ulm university medical center institute of molecular
TRANSCRIPT
![Page 1: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/1.jpg)
Ulm University Medical Center
Institute of Molecular Virology
Prof. Dr. Frank Kirchhoff
A small peptide derived from the HIV-1 gp120 glycoprotein
forms positively charged fibrils that enhance transduction
efficiencies of retro- and lentiviral vectors
Dissertation
to obtain the Doctoral Degree of Human Biology (Dr. biol. hum.)
at the Faculty of Medicine, Ulm University
presented by
Maral Yolamanova
Ashgabat, Turkmenistan
2016
![Page 2: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/2.jpg)
2
Present Dean: Prof. Dr. Thomas Wirth
1st reviewer: Prof. Dr. Jan Münch
2nd reviewer: Prof. Dr. Barbara Spellerberg
Date of graduation: 15th April 2016
![Page 3: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/3.jpg)
Parts of this dissertation have already been published in the following journal article:
Yolamanova M, Meier C, Shaytan AK, Vas V, Bertoncini CW, Arnold F,
Zirafi O, Usmani SM, Müller JA, Sauter D, Goffinet C, Palesch D, Walther P,
Roan NR, Geiger H, Lunov O, Simmet T, Bohne J, Schrezenmeier H,
Schwarz K, Ständker L, Forssmann WG, Salvatella X, Khalatur PG,
Khokhlov AR, Knowles TP, Weil T, Kirchhoff F and Münch J.
Peptide nanofibrils boost retroviral gene transfer and
provide a rapid means for concentrating viruses.
Nature Nanotechnology 2013, 8:130-136. DOI: 10.1038/nnano.2012.248
Copyright © by Macmillan Publishers Limited
![Page 4: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/4.jpg)
TABLE OF CONTENTS I
TABLE OF CONTENTS
TABLE OF CONTENTS ....................................................................................................... I
LIST OF ABBREVIATION ................................................................................................ III
1 INTRODUCTION ............................................................................................................ 1
1.1 Retroviruses ............................................................................................................... 1
1.2 Retroviral vectors ...................................................................................................... 3
1.3 Pseudotyping ............................................................................................................. 5
1.4 Limitations for efficient retroviral gene transfer ....................................................... 5
1.5 Approaches to enhancing retroviral transduction efficiency ..................................... 6
1.6 Peptide derived from HIV-1 envelope glycoprotein boost HIV-1 infection ............. 8
1.7 Aim of present study ............................................................................................... 10
2 MATERIAL AND METHODS...................................................................................... 11
2.1 Material .................................................................................................................... 11
2.1.1 Eukaryotic cells ................................................................................................ 11
2.1.2 Primary cells ..................................................................................................... 12
2.1.3 Bacteria ............................................................................................................. 12
2.1.4 Nucleic acids..................................................................................................... 12
2.1.5 Proteins ............................................................................................................. 14
2.1.6 Peptides ............................................................................................................. 14
2.1.7 Chemical reagent .............................................................................................. 15
2.1.8 Consumables ..................................................................................................... 17
2.1.9 Technical equipment......................................................................................... 17
2.1.10 Kits ................................................................................................................. 18
2.1.11 Buffers and solutions ...................................................................................... 19
2.1.12 Media .............................................................................................................. 19
2.2 Methods ................................................................................................................... 20
2.2.1 DNA methods ................................................................................................... 20
2.2.2 Bacterial methods ............................................................................................. 21
2.2.3 Cell culture ....................................................................................................... 21
2.2.4 Viral methods ................................................................................................... 22
2.2.5 Imaging methods .............................................................................................. 28
2.2.6 Proteomic methods ........................................................................................... 29
3. RESULTS ...................................................................................................................... 30
3.1 Identification of gp120 fragments that promote HIV-1 infection ............................. 30
3.2 gp120 fragments are not cytotoxic. ........................................................................... 32
3.3 gp120 peptides that enhance HIV infection form amyloid fibrils ............................. 32
![Page 5: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/5.jpg)
TABLE OF CONTENTS II
3.4 Formation of EF-C fibrils can be achieved in several solvents and their virus enhancing activity is stable .............................................................................................. 35
3.5 EF-C fibrils increase viral attachment and fusion ..................................................... 36
3.6 EF-C fibrils allow to concentrate viral particles ........................................................ 39
3.7 EF-C fibrils are potent enhancer of lenti- and retroviral transduction ...................... 41
3.8 Comparison between EF-C fibrils and other agents used to promote retroviral transduction ..................................................................................................................... 45
3.9 Immobilized EF-C nanofibrils capture virus and increase transduction. .................. 47
4. DISCUSSION ................................................................................................................ 52
4.1 Application of EF-C nanofibrils as enhancer of transduction efficiency. ............... 52
4.2. Analysis of the mechanism of fibril-mediated enhancement of viral infection. .... 55
5. SUMMARY .................................................................................................................. 59
6. REFERENCES .............................................................................................................. 60
![Page 6: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/6.jpg)
LIST OF ABBREVIATION III
LIST OF ABBREVIATION
°C Degree Celsius
μg microgram
μl microliter
aa amino acid
β Beta
β-gal Beta-galactosidase
ATCC American Type Culture Collection
bp Basepair
CaCl2 Calcium chloride
CCR5 C-C chemokine receptor type 5
DEAE Diethylaminoethyl
DMEM Dulbecco’s Modified Eagle’s Medium
DMSO Dimethyl sulfoxide
DNA Desoxyribonucleic acid
DRK German: Deutsches Rotes Kreuz
ds Double strand
E. coli Escherichia coli
EDTA Ethylenediaminetetraacetic acid
EF-A Enhancing factor A
EF-C Enhancing factor C
env Envelope
FCS Fetal calf serum
Fig. Figure
g gravitational force
g Gram
gag Group specific antigen
Gal Galactosidase
GALV Gibbon ape Leukemia Virus
GFP Green Fluorescent Protein
G-CSF Granulocyte colony stimulating factor
gp Glycoprotein
gp120 Envelope glycoprotein of HIV, 120 kDa
gp41 Envelope glycoprotein of HIV, 41 kDa
HCl Hydrochloric acid
HEPES 2-(4-(2-Hydroxyethyl)- 1-piperazinyl)-ethansulfonsäure
![Page 7: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/7.jpg)
LIST OF ABBREVIATION IV
h Hour(s)
HIV Human Immunodeficiency Virus
i.e. id est
IL-2 Interleukin-2
kb Kilo base pairs
kDa Kilodalton
KCl Potassium chloride
l Liter
LB Lysogeny Broth
LSM Laser Scanning Microscope
LTR Long Terminal Repeat
m Meter
mM Millimolar
MgCl2 Magnesiumchloride
min Minute(s)
ml Milliliter
MLV Murine Leukemia Virus
NaCl Sodium chloride
NEB New England Biolabs
nef Negative factor
ng Nanogram
NIH National Institutes of Health
nm Nanometer
p24 Capsid protein of HIV, 24 kDa
PAP Prostatic acid phosphatase
PBL Peripheral blood lymphocyte
PBS Phopsphate buffered saline
pH Potentia hydrogenii
PHA Phytohaemagglutinin
pol Polymerase
RD114 Envelope glycoprotein of Feline Leukemia Virus
rev Regulator of expression of virion proteins
rhIL-6 Recombinant human interleukin-6
rhSCF Recombinant human Stem Cell Factor
RLU Relative Light Units
RPMI Roswell Park Memorial Institute medium
rpm Revolutions per minute
![Page 8: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/8.jpg)
LIST OF ABBREVIATION V
RRE Rev responsive element
RT Room temperature (21°C - 25°C)
sec Second(s)
SEVI Semen-derived Enhancer of Viral Infection
SIN Self-inactivating vector
S.O.C Super Optimal broth with Catabolite repression
ss Single strand
TAE Tris-acetate-EDTA
tat Transactivator of transcription
TEM Transmission electron microscopy
ThT Thioflavin T
Tris Tris(hydroxymethyl)aminomethane
U3 Unique 3
U5 Unique 5
V3 Variable loop 3
v/v Volume per volume
vif Viral infectivity factor
vpr Viral protein R
vpu Viral protein U
VSV Vesicular Stomatitis Virus
w/v Weight per volume
YFP Yellow Fluorescent Protein
Amino acid code
A Alanine N Asparagine C Cysteine P Proline D Aspartic acid Q Glutamine E Glutamic acid R Arginine F Phenylalanine S Serine G Glycine T Threonine H Histidine U Selenocysteine I Isoleucine V Valine K Lysine W Tryptophan L Leucine Y Tyrosine M Methionine
![Page 9: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/9.jpg)
1 INTRODUCTION 1
1 INTRODUCTION
Introduction of genetic material into the cells offers many prospects for basic research, e.g.
for constitutive or regulated gene expression, cDNA library construction, siRNA delivery,
insertional mutagenesis or generation of transgenic animals (Matrai et al., 2010; Tiscornia
et al., 2002). Furthermore the opportunity to treat disease by either modifