Street, Oklahoma City, OK 73104, Tel: 405-271-3855, 17
Fax: 405-271-3874, email: [email protected] 18
Copyright © 2009, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights Reserved.J. Bacteriol. doi:10.1128/JB.01221-09 JB Accepts, published online ahead of print on 13 November 2009
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
2
ABSTRACT 19
In the current study we examined the regulatory interactions of a serine-threonine phosphatase 20
(BA-Stp1), serine-threonine kinase (BA-Stk1) pair in Bacillus anthracis. B. anthracis STPK101, 21
a null mutant lacking BA-Stp1 and BA-Stk1, was impaired in its ability to survive within 22
macrophages, and this correlated with an observed reduction in virulence in a mouse model of 23
pulmonary anthrax. Biochemical analyses confirmed that BA-Stp1 is a PP2C phosphatase and 24
dephosphorylates phosphoserine and phosphothreonine residues. Treatment of BA-Stk1 with 25
BA-Stp1 altered BA-Stk1 kinase activity, indicating that the enzymatic function of BA-Stk1 can 26
be influenced by BA-Stp1 dephosphorylation. Using a combination of mass-spectrometry and 27
mutagenesis approaches, three phosphorylated residues T165, S173, and S214 in BA-Stk1 were 28
identified as putative regulatory targets of BA-Stp1. Further analysis found that T165 and S173 29
were necessary for optimal substrate phosphorylation, while S214 was necessary for complete 30
ATP-hydrolysis, autophosphorylation, and substrate phosphorylation. These findings provide 31
insight into a previously undescribed Stp/Stk pair in B. anthracis. 32
33
34
35
36
37
38
39
40
41
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
3
INTRODUCTION 42
A profile of the intracellular signaling proteins that regulate transition of Bacillus anthracis from 43
dormancy to expression of virulence factors is emerging. Like many prokaryotes, B. anthracis 44
utilizes two-component histidine kinase systems to regulate physiological changes and the 45
expression of virulence factors. These systems include the Spo0 histidine kinase based 46
phosphorelay pathway (32, 37) and the Bacillus respiratory response A and B involved in 47
regulating toxin expression (36). Unlike histidine kinase systems, little is known about reversible 48
serine/threonine phosphorylation events in B. anthracis. These systems are common to 49
eukaryotic cells (3, 14, 25, 40), but were only recently found in prokaryotes to modulate a variety 50
of metabolic and physiological processes (1, 2, 7, 11, 12, 15, 17, 24, 28, 35, 38). Whether 51
reversible serine/threonine phosphorylation contributes to similar events in B. anthracis is not 52
known. 53
54
The current paradigm for prokaryotic serine/threonine kinases (STK) is based in part on the 55
structure of PknB, a serine-threonine kinase from Mycobacterium tuberculosis that is structurally 56
related to eukaryotic Hanks-type kinases (39). PknB autophosphorylates and is dephosphorylated 57
by a M. tuberculosis phosphatase, PstP, in order to alter kinase activity (4). Similar to the 58
findings on PnkB, Madec et al. identified critical autophosphorylated residues and 59
autophosphorylated domains of PrkC, an STK from Bacillus subtilis (22), which suggested the 60
phosphorylation state of these residues impacts the activation of PrkC (22). These studies 61
suggested prokaryotic STKs exhibited similar activities to their eukaryotic homologs and were 62
regulated by cognate phosphatases. Hence, studies on serine-threonine phosphatase (STP)/STK 63
pairs may help define a core regulatory module in bacterial physiology and virulence, wherein 64
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
4
the kinase autophosphorylates following interaction with stimuli and is subsequently down 65
regulated by a cognate phosphatase when stimuli levels decline. 66
67
Analysis of the B. anthracis genome indicates this organism has a single phosphatase/kinase pair 68
encoded within a putative operon. This operon, between nucleotides 3588319 and 3678099 in the 69
genome of B. anthracis Sterne, contains eight candidate open reading frames (ORF). Six of the 70
potential ORFs encode proteins involved in translation and DNA metabolism, while the 71
phosphatase-encoding ORF (stp1) and the kinase-encoding ORF (stk1) are paired at the 3’ end of 72
this operon. Examination of the genome sequences of several other Gram-positive bacteria 73
indicates this putative operon and the general orientation of stp1 and stk1 are conserved among 74
members of the Firmicutes group of bacteria. BA-Stp1 and BA-Stk1 homologs influence a 75
variety of bacterial processes. For example, homologs of BA-Stp1 and BA-Stk1 regulate growth 76
in Bacillus subtilis (12), cell viability and segregation in Streptococcus agalactiae (28), 77
competence in Streptococcus pneumoniae (26), and virulence in both Streptococcus pyogenes 78
(17) and Staphylococcus aureus (9). Although kinases homologous to BA-Stk1 influence several 79
bacterial processes in different species, the tandem association of this kinase with a phosphatase 80
does not vary. This observation led us to hypothesize that the phosphatase (BA-Stp1) influences 81
Ba-Stk1 activity by dephosphorylation. 82
83
In the current study we analyzed the importance of BA-Stp1 and BA-Stk1 in the virulence of B. 84
anthracis and assessed the biochemical interactions between these two proteins. Results from 85
these studies indicate this phosphatase/kinase pair contributes to the virulence of B. anthracis, as 86
mutants lacking BA-Stp1 and BA-Stk1 exhibit decreased lethality in a mouse model of 87
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
5
inhalational anthrax. Furthermore, a series of biochemical analyses reveal an interaction between 88
BA-Stk1 and BA-Stp1 where BA-Stk1 autophosphorylates in order to enhance kinase activity 89
and is dephosphorylated by BA-Stp1 as a putative step in down-regulating kinase activity as 90
levels of stimuli subsides. Moreover, we have identified candidate serine and threonine residues 91
that appear to modulate kinase activity. These findings provide insight into a previously 92
undescribed serine-threonine phosphatase/kinase system in B. anthracis. 93
94
MATERIALS AND METHODS 95
Bacterial strains, cell lines, and growth conditions. B. anthracis Sterne strain 7702, (as 96
described by Cataldi et al.(6)) and Escherichia coli were grown in Brain Heart Infusion Broth 97
(BHI) and Luria-Bertani (LB) medium respectively at 37°C. 98
99
Abelson murine leukemia virus-transformed murine macrophages derived from ascites of 100
BALB/c mice (termed RAW 264.7) were obtained from the American Type Culture Collection 101
(ATCC, Manassas, VI). The RAW 264.7 cell line was maintained in tissue culture-grade T-75 102
flasks grown in the presence of Dulbecco’s Modified Essential Medium (DMEM) (ATCC) 103
supplemented with 10% Fetal Bovine Serum (FBS) (ATCC) at 37°C with 5% CO2 in a 104
humidified incubator. Cells were used between passages 10 and 20 for the infection experiments. 105
106
Genetic construction of a ∆ba-stp1/∆ba-stk1 double mutant in B. anthracis Sterne. Allelic 107
replacement was used to construct a double mutant lacking expression of BA-Stp1 and BA-Stk1. 108
Briefly, a 3.75 kb fragment comprising of 1,500 bp flanking regions sharing sequence similarity 109
to the upstream and downstream region of the ba-stp1 gene was PCR amplified from B. 110
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
6
anthracis Sterne 7702 genomic DNA using forward primer, 5’-CC 111
GGAATTCGGCATTAGATGCTAGAAAAGTGC-3’ and reverse primer, 5’-112
CCGGAATTCGTCTAATTTGATAAGGGCCTTTAC-3’ incorporating EcoRI restriction sites. 113
The PCR product was subsequently ligated to pGEM-T-easy vector (Promega) using TA 114
overhangs to generate the plasmid construct pGEM-PK101 that was transformed into E. coli 115
JM109. Transformed clones were screened for ampicillin resistance and DNA sequencing of the 116
isolated plasmid confirmed clones positive for insert. Inverse PCR was then performed using 117
pGEM-PK101 as a template with right primer, 118
5’-CGCGGATCCAGTGCAACGTGCTGATTGGAAAAC-3’ and left primer, 5’-119
CGCGGATCCCTCGTCACCTCGTCTCTTCTTTGC-3’ that amplify a gene sequence inverse 120
to ba-stp1 incorporating BamHI restriction sites. The inverse PCR product comprising the 121
homologous flanking regions of ba-stp1 (inserted in pGEM-T-easy) was then ligated to BamHI 122
digested apha-3 gene (Ω-km-2 cassette) isolated from pUTE618 (31) conferring kanamycin 123
resistance. The resulting clone was then digested with EcoRI to release ∆ba-stp1-kanr which 124
was then sub-cloned into pUTE568 (31), a generous gift from Dr. Theresa Koehler, producing 125
pPK101. E. coli strain JM110 (∆dam ∆dcm) was then transformed with pPK101 to obtain 126
unmethylated DNA that was subsequently electroporated into B. anthracis Sterne 7702. 127
Transformants were selected on solid LB-agar plates containing kanamycin (100 µg/ml) and 128
erythromycin (5 µg/ml). To select for the double-recombination event, isolated clones were 129
serially passaged in antibiotic-free medium and clones exhibiting a Kanr
Erms phenotype were 130
identified. The mutant STKP101 was confirmed by PCR and maintained in medium containing 131
kanamycin (100 µg/ml). 132
133
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
7
Spore preparation and infection experiments. Vegetative bacilli of B. anthracis Sterne 7702 134
parent strain and B. anthracis STPK101 mutant strain (grown in the presence of kanamycin (100 135
µg/ml) were induced to sporulate by growth in sporulation medium (PA broth) containing: 0.6 136
mM CaCl2, 2H2O; 0.8 mM MgSO4, 7H2O; 0.3 mM MnSO4, H2O; 85.5 mM NaCl and 8 g/L 137
Nutrient Broth (pH 6.0) as described by McKevitt et al. (23). Spore suspensions were diluted to 138
working concentrations necessary for the corresponding experiment, and heated to 70°C for 30 139
min to kill any residual vegetative cells as well as to heat-activate the spores. RAW 264.7 140
macrophages were seeded into 24-well tissue culture-grade plates at a concentration of 7.5 x 105 141
cells/well in DMEM-10% FBS and incubated overnight at 37ºC in 5% CO2. Macrophages were 142
then infected with spores of B. anthracis Sterne 7702 parent or B. anthracis STPK101 mutant 143
strain at a multiplicity of infection (MOI) of 10. Subsequently, the plates were centrifuged at 250 144
x g for 10 min. The plates were then incubated at 37ºC, 5.0% CO2, for 30 min after which 145
gentamicin (10 µg/ml) was added to kill extracellular vegetative bacilli for an additional 30 min. 146
Next, the infected macrophages were washed ten times with DMEM-10% FBS and then 147
incubated for up to 10 hours. At two-hour intervals, the culture media was removed and the 148
macrophages were scraped from the wells with PBS, briefly vortexed and subsequently serially 149
diluted and plated on solid media. The total number of colony forming units (CFU) were 150
enumerated following an overnight incubation. The average and standard deviation were 151
calculated from two independent experiments performed in triplicate. 152
153
In vivo analysis of B. anthracis STPK101 was performed using a mouse model of pulmonary 154
anthrax similar to that previously described (20, 23). Briefly, female DBA/2 mice (housed in 155
accordance with approved IACUC guidelines, University of New Mexico Health Sciences 156
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
8
Center) were anesthetized and the trachea was exposed by a small incision under the skin. 157
Spores were injected in a 50 ml volume using a bent 30-guage needle. To determine the number 158
of spores deposited per group, 2 mice were sacrificed and the total CFU was determined from 159
homogenized lung tissue. The animals were monitored twice daily for survival and clinical 160
signs. 161
162
Monitoring spore germination and sporulation efficiency. Spore germination was determined 163
using the protocol described by McKevitt et al. (23). Briefly, spore preparations (3x107) of B. 164
anthracis Sterne 7702 parent and B. anthracis STPK101 mutant strains were heat activated (20 165
min at 65°C) and resuspended in 200 µl of medium (PBS, L-alanine, inosine, or 25% BHI) in a 166
well of a 100 well Honeycomb 2 (Thermo Electron Corp) microplate. Germination was 167
monitored at 37°C by loss of optical density at 600 nm caused by changes in the refractivity of 168
the spore. Germination was analyzed as percent decrease in optical density measured every 3 169
minutes for 30-60 min under shaking conditions. Experiments were carried out in triplicate and 170
mean absorbance was determined. 171
172
To analyze sporulation, B. anthracis Sterne parent and B. anthracis STPK101 mutant vegetative 173
cells were cultured in sporulation medium containing: 0.6mM CaCl2⋅2H2O, 0.8mM 174
MgSO4⋅7H2O, 0.3mM MnSO4⋅H2O, 85.5mM NaCl and 8 g/L Nutrient Broth (pH 6.0) for 3 days 175
at 30°C. The samples were heated at 70°C for 15 min to kill vegetative bacilli and he number of 176
heat resistant CFU were determined by serial dilution and plating. The percentage of heat 177
resistant CFU from the total CFU was calculated to determine the sporulation efficiency. 178
179
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
9
Construction of His-tagged BA-Stp1 and His-tagged BA-Stk1cat. Genomic DNA was isolated 180
from an overnight culture of B. anthracis Sterne 7702 in BHI. To construct His-BA-Stp1, a 753-181
bp fragment was PCR amplified with forward primer 5'-182
GGAATTCCATATGGAAGGAGCGCAAAGAAGAGAC-3' and reverse primer 5'-183
GGCGCGGATCCGCTTATAACGGTCATTTAAGA-3' from isolated genomic DNA using 184
High Fidelity Polymerase (Roche). Similarly, the putative catalytic domain of BA-Stk1cat was 185
PCR amplified from genomic DNA using the following oligonucleotides; 5’-186
GGGATTCATATGGTGCTGATTGGAAAACGCTTAAATG-3’ 187
and 5’-CGGATCCTTGTCGCTTCCATATCTTCCGG-3’. The primers were designed to 188
incorporate NdeI and BamHI restriction enzyme sites respectively. The PCR product was cleaned 189
with QIAquick PCR Purification Kit (Qiagen) and subsequently digested with NdeI and BamHI 190
(New England Biolabs) overnight at 37°C. The digested PCR products were then ligated using 191
T4 DNA ligase (Roche) into the expression vector, pET-15b, and transformed into E. coli XL1-192
Blue to obtain the recombinant plasmids, pET-15b-BA-Stp1 and pET-15b-BA-Stk1cat. DNA 193
sequence analysis of the BA-Stp1 insert at the Laboratory for Genomics & Bioinformatics 194
Sequencing Core (OUHSC), demonstrated that it was identical to the locus BAS3714 of B. 195
anthracis Sterne 7702. 196
197
Expression and purification of His-tagged BA-Stp1 and His-tagged BA-Stk1cat. The 198
recombinant plasmids pET-15b-BA-Stp1 and pET-15b-BA-Stk1cat were transformed into E. coli 199
BL21 (DE3) cells (Novagen) and transformed clones were selected on LB agar plates containing 200
ampicillin (50 µg/ml) (American Bioanalytical). Single colonies were grown in cultures to an 201
OD600=0.7 before inducing for 4 hours at 37°C with 1mM Isopropyl β-D-1-202
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
10
thiogalactopyranoside (Denville Scientific). Cells were then harvested by centrifugation at 9000x 203
g for 20 min and the pellets were resuspended in 20 mM Tris-HCl, 500 mM NaCl, and 10 mM 204
imidazole pH 7.9 and lysed using a cell disruptor. Recombinant BA-Stp1 and BA-Stk1cat were 205
purified using the His•Bind kit (Novagen) according to the manufacturer’s instructions and 206
desalted in 20 mM Tris-HCl using PD-10 columns (GE Healthcare). The purified proteins were 207
visualized on a 12.5% SDS-PAGE stained with Coomassie Brilliant Blue. When necessary, the 208
His-tag of purified BA-Stp1 was cleaved using thrombin (Novagen) following manufacturer’s 209
instructions. 210
211
In vitro phosphatase assays using p-NPP and phosphopeptides. All reactions were performed 212
in 50 µl reaction buffer containing 50 mM Tris-HCl, pH 8.0, 5 mM MnCl2, 5 mM MgCl2, 0.5 213
mM DTT (Invitrogen). Single tablets of p-NPP (Sigma) were dissolved in 5 ml of reaction 214
buffer immediately before use to give a working stock of 10 mM. Fifty microliters of this 215
working stock was added to each well in triplicate, and the reaction was initiated by adding 3 µg 216
of purified BA-Stp1 to the appropriate wells. Absorbance at 405 nm was measured every 5 min 217
for 90 min in a 96-well plate reader at 37°C. 218
219
Dephosphorylation of phosphopeptides was examined using a malachite green/molybdate 220
phosphatase detection system (10). Briefly, 5 mM phosphopeptides, RRApTVA (Promega), 221
RRApSVA and RRLIEDAEpYAARG (Upstate) were added to the reaction buffer 222
containing 50 mM Tris-HCl pH 8.0, 5mM MnCl2, and 0.02% (v/v) β-mercaptoethanol. To 223
initiate the reaction, BA-Stp1 was added to the reaction mixture across a range of concentrations 224
from 0-600 mM, in a total final volume of 50 µl. The reactions were incubated at 37°C for 15 225
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
11
min. Subsequently, 50 µl of the molybdate dye/Additive mixture (Promega) was added to stop 226
the reaction and the plate was incubated for 15 min at room temperature to allow for color 227
development. Absorbance of the malachite green-molybdate complex was measured at 600 nm 228
and the amount of free phosphate released was determined using a standard curve. For enzymatic 229
analysis, 1.3 µM BA-Stp1 and phosphopeptides concentrations ranging from 5-400 µM were 230
used to determine the initial reaction rates. The Km and Vmax values were calculated by using non-231
linear regression analysis (Prism software). 232
233
Oligonucleotide site-directed mutagenesis. Mutagenesis of aspartic acid residues was 234
performed using QuikChange site-directed mutagenesis kit (Stratagene) according to 235
manufacturer’s instructions. Briefly, 50 ng of pET-15b-BA-Stp1 was used as a template. Point 236
mutations were inserted using synthetic oligonucleotide pairs as follows, D18A forward primer 237
5'-AAAAGTTCGTCAACATAATGAAGCTAGTGCAGGAGTTTTTCACAAT-3', reverse 238
primer 5'-AATTGTGAAAAACTCCTGCACTAGCTTCATTATGTTGACGAACTTTT-3', 239
D36A forward primer 5'-TTTAGCGGTAGTAGCAGCTGGAATGGGAGGTCATC- 3', reverse 240
primer 5'-GATGACCTCCCATTCCAGCTGCTACTACCGCTAAA-3' D194A forward primer 241
5'-GATCAGCTACTTCTTTGCTCTGCTGGATTATCTAACAAAGTTTCT-3', reverse primer 242
5'-AGAAACTTTGTTAGATAATCCAGCAGAGCAAAGAAGTAGCTGATC-3', D233A 243
forward primer 5'-TGATCGTGGCGGGGAAGCTAATATCACCCTTGTTC-3', reverse primer 244
5'-GAACAAGGGTGATATTGACTTCCCCGCCACGATCA-3'. Mutations were confirmed by 245
DNA sequencing. 246
247
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
12
Dephosphorylation of BA-Stk1cat. Phosphate release was measured by malachite 248
green/molybdate reactivity after dephosphorylation of recombinant BA-Stk1cat by BA-Stp1 wild 249
type or aspartic acid mutants. Enzymatic analysis of BA-Stp1 with BA-Stk1cat as substrate was 250
performed. Briefly, BA-Stk1cat concentrations ranging from 2-50 µM were used to determine the 251
initial reaction rates. The Km and Vmax values were calculated by using non-linear regression 252
analysis (Prism software). kcat (s-1
) was calculated using the formula Vmax/Et. The catalytic 253
efficiency of the reaction (s-1
mM-1
) was determined by the formula kcat / Km . 254
255
Western blot analysis of dephosphorylation of BA-Stk1cat. Dephosphorylation reactions of 2 256
µM BA-Stk1cat were initiated by the addition of equimolar amounts (5 µM) of either purified 257
BA-Stp1, D18A mutant, or a control of shrimp alkaline phosphatase (Roche) diluted in reaction 258
buffer. Reactions were incubated at 37°C and stopped at 5, 15, and 30 min with the addition of 259
4X SDS-Laemmli buffer, and boiled for 5 min. Subsequently, 10 µl of the reaction products 260
were separated on a 10% SDS-PAGE and transferred to a PVDF membrane, which was probed 261
with 1:1000 concentration of Phospho-(Ser) 14-3-3 Binding Motif Antibody (Cell Signaling). 262
The blot was then washed with TBS, 0.1% Tween-20 five times for 5 min each and incubated 263
with goat anti-rabbit IgG (H+L)-horse radish peroxidase (HRP) conjugate antibody (Bio-Rad) 264
for 1 h on a shaker at room temperature. The bands were visualized using enhanced 265
chemiluminescence (Amersham) according to manufacturer’s instructions followed by exposure 266
to film. 267
268
Dephosphorylation of autophosphorylated BA-Stk1cat. Autophosphorylation was performed 269
by addition of 1 µCi of [γ-32P] adenosine triphosphate (ATP) (Perkin Elmer) to 10 µg of purified 270
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
13
BA-Stk1cat in 100 µl kinase reaction buffer (4 mM MOPS, pH 7.2, 5 mM MnCl2, 0.05 mM DTT 271
and 10 µM ATP). The reaction was incubated at 37°C and unincorporated [γ-32P] ATP was 272
removed using a G-50 sephadex spin column (Amersham). One microgram of phosphorylated 273
BA-Stk1cat was incubated with 3 µg of purified BA-Stp1 in phosphatase reaction buffer 274
containing 50 mM Tris-HCl, pH 8.0, 5 mM MgCl2, 0.5 mM DTT. Reactions were stopped at 0, 275
30, 60, and 90 min using 4X SDS-Laemmli buffer and boiled for 5 min. Samples were resolved 276
by SDS-PAGE, and the dried gel was exposed and visualized by autoradiography. To test BA-277
Stk1 kinase activity after dephosphorylation with BA-Stp1, ATP and [γ-32P] ATP were replaced 278
by thio-γATP and [35
S]ATP-γS. 279
280
Measurement of BA-Stk1cat kinase activity in vitro. Kinase activity of 1.25 µM BA-Stk1cat 281
wild type, alanine mutants (T165A, S173A, S214A, T290A), or aspartic acid mutants (T165D, 282
S173D, S214D, T290D) was assayed in reaction buffer (4 mM MOPS, pH 7.2, 5 mM MnCl2, 283
0.05 mM DTT) with 10 µM ATP (Cell Signaling Technology). After incubating for 90 min at 284
37°C, kinase activity was assayed using the Kinase-Glo Luminescent Kinase Assay Platform 285
(Promega) and the luminescent signal was measured in a Victor 3 (Perkin Elmer) plate reader. 286
The luminescent signal inversely correlates to the amount of kinase activity. The percent relative 287
activity of BA-Stk1cat site-directed mutants was calculated as an inverse of units of 288
luminescence, compared to the wild type BA-Stk1cat. All reactions were performed in triplicate. 289
290
Measurement of myelin basic protein (MBP) phosphorylation by BA-Stk1cat in vitro. To 291
analyze the effect of alanine or aspartic acid substitutions on the kinase activity of BA-Stk1cat, 2 292
µM of purified wild type BA-Stk1cat or site-directed mutant protein was incubated with 20 µM 293
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
14
myelin Basic protein (Upstate) in kinase buffer containing 1 µCi of [γ-32P] ATP. The reactions 294
were incubated for 30 min at 37°C and stopped using 4X SDS-Laemmli buffer and boiled for 5 295
min. Samples were resolved by SDS-PAGE, the dried gel was exposed and visualized by 296
autoradiography. The level of 32
P incorporation was determined by phosphorimage analysis. 297
298
Mass spectrometric analysis of BA-Stk1cat. Mass spectrometry analysis was performed in the 299
Molecular Biology Proteomics Facility (University of Oklahoma Health Sciences Center). 300
Following SDS-PAGE and staining of autophosphorylated and dephosphorylated BA-Stk1cat, 301
protein bands were excised and then digested with trypsin within the gel utilizing the Pierce in-302
gel tryptic digestion kit and then extracted from the 1.0 % trifluoroacetic acid/water and 303
combined with the digestion solution. The samples were subjected to LC/MS and LC/MS/MS on 304
a Dionex Ultimate 3000 nanoscale HPLC connected to an Applied Biosystems QSTAR Elite 305
mass spectrometer operated in the positive ion mode at a voltage of 2.3 KV. The peptide 306
separation was performed on a PepMap C18 column (75 micron ID x 150 mm length, packed 307
with 3 micron particles) at a flow rate of 250 nanoliters/min. For LC/MS/MS, data was collected 308
in the Information Dependent Acquisition mode over a mass range of 300-2000 m/z. Peptides 309
with a +2 to +5 charge status were selected for MS/MS fragmentation. A survey scan in the MS 310
mode was performed, followed by MS/MS fragmentations of the three most abundant ions in the 311
mass range of 300-1400 m/z for five seconds for each ion selected. The MS/MS data was 312
collected over a mass range of 50 to 2400 m/z. The MS data file was used to search the NCBI 313
non-redundant protein database (release 02/16/2007) utilizing the MASCOT search engine 314
(software version 2.2), both of which are installed on an on-site MASCOT server. The search 315
parameters consisted of the database search of all Eubacteria, Firmicutes with trypsin selected as 316
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
15
the enzyme, allowing one missed cleavage. Fixed modifications were set to 317
carboxamidomethylation of cysteine residues, while oxidation of methionine, deamidation of 318
Asn/Gln and phosphorylation of serine and threonine were chosen for variable modifications. 319
Protein identifications were made based upon MASCOT Mowse scores greater than the 320
significance threshold value at p < 0.05. The elution point and relative ionization intensity of 321
phosphorylated peptides and their non-phosphorylated versions were determined by LC/MS 322
analysis over a mass range of 300- 2000 m/z. The differentially phosphorylated versions were 323
observed by plotting the extracted-ion current for each peptide utilizing a 1.0 amu window 324
spanning the three most abundant isotopic forms of +3 charged peptide. 325
326
RESULTS 327
Identification and characterization of a serine/threonine phosphatase-kinase pair in B. 328
anthracis. A search of the B. anthracis Sterne genome revealed putative orthologs of eukaryotic 329
STKs and phosphatases. In all, four putative STKs and six putative serine/threonine 330
phosphatases (STPs) were identified. Of particular interest to our studies was a pair of ORFs 331
juxtaposed at the 3’ end of a putative operon, as this was the only closely related STP/STK pair 332
identified in B. anthracis. The STP (termed BA-Stp1) and STK (termed BA-Stk1) are encoded 333
by BAS3714 and BAS3713 (GenBank accession numbers AAT56015 and AAT56016) 334
respectively. No other closely associated STP/STK pair was identified within the genome of B. 335
anthracis. 336
337
To characterize BA-Stp1/BA-Stk1 in B. anthracis Sterne, a double mutant (∆stp1/∆stk1) was 338
constructed by allelic replacement using a Ω kanr cassette consisting of the apha3 gene 339
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
16
conferring kanamycin resistance and the mutant was termed B. anthracis STPK101. In vitro 340
analysis of B. anthracis STPK101 found that the mutant grew in liquid medium, sporulated, and 341
germinated with efficiency similar to the parent strain (data not shown). Thus, we next 342
determined whether the virulence of B. anthracis STPK101 was similar to parent strain. 343
344
Macrophages are considered the primary site of B. anthracis spore germination following 345
infection (13), hence B. anthracis STPK101 was assessed for growth and survival in these cells. 346
When RAW 264.7 macrophage-like cells were infected with spores of the parent B. anthracis 347
Sterne strain or B. anthracis STPK101, the total number of colony forming units of B. anthracis 348
STPK101 recovered at 10 h post-infection were significantly reduced compared to the parent 349
strain (Fig. 1A). A comparison between STPK101 and the parent strain found no differences in 350
the rate of growth in tissue culture medium alone (data not shown), suggesting that the observed 351
defect was due to attenuated germination, growth, or survival of the mutant within the 352
macrophage. 353
354
Next, to assess the importance of the phosphatase-kinase pair in virulence of B. anthracis, the 355
50% lethal dose (LD50) of the parent B. anthracis Sterne strain and B. anthracis STPK101 was 356
compared using a mouse model of pulmonary anthrax. As shown in Fig. 1B and Fig. 1C, the 357
LD50 of B. anthracis STPK101 (4.5 x 105
spores) was 10-fold higher than the LD50 of the B. 358
anthracis parent strain (4.5 x 104 spores). Collectively, these data indicate that the phosphatase-359
kinase pair contributes to the survival of B. anthracis during infection of cultured macrophages 360
and following infection in a mouse model of pulmonary anthrax. 361
362
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
17
Characterization of BA-Stp1. Because BA-Stp1 and BA-Stk1 appeared to be important in B. 363
anthracis virulence, we began to analyze these proteins in more detail. We predicted that BA-364
Stp1 could dephosphorylate BA-Stk1, which made it critical to first establish that BA-Stp1 is 365
indeed a phosphatase. Experiments using p-nitrophenyl phosphate (p-NPP) as synthetic 366
substrate found that BA-Stp1 exhibits phosphatase activity and requires divalent metal ions, 367
Mn2+
or Mg2+
, to hydrolyze p-NPP (data not shown). Such a dependence on divalent cations 368
suggested that BA-Stp1 could be a PP2C family phosphatase (1, 3, 5). This was confirmed by 369
further biochemical analysis which revealed that BA-Stp1 is inactivated by non-specific 370
inhibitors such as sodium pyrophosphate, but is unaffected by specific PPP and PP2B 371
phosphatase inhibitors such as okadaic acid and calyculin A (data not shown). 372
373
Next, we performed experiments designed to identify the types of residues dephosphorylated by 374
BA-Stp1. Synthetic phosphopeptides with phosphate groups at threonine (RRApTVA), serine 375
(RRApSVA), or tyrosine (RRLIEDAEpYAARG) residues were used as substrates in a 376
malachite-green phosphate detection assay. Phosphate release increased when phosphothreonine 377
or phosphoserine peptides were used as substrates, but not with the phosphotyrosine peptide 378
(Fig. 2A). Using these synthetic substrates, we also determined the kinetic parameters of the 379
dephosphorylation reaction. The Vmax and Km values for the phosphothreonine peptide were 380
calculated to be 115.3 pmole min-1
µg-1
and 121.5 µM respectively. Similarly, the Vmax and Km 381
values for the phosphoserine peptide were found to be 172.7 pmole min-1
µg-1
and 248.6 µM 382
respectively. The Km value of BA-Stp1 for the phosphotyrosine peptide was above the range for 383
accurate determination (data not shown), which is consistent with low levels of Pi detected in the 384
phosphate release assay. 385
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
18
386
Examination of BA-Stp1 identified residues (D18, D36, D194, and D233) which corresponded to 387
metal-complexed sites in human PP2Cα, leading us to predict that BA-Stp1 might share a 388
common enzymatic mechanism with human PP2Cα (8, 16). To address this possibility, single 389
aspartic acid mutants D18A, D36A, D194A, and D233A were generated in BA-Stp1 and each 390
mutant was assayed for phosphatase activity using RRApSVA or RRApTVA as substrates. 391
As shown in Fig. 2B, substituting alanine for these critical aspartic acid residues eliminated 392
phosphatase activity of BA-Stp1, supporting our prediction that BA-Stp1 is similar 393
mechanistically to the human PP2Cα. 394
395
BA-Stk1 is a substrate of BA-Stp1. Having confirmed that BA-Stp1 is a phosphatase we next 396
sought to determine the interaction of this phosphatase with BA-Stk1. To test whether BA-Stp1 397
dephosphorylates phospho-residues on BA-Stk1, the catalytic domain of BA-Stk1, termed BA-398
Stk1cat was cloned, expressed, and purified from E. coli. Western blot analysis with antibodies to 399
phosphoserine and phosphothreonine residues demonstrated that BA-Stk1cat was 400
autophosphorylated (data not shown), which is similar to previous findings on B. subtilis PrkC 401
(21, 22). Phosphorylated BA-Stk1cat was then used as a substrate for BA-Stp1. As shown in Fig. 402
3A, when BA-Stk1cat was added to the reaction there was an increase in detectable levels of 403
phosphate relative to the negative control, suggesting that BA-Stp1 hydrolyzes the phosphate 404
groups on BA-Stk1cat. Kinetic analysis of dephosphorylation of BA-Stk1cat suggested that BA-405
Stp1 dephosphorylates phospho-residues on BA-Stk1cat with a high affinity (Km 9.65 µM) and a 406
catalytic efficiency, kcat/Km of 113.9 s-1
mM-1
. Moreover, phosphate release was significantly 407
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
19
reduced when each of the aspartic acid mutants, D18A, D36A, D194A, or D233A was 408
substituted for wild type BA-Stp1 in the reaction (Fig. 3B). 409
410
BA-Stp1 inactivates BA-Stk1. Because BA-Stk1cat was isolated from E. coli in a recombinant 411
form, it was necessary to show that the residues dephosphorylated by BA-Stp1 arose from 412
autophosphorylation and not through cross-phosphorylation by E. coli kinases during isolation of 413
the protein. To accomplish this we incubated BA-Stk1cat with [γ-32P] ATP thereby allowing the 414
predicted autophosphorylation to occur. The 32
P labeled BA-Stk1cat was then incubated with BA-415
Stp1, or buffer control, and the level of incorporated 32
P was determined by autoradiography. As 416
shown in Fig. 3C, when labeled BA-Stk1cat was incubated with BA-Stp1 there was a precipitous 417
decrease in the level of detectable phosphorylated kinase. Within 30 min following the 418
incubation start there was a greater than 90% reduction in the level of detectable phosphorylated 419
kinase indicating that BA-Stp1 dephosphorylates autophosphorylated BA-Stk1. 420
421
To confirm our prediction that BA-Stk1cat serine residues were dephosphorylated by BA-Stp1, 422
we examined the dephosphorylated kinase using anti-phosphoserine antibodies (Fig. 4A). As 423
shown in the immunoblot, upon incubation with shrimp alkaline phosphatase, there was no 424
detectable decrease in the phosphoserine signal. However, when BA-Stp1 was added to BA-425
Stk1cat, a precipitous reduction in levels of phosphoserine was observed. Prolonged incubation 426
(30 min) resulted in hydrolysis of the phosphate group from serine residues on BA-Stk1cat to 427
levels that were no longer detectable by the anti-phosphoserine antibodies. Finally, when a 428
similar analysis was performed using an inactive phosphatase mutant, BA-Stp1D18A there was no 429
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
20
detectable change in the level of phosphorylated BA-Stk1cat; further suggesting this reaction 430
requires catalytically active phosphatase. 431
432
Previous work by Madec et al. demonstrated that autophosphorylation is critical to the kinase 433
activity of B. subtilis PrkC (22), suggesting that BA-Stp1-mediated dephosphorylation could 434
alter the kinase activity of BA-Stk1. Hence, we next analyzed the impact of BA-Stp1 435
dephosphorylation on the kinase activity of BA-Stk1. To accomplish this, his-tagged BA-Stk1cat 436
was incubated with recombinant BA-Stp1, or BA-Stp1D36A, both of which had the his-tags 437
removed. This approach was taken in order to separate BA-Stk1cat and BA-Stp1 prior to 438
performing the kinase assay. After separating the two proteins using nickel-affinity 439
chromatography, BA-Stk1cat was incubated with [γ-32P] ATP and levels of autophosphorylated 440
kinase were determined across a time-course. As shown in Fig. 4B, pretreatment of the kinase 441
with BA-Stp1 resulted in a reduction in the amount of 32
P incorporated during 442
autophosphorylation. In contrast, pretreatment of BA-Stk1cat with the inactive phosphatase 443
mutant, BA-Stp1D36A, did not alter levels of kinase activity. 444
Because it was difficult to absolutely exclude the effects of trace amounts of phosphatase in 445
these experiments a second experimental approach was utilized to confirm that 446
dephosphorylation reduced the kinase activity of BA-Stk1. After pretreatment of BA-Stk1 with 447
BA-Stp1, BA-Stk1 autophosphorylation and kinase activity was measured using thio-γATP 448
instead of ATP. The rational for this approach was that thiophosphorylated substrates are 449
resistant to dephosphorylation by protein phosphatases (4, 19). BA-Stk1 was pre-incubated with 450
BA-Stp1 for 30 min and the kinase activity was then measured in a time course using [35
S] ATP-451
γS and myelin basic protein as substrates. As shown in Fig. 4C, pretreatment of BA-Stk1 with 452
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
21
BA-Stp1 reduced its autophosphorylation and kinase activity towards myelin basic protein. 453
Collectively, these data suggest that phosphorylation of BA-Stk1cat renders it active and that BA-454
Stp1 modulates this activity by dephosphorylation. 455
456
Identification of autophosphorylated residues on BA-Stk1. Phosphorylation and 457
dephosphorylation appeared to be important for regulating the kinase activity of BA-Stk1cat, and 458
this heightened our interest in identifying residues phosphorylated in BA-Stk1cat. Indeed, we 459
predicted that such residues are involved in important aspects of BA-Stk1’s enzymatic activity 460
and might be subjected to regulation via BA-Stp1 dephosphorylation. Thus, in the next series of 461
experiments we mapped phosphorylated regions in BA-Stk1. Autophosphorylated BA-Stk1cat 462
was excised from an SDS-PAGE gel, trypsin digested, and the phosphopeptides were isolated 463
using immobilized gallium. The enriched phosphopeptide pool was then subjected to 464
LC/MS/MS analysis. The MS/MS spectra identified four phosphorylated peptides of BA-Stk1cat 465
based on sequences from the NCBI non-redundant protein database bank (Table 1). Of these 466
peptides BA-Stk1cat (150-183) with the sequence, 467
VTDFGIATATSATTITHTNSVLGSVHYLSPEQAR was predicted to have a cluster of seven 468
phospho-residues. When BA-Stk1cat was subjected to dephosphorylation by BA-Stp1, we 469
observed a loss in the level of phosphorylated amino acids within this peptide fragment, 470
indicating that BA-Stp1 hydrolyzes phosphate groups of this phosphopeptide (data not shown). 471
A similar observation was made on the peptide BA-Stk1cat (208-221) with the sequence, 472
QPFSGESAVAIALK, indicating that serine residues on this peptide are dephosphorylated by 473
BA-Stp1. Similar peptides were found by Madec et al. to be phosphorylated in PrkC (22), 474
suggesting PrkC and BA-Stk1 share autophosphorylation domains. 475
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
22
476
Kinase activity of serine/threonine mutants of BA-Stk1cat. Madec et al. performed an 477
extensive mutational analysis of candidate phosphorylated residues in the activation loop of 478
PrkC, by substituting alanine for threonines and serines in this domain of the kinase. PrkC 479
mutants that could no longer phosphorylate substrates were then identified (22). Yet, whether 480
these mutants were defective in ATP hydrolysis and autophosphorylation, or whether sustained 481
phosphorylation of these residues influenced activity was not determined. Moreover, whether 482
BA-Stk1 utilized similar residues for autophosphorylation was not known. Thus, we examined 483
representative serine/threonine residues for their contribution to regulation of BA-Stk1cat activity. 484
The first two residues T165 and S173 were selected as representatives of targets phosphorylated 485
within the activation loop (T165) or outside the activation loop (S173) of the enzymatic domain 486
of BA-Stk1cat. S214 was selected from the identified phosphopeptide BA-Stk1cat (208-221). 487
Finally, T290 was selected as a representative of targets phosphorylated in the juxtamembrane 488
region of BA-Stk1 (spanning 55 residues) that is implicated in the regulation of eukaryotic 489
kinases (34). Alanine substitutions of these residues in BA-Stk1cat were made and the impact of 490
these mutations on kinase activity and autophosphorylation was determined. Kinase activity of 491
the mutants was measured in terms of ATP hydrolysis by analyzing the consumption of ATP in a 492
luminescence-based assay. As shown in Fig. 5A, kinase activity of mutants S173A and S214A is 493
reduced compared to wild type BA-Stk1cat, suggesting that phosphorylation at residues, S173 and 494
S214 is important for BA-Stk1cat kinase activity. Mutants T165A and T290A, however, did not 495
show reduced kinase activity as levels of ATP hydrolysis were comparable to wild type BA-496
Stk1cat. 497
498
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
23
To further test the importance of phosphorylation on these residues, aspartic acid substitutions 499
were used to mimic a phosphorylated state of BA-Stk1 and the mutated proteins were tested for 500
kinase activity by measuring levels of ATP hydrolysis. As shown in Fig. 5B, the kinase activity 501
of S173D and S214D was similar to wild type BA-Stk1cat suggesting that the phosphorylated 502
state of residues S173 and S214 is critical for kinase activity. 503
504
To confirm the role of these residues in the BA-Stk1 kinase activity, both alanine and aspartic 505
acid mutants of T165, S173, S214, and T290 were analyzed in a myelin basic protein (MBP) 506
phosphorylation assay using radiolabeled ATP. Analysis of autophosphorylation activity of the 507
BA-Stk1 mutants demonstrated that the mutants undergo autophosphorylation to levels slightly 508
reduced or similar to wild type BA-Stk1cat (Fig. 5C). However, comparison of MBP 509
phosphorylation by the mutants and wild type BA-Stk1cat shows that kinase activity of both 510
alanine and aspartic acid mutants of T165 and S173 is significantly reduced (Fig. 5C). 511
Calculation of the percent phosphorylation of MBP shows that mutants of T165 and S173 exhibit 512
only 20% and <2% phosphorylation, respectively, compared to wild type BA-Stk1cat (Fig. 5D). 513
These results suggest that the presence of the phosphate moiety on these residues is required for 514
binding and/or phosphorylation of substrates. Though T165A and T165D had no detectable 515
defect in ATP hydrolysis as demonstrated in Fig. 5A and Fig. 5B, both mutants were attenuated 516
in substrate phosphorylation (Fig. 5C and Fig. 5D). More importantly, the native phosphoserine 517
at position 173 is essential for both ATP hydrolysis (Fig. 5A) and for substrate phosphorylation 518
(Fig. 5C and Fig. 5D). 519
520
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
24
Analysis of MBP phosphorylation by mutant S214A also shows reduced activity; however, this 521
defect is rescued by the aspartic acid substitution on the same site (Fig. 5D) suggesting that the 522
phosphorylation state of residue S214 is important not only for hydrolysis of ATP (Fig. 5A) but 523
for phosphorylation of substrates as well (Fig. 5D). Though residue T290 was predicted as being 524
phosphorylated in kinases homologous to BA-Stk1, alanine or aspartic acid substitutions at this 525
site had no apparent effect on autophosphorylation or substrate phosphorylation (Fig. 5D). 526
527
DISCUSSION 528
The current findings provide insight into a paired serine/threonine phosphatase and kinase in B. 529
anthracis. Several recent studies have shown that Stp/Stk pairs contribute to bacterial virulence 530
and physiology but the underlying molecular mechanisms and how these proteins are regulated 531
remains poorly understood. To this end, the data provided herein addresses important gaps in our 532
understanding of how the activity of a bacterial Stk is regulated by a partner phosphatase through 533
dephosphorylation. The results of this study indicate that BA-Stp1 regulation of BA-Stk1 is a 534
complex system of multiple residues targeted for dephosphorylation, with some phospho-535
residues important only for autophosphorylation, while other residues are necessary for both 536
ATP hydrolysis and substrate phosphorylation. 537
538
Analysis of the enzyme kinetic parameters (Km and Vmax) indicated that BA-Stp1 539
dephosphorylates phosphothreonine and phosphoserine residues with Km values similar to those 540
reported for phosphatases, such as PphA from Synechocystis PPC 6803(30), and PrpZ from S. 541
enterica (18). Thus, these biochemical and enzymatic characterizations of BA-Stp1 all 542
correspond to the expected activities of a PP2C phosphatase. The data shown in Fig. 3 indicate 543
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
25
that BA-Stp1 utilizes this PP2C phosphatase activity to modulate BA-Stk1, wherein 544
dephosphorylation leads to a decline in kinase activity. Importantly, this reaction appears to be 545
more specific as BA-Stp1 exhibited a higher affinity, Km 9.65 µM vs 248.6 µM, towards BA-546
Stk1 compared to generic substrates. 547
548
A graphical summary of our data is presented in Fig. 6. Unlike histidine kinases whose 549
phosphorylation status can either turn on/off a single phosphotransferase mechanism, BA-Stk1 550
exhibits a complex assembly of critical autophosphorylated residues, some of which contribute 551
to ATP hydrolysis and autophosphorylation, and others that contribute only to substrate 552
phosphorylation. For example, in the absence of phosphorylation of S173 and S214, substrate 553
phosphorylation is attenuated but autophosphorylation increases. The phosphorylation of S173 554
and S214 may, therefore, shift the kinase from an autophosphorylating state to substrate 555
phosphorylation. While it is difficult to absolutely exclude the influence of subtle conformational 556
changes occurring from the alanine substitution, the aspartic acid substitutions further support 557
the idea that the balance between these two biochemical activities is influenced by the 558
phosphorylation of these residues. Indeed, when phosphorylation is simulated at S214 by 559
aspartic acid substitution, autophosphorylation is reduced, and substrate phosphorylation is 560
enhanced. In a corresponding manner, when the residue can not be phosphorylated due to an 561
alanine substitution, Stk1 increases autophosphorylation and decreases substrate 562
phosphorylation. Conversely, mimicking phosphorylation of S173 by aspartic acid substitution 563
reduced autophosphorylation and substrate phosphorylation, indicating the addition of a 564
phosphate group to this residue has an overall negative effect on kinase activity. Finally, aspartic 565
acid substitution at T165 slightly increased autophosphorylation, suggesting that phosphorylation 566
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
26
of this residue enhances kinase activity. We predict that T165 is one of the key residues 567
dephosphorylated by BA-Stp1 leading to down regulation of kinase activity and that the presence 568
of the threonine at position 165 is necessary to allow for binding and/or phosphorylation of target 569
substrates. Collectively, we observed that phosphorylation of some residues in BA-Stk1 promote 570
kinase activity, while phosphorylation of other residues represses kinase activity. These results 571
reveal a sophisticated mechanism of control for BA-Stk1 kinase activity, wherein a network of 572
phosphorylated residues are altered to either activate or inactivate the enzymatic activity of this 573
signaling protein in B. anthracis. 574
575
A comparison of our findings on Ba-Stp1 relative to B. subtilis PrpC is instructive. Like Ba-576
Stp1, PrpC is believed to be functionally coupled with its partner kinase, PrkC. Moreover, PrpC 577
was found to dephosphorylate PrkC in earlier work by Obuchowski and colleagues (27) and this 578
is similar to our current results on Ba-Stp1 dephosphorylation of Ba-Stk1. However, the impact 579
of dephosphorylation on kinase activity has not been determined for the PrpC/PrkC pair. 580
PrpC/PrkC also differs from BA-Stp1/BA-Stk1 in that the phosphatase/kinase pair appears to 581
regulate late-stationary growth phase events (e.g. sporulation and biofilm formation) in B. 582
subtilis, an effect we did not observe in B. anthracis. Despite several attempts, we could not 583
detect or demonstrate any difference in sporulation efficiency between the parent B. anthracis 584
Sterne strain and B. anthracis STPK101 (data not shown). In fact extensive analysis of B. 585
anthracis STPK101 did not find any notable growth defect under in vitro conditions, and a 586
prominent phenotype only became apparent when infection models were used. These data 587
suggest BA-Stp1/BA-Stk1 may have been refined by B. anthracis for growth and virulence in 588
vivo, while PrpC/PrkC have evolved to regulate events more important to survival of B. subtilis 589
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
27
in the environment. Very recently, Shah et al. (33) reported a role for B. subtilis PrkC in sensing 590
muropeptides released during germination, and B. anthracis was among the list of other bacteria 591
for which this group defined this system. The study by Shah et al. found that null mutants 592
lacking the gene for PrkC and BA-Stk1 were unable to sense muropeptide and peptidoglycan as 593
a germinant. Thus, although we did not observe a defect in germination of the mutant in vitro, it 594
is reasonable to suspect that the attenuation of virulence could be due to defects in the ability of 595
B. anthracis to regulate peptidoglycan-related germination during the establishment of disease. 596
597
Our findings report the importance of a critical serine/threonine phosphatase-kinase pair in the 598
virulence of B. anthracis and highlight a mechanism by which a bacterial phosphatase modulates 599
the activity of its partner kinase at the molecular level. We hypothesize that BA-Stk1 acts as a 600
sensor for regulating virulence in response to stimuli and does so by autophosphorylation, and as 601
the stimuli subsides BA-Stp1 serves to inactive the kinase by dephosphorylation. Further studies 602
on the phosphatase-kinase association between BA-Stp1 and BA-Stk1 will provide new insights 603
into identification of novel target substrates and the importance of reversible phosphorylation as 604
a regulatory mechanism in B. anthracis. 605
606
Acknowledgements 607
We thank Dr. Ken Jackson and Stephen Snow at the Molecular Biology-Proteomics Facility 608
(OUHSC) for their help with the mass spectrometric analysis of BA-Stk1. This work was 609
supported by Public Health Service grant U54A1057156, Western Region Center for Biodefense 610
and Emerging Infectious Diseases (J.D.B. and C.R.L.) 611
612
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
28
Reference 613
614
1. Adler, E., A. Donella-Deana, F. Arigoni, L. A. Pinna, and P. Stragler. 1997. 615
Structural relationship between a bacterial developmental protein and eukaryotic PP2C 616
protein phosphatases. Mol Microbiol 23:57-62. 617
2. Archambaud, C., E. Gouin, J. Pizarro-Cerda, P. Cossart, and O. Dussurget. 2005. 618
Translation elongation factor EF-Tu is a target for Stp, a serine-threonine phosphatase 619
involved in virulence of Listeria monocytogenes. Molecular Microbiology 56:383-396. 620
3. Barford, D. 1996. Molecular mechanisms of the protein serine/threonine phosphatases. 621
Trends in Biochemical Sciences 21:407-412. 622
4. Boitel, B., M. Ortiz-Lombardia, R. Duran, F. Pompeo, S. T. Cole, C. Cervenansky, 623
and P. M. Alzari. 2003. PknB kinase activity is regulated by phosphorylation in two Thr 624
residues and dephosphorylation by PstP, the cognate phospho-Ser/Thr phosphatase, in 625
Mycobacterium tuberculosis. Molecular Microbiology 49:1493-1508. 626
5. Bork, P., N. P. Brown, H. Hegyi, and J. Schultz. 1996. The protein phosphatase 2C 627
(PP2C) superfamily: detection of bacterial homologues. Protein Sci 5:1421-5. 628
6. Cataldi, A., E. Labruyere, and M. Mock. 1990. Construction and characterization of a 629
protective antigen-deficient Bacillus anthracis strain. Mol Microbiol 4:1111-7. 630
7. Cozzone, A. J. 2005. Role of Protein Phosphorylation on Serine/Threonine and Tyrosine 631
in the Virulence of Bacterial Pathogens. Journal of Molecular Microbiology and 632
Biotechnology 9:198-213. 633
8. Das, A. K., N. R. Helps, P. T. Cohen, and D. Barford. 1996. Crystal structure of the 634
protein serine/threonine phosphatase 2C at 2.0 A resolution. Embo J 15:6798-809. 635
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
29
9. Debarbouille, M., S. Dramsi, O. Dussurget, M.-A. Nahori, E. Vaganay, G. Jouvion, 636
A. Cozzone, T. Msadek, and B. Duclos. 2009. Characterization of a Serine/Threonine 637
Kinase Involved in Virulence of Staphylococcus aureus. J. Bacteriol. 191:4070-4081. 638
10. Ekman, P., and O. Jäger. 1993. Quantification of subnanomolar amounts of phosphate 639
bound to seryl and threonyl residues in phosphoproteins using alkaline hydrolysis and 640
malachite green. Anal Biochem 214:138-141. 641
11. Fernandez, P., B. Saint-Joanis, N. Barilone, M. Jackson, B. Gicquel, S. T. Cole, and 642
P. M. Alzari. 2006. The Ser/Thr protein kinase PknB is essential for sustaining 643
mycobacterial growth. J Bacteriol 188:7778-84. 644
12. Gaidenko, T. A., T.-J. Kim, and C. W. Price. 2002. The PrpC Serine-Threonine 645
Phosphatase and PrkC Kinase Have Opposing Physiological Roles in Stationary-Phase 646
Bacillus subtilis Cells. J. Bacteriol 184:6109-6114. 647
13. Guidi-Rontani Chantal , Weber-Levy Martine , Labruyere Elisabeth , and M. 648
Michele. 1999. Germination of Bacillus anthracis spores within alveolar macrophages. 649
Molecular Microbiology 31:9-17. 650
14. Hunter, T. 1995. Protein kinases and phosphatases: The Yin and Yang of protein 651
phosphorylation and signaling. Cell 80:225-236. 652
15. Inouye, S., R. Jain, T. Ueki, H. Nariya, C. Y. Xu, M. Y. Hsu, B. A. Fernandez-653
Luque, J. Munoz-Dorado, E. Farez-Vidal, and M. Inouye. 2000. A large family of 654
eukaryotic-like protein Ser/Thr kinases of Myxococcus xanthus, a developmental 655
bacterium. Microb Comp Genomics 5:103-20. 656
16. Jackson, M. D., C. Ç. Fjeld, and J. M. Denu. 2003. Probing the function of conserved 657
residues in the serine/threonine phosphatase PP2Cα Biochemistry 42:8513-8521. 658
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
30
17. Jin, H., and V. Pancholi. 2006. Identification and Biochemical Characterization of a 659
Eukaryotic-type Serine/Threonine Kinase and its Cognate Phosphatase in Streptococcus 660
pyogenes: Their Biological Functions and Substrate Identification. Journal of Molecular 661
Biology 357:1351-1372. 662
18. Lai, S. M., and H. Le Moual. 2005. PrpZ, a Salmonella enterica serovar Typhi 663
serine/threonine protein phosphatase 2C with dual substrate specificity. Microbiology 664
151:1159-67. 665
19. Li, H., P. Simonelli, and L. Huan. 1988. Preparation of protein phosphatase-resistant 666
substrates using adenosine 5'-O-(gamma-thio)triphosphate. Methods in Enzymology 667
159:346-56. 668
20. Lyons, C. R., J. Lovchik, J. Hutt, M. F. Lipscomb, E. Wang, S. Heninger, L. Berliba, 669
and K. Garrison. 2004. Murine Model of Pulmonary Anthrax: Kinetics of 670
Dissemination, Histopathology, and Mouse Strain Susceptibility. Infect. Immun. 671
72:4801-4809. 672
21. Madec, E., A. Laszkiewicz, A. Iwanicki, M. Obuchowski, and S. Seror. 2002. 673
Characterization of a membrane-linked Ser/Thr protein kinase in Bacillus subtilis, 674
implicated in developmental processes. Mol Microbiol 46:571-86. 675
22. Madec, E., A. Stensballe, S. Kjellstrom, L. Cladiere, M. Obuchowski, O. N. Jensen, 676
and S. J. Seror. 2003. Mass Spectrometry and Site-directed Mutagenesis Identify 677
Several Autophosphorylated Residues Required for the Activity of PrkC, a Ser/Thr 678
Kinase from Bacillus subtilis. Journal of Molecular Biology 330:459-472. 679
23. McKevitt, M. T., K. M. Bryant, S. M. Shakir, J. L. Larabee, S. R. Blanke, J. 680
Lovchik, C. R. Lyons, and J. D. Ballard. 2007. Effects of Endogenous D-Alanine 681
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
31
Synthesis and Autoinhibition of Bacillus anthracis Germination on In Vitro and In Vivo 682
Infections. Infect. Immun. 75:5726-5734. 683
24. Mukhopadhyay, S., V. Kapatral, W. Xu, and A. M. Chakrabarty. 1999. 684
Characterization of a Hank's type serine/threonine kinase and serine/threonine 685
phosphoprotein phosphatase in Pseudomonas aeruginosa. J Bacteriol 181:6615-22. 686
25. Mumby, M. C., and G. Walter. 1993. Protein serine/threonine phosphatases: structure, 687
regulation, and functions in cell growth. Physiol Rev 73:673-99. 688
26. Novakova, L., L. Saskova, P. Pallova, J. Janecek, J. Novotna, A. Ulrych, J. 689
Echenique, M. C. Trombe, and P. Branny. 2005. Characterization of a eukaryotic type 690
serine/threonine protein kinase and protein phosphatase of Streptococcus pneumoniae 691
and identification of kinase substrates. Febs J 272:1243-54. 692
27. Obuchowski, M., E. Madec, D. Delattre, G. Boel, A. Iwanicki, D. Foulger, and S. J. 693
Seror. 2000. Characterization of PrpC from Bacillus subtilis, a member of the PPM 694
phosphatase family. J Bacteriol 182:5634-8. 695
28. Rajagopal, L., A. Clancy, and C. E. Rubens. 2003. A Eukaryotic Type 696
Serine/Threonine Kinase and Phosphatase in Streptococcus agalactiae Reversibly 697
Phosphorylate an Inorganic Pyrophosphatase and Affect Growth, Cell Segregation, and 698
Virulence. J. Biol. Chem. 278:14429-14441. 699
29. Reed, L. J., and H. Muench. 1938. A Simple Method Of Estimating Fifty Per Cent 700
Endpoints. Am. J. Epidemiol. 27:493-497. 701
30. Ruppert, U., A. Irmler, N. Kloft, and K. Forchhammer. 2002. The novel protein 702
phosphatase PphA from Synechocystis PCC 6803 controls dephosphorylation of the 703
signalling protein PII. Mol Microbiol 44:855-64. 704
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
32
31. Saile, E., and T. M. Koehler. 2006. Bacillus anthracis Multiplication, Persistence, and 705
Genetic Exchange in the Rhizosphere of Grass Plants Appl. Environ. Microbiol. 72:3168-706
3174. 707
32. Scaramozzino, F., A. White, M. Perego, and J. A. Hoch. 2009. A Unique GTP-708
Dependent Sporulation Sensor Histidine Kinase in Bacillus anthracis. J. Bacteriol 709
191:687-692. 710
33. Shah, I. M., M.-H. Laaberki, D. L. Popham, and J. Dworkin. 2008. A Eukaryotic-like 711
Ser/Thr Kinase Signals Bacteria to Exit Dormancy in Response to Peptidoglycan 712
Fragments. Cell 135:486-496. 713
34. Thiel, K. W., and G. Carpenter. 2007. Epidermal growth factor receptor 714
juxtamembrane region regulates allosteric tyrosine kinase activation. Proceedings of the 715
National Academy of Sciences 104:19238-19243. 716
35. Treuner-Lange, A., M. J. Ward, and D. R. Zusman. 2001. Pph1 from Myxococcus 717
xanthus is a protein phosphatase involved in vegetative growth and development. Mol 718
Microbiol 40:126-40. 719
36. Vetter, S. M., and P. M. Schlievert. 2007. The Two-Component System Bacillus 720
Respiratory Response A and B (BrrA-BrrB) Is a Virulence Factor Regulator in Bacillus 721
anthracis. Biochemistry 46:7343-7352. 722
37. White, A. K., J. A. Hoch, M. Grynberg, A. Godzik, and M. Perego. 2006. Sensor 723
Domains Encoded in Bacillus anthracis Virulence Plasmids Prevent Sporulation by 724
Hijacking a Sporulation Sensor Histidine Kinase. J. Bacteriol. 188:6354-6360. 725
38. Wiley, D. J., R. Nordfeldth, J. Rosenzweig, C. J. DaFonseca, R. Gustin, H. Wolf-726
Watz, and K. Schesser. 2006. The Ser/Thr kinase activity of the Yersinia protein kinase 727
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
33
A (YpkA) is necessary for full virulence in the mouse, mollifying phagocytes, and 728
disrupting the eukaryotic cytoskeleton. Microb Pathog 40:234-43. 729
39. Young, T. A., B. Delagoutte, J. A. Endrizzi, A. M. Falick, and T. Alber. 2003. 730
Structure of Mycobacterium tuberculosis PknB supports a universal activation 731
mechanism for Ser/Thr protein kinases. Nat Struct Mol Biol 10:168-174. 732
40. Zhou, H., J. D. Watts, and R. Aebersold. 2001. A systematic approach to the analysis 733
of protein phosphorylation. Nat Biotech 19:375-378. 734
735
736
737
738
739
740
741
742
743
744
745
746
747
748
749
750
751
752
753
754
755
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
34
Table 1. Phosphopeptides of BA-Stk1cat identified by Mass spectrometry 756
Peptide name Peptide Sequence
Stk1:45-55 DY[pS]NNEEFIKR
Stk1:150-183 VTDFGIA[pT][pT][pS]A[pT][pT]I[pT]H[pT]NSVLGSVHYLSPEQA
R
Stk1:208-221 QPFSGE[pS]AVAIALK
Stk1:264-273 DIE[pT]ALYPER
757
Phosphopeptides identified in autophosphorylated Ba-Stk1 by LC-MS/MS analysis of tryptic 758
digests. Residues in parentheses were identified as predicted phosphorylation sites based on a 759
search of the NCBI non-redundant protein database search of all Eubacteria, Firmicutes group. 760
761
762
763
764
765
766
767
768
769
770
771
772
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
35
773
Figure Legends: 774
775
Figure 1. Analysis of survival and virulence of B. anthracis Sterne STPK101. Panel A: 776
Survival of B. anthracis Sterne STPK101 in cultured macrophage-like cells. RAW 264.7 777
macrophages were infected with spores at a MOI of 10 as described in materials and methods. At 778
0, 2, 6, 8, and 10 h post infection, spores and vegetative bacilli were collected and the total 779
number of colony forming units were enumerated by plate count method for parent strain (black 780
bars) and B. anthracis Sterne STPK101 (white bars). Statistical analysis was performed using 781
unpaired two-tailed Student’s T test (P value 0.0173). Panel B and C: Virulence of B. anthracis 782
Sterne STPK101 in a mouse model of pulmonary anthrax. Kaplan-Meier survival curves of 783
DBA/2 mice treated with the parent strain B. anthracis Sterne (panel B) and B. anthracis Sterne 784
STPK101 (panel C). DBA/2 mice, 10/group, were subjected to an intra-tracheal challenge of 785
either 1x104, 1x10
5, or 1x10
6 spores of either the parent strain B. anthracis Sterne or B. anthracis 786
Sterne STPK101. Mice were observed for 14 days following challenge and the LD50 was 787
calculated using the Reed and Muench method (29) (inset within the panel). 788
789
Figure 2. Biochemical analysis of BA-Stp1. The biochemical characteristics of BA-Stp1 were 790
determined by examining the dephosphorylation of synthetic peptides with phosphate groups on 791
serine, threonine, or tyrosine residues. These activities were then compared with BA-Stp1 792
mutants containing alanine substitutions at critical aspartic acid residues. Panel A: Analysis of 793
phospho-residue specificity of BA-Stp1. Dephosphorylation of synthetic phosphopeptides by 794
BA-Stp1 was measured using a malachite-green phosphate detection system. BA-Stp1 795
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
36
(concentrations ranging from 0-600 nM) was incubated with 50 µM phosphothreonine peptide-796
RRApTVA (black bars), 50µM phosphoserine peptide-RRApSVA (grey bars), and 50µM 797
phosphotyrosine peptide-RRLIEDAEpYAARG (white bars). Phosphatase activity was 798
detected at 600 nm and measured in terms of pmole of phosphate (Pi) released. Error bars 799
represent the standard deviation. Panel B: Analysis of phosphatase activity of site-directed 800
aspartic acid mutants of BA-Stp1. Phosphatase activity of site-directed aspartic acid mutants of 801
BA-Stp1 was measured in comparison to wild type BA-Stp1. Using 50 µM RRApSVA (black 802
bars) and 50 µM RRApTVA (grey bars) as substrates, phosphatase activity of 2 µM site-803
directed mutants, D18A, D36A, D194A, and D233A and 2 µM wild type BA-Stp1 was measured 804
as pmole of phosphate released. Error bars represent the standard error of the mean. Statistical 805
analysis was performed with ANOVA (p value<0.0001) 806
807
Figure 3. Analysis of BA-Stk1 as a candidate substrate of BA-Stp1. Panel A: 808
Dephosphorylation of recombinant BA-Stk1cat by BA-Stp1. The dephosphorylation of BA-Stk1 809
was assessed using a malachite-green phosphate detection assay in which the dephosphorylation 810
of BA-Stk1cat (0-25 µM) by BA-Stp1 is reported as pmole of Pi released following 30 min 811
incubation. Error bars represent the standard deviation of the mean. Statistical analysis was 812
performed by ANOVA (p value <0.0001). Panel B: Analysis of BA-Stk1 dephosphorylation by 813
BA-Stp1 mutants. BA-Stp1 or individual corresponding mutants were incubated with 2 µM BA-814
Stk1cat was in reaction buffer for 30 min and the pmole of Pi released was determined. Error 815
bars represent the standard deviation of the mean. Statistical analysis was performed with 816
ANOVA (p value <0.001) Panel C: BA-Stp1-dephosphorylation of autophosphorylated BA-817
Stk1. BA-Stk1 was autophosphorylated in the presence of [γ-32P] ATP for 30 min and then 818
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
37
incubated in phosphatase buffer with or without purified BA-Stp1. Aliquots were removed at 0, 819
30, 60, and 90 min and the reaction products were analyzed on SDS-PAGE followed by 820
autoradiography to visualize the degree of dephosphorylation. 821
822
Figure 4. BA-Stp1 dephosphorylation of BA-Stk1 and corresponding decrease in 823
autophosphorylation. Purified BA-Stk1 was subjected to a dephosphorylation reaction by BA-824
Stp1 and examined for changes in autophosphorylation activity. Panel A: Western Blot analysis 825
of BA-Stk1 serine phosphorylation following incubation with BA-Stp1. BA-Stk1 was incubated 826
under the indicated conditions and examined for dephosphorylation using polyclonal anti-827
phosphoserine antibodies at the indicated time-points. Lanes 1-3, BA-Stk1 incubated in reaction 828
buffer alone; Lanes 4-6, BA-Stk1 incubated with shrimp alkaline phosphatase (SAP); Lanes 7-9, 829
BA-Stk1 incubated with BA-Stp1; Lanes 10-12, BA-Stk1 incubated with enzymatically inactive 830
BA-Stp1D18A. Panel B: Autoradiograph of BA-Stk1 autophosphorylation following treatment 831
with BA-Stp1. Prior to the autophosphorylation reaction, BA-Stk1 was incubated with BA-Stp1 832
or the enzymatically inactive BA-Stp1D36A for 30 min. Untagged BA-Stp1 and BA-Stp1D36A 833
were removed from the mixture by affinity chromatography and the kinase activity of His-tagged 834
BA-Stk1 was examined by analyzing autophosphorylation using [γ-32P] ATP. Reactions were 835
stopped at 0, 15, 30, and 60 min and the products were analyzed on SDS-PAGE followed by 836
autoradiography. Lanes 1-4, Control treated BA-Stk1; Lanes 5-8 BA-Stp1 treated BA-Stk1; 837
Lanes 9-12 BA-Stp1D36A treated BA-Stk1. Panel C: Autoradiograph of BA-Stk1 838
autophophosphorylation and MBP phosphorylation following treatment with BA-Stp1. BA-Stk1 839
was preincubated with BA-Stp1 or buffer control for 30 min to allow for the dephosphorylation 840
reaction. Subsequently, autophosphorylation and kinase activity was analyzed using MBP and 841
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
38
[35
S] ATP-γS. Reactions were stopped at 15, 30, and 60 min and the products were analyzed on 842
SDS-PAGE followed by autoradiography. 843
844
Figure 5. Kinase activity of BA-Stk1 mutants. Alanine or aspartic acid-substituted site-845
directed mutants of BA-Stk1 were examined for changes in kinase activity in order to identify 846
serine and threonine residues critical to these events. Panel A: ATP hydrolysis activity of four 847
alanine site-directed mutants of BA-Stk1cat. Purified candidate serine (S173A and S214A) and 848
threonine (T165A and T290A) site-directed mutants of BA-Stk1cat were tested for activity in a 849
luminescence assay measuring consumption of ATP. Panel B: ATP hydrolysis activity of 850
aspartic acid mutants of BA-Stk1cat. Purified serine (S173D and S214D) and threonine (T165D 851
and T290D) site-directed mutants of BA-Stk1cat were tested for activity in a luminescence assay 852
as described above. Results were calculated as percent kinase activity relative to wild type BA-853
Stk1cat. Statistical analysis was performed with unpaired two-tailed Student’s T-test and all 854
calculated values were p<0.05. Panel C: Phosphorylation activity of BA-Stk1 mutants towards 855
myelin basic protein (MBP). Alanine or aspartic acid-substituted site-directed mutants of BA-856
Stk1 were examined for kinase activity towards MBP in order to identify serine and threonine 857
residues critical for substrate phosphorylation. Purified wild type BA-Stk1cat or alanine or 858
aspartic acid-mutants of BA-Stk1cat were incubated with MBP in the presence of [γ-32P] ATP for 859
30 min in kinase buffer. The reactions were stopped with SDS loading buffer and the reaction 860
products were analyzed on SDS-PAGE followed by autoradiography. Panel D. Quantification of 861
MBP phosphorylation. Levels of 32
P incorporation were obtained by PhosphorImage analysis 862
and the relative values are depicted as percent phosphorylation of MBP by BA-Stk1 mutants 863
compared to wild type BA-Stk1cat. Error bars represent standard deviation of the mean. 864
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from
Shakir et al.
A virulence-associated B. anthracis ser/thr phoshatase-kinase pair
39
Statistical analysis was performed with unpaired two-tailed Student’s T-test and all calculated 865
values were p<0.05. 866
867
Figure 6. Graphic summary of BA-Stk1 phospho-residues targeted by BA-Stp1 and their 868
contribution to specific kinase activities. Four residues are represented in the figure and 869
include the two serines and two threonines predicted as sites of phosphorylation 870
dephosphorylated by BA-Stp1. This model is derived from a series of experiments using a 871
combination of mutagenesis approaches and kinase assays to determine the role of each residue 872
in the activity of BA-Stk1. The symbols ↑ and ↓ denote increase or decrease in activity. Overall 873
kinase activity (KA) is measured in terms of levels of autophosphorylation plus substrate 874
phosphorylation. 875
on May 23, 2021 by guest
http://jb.asm.org/
Dow
nloaded from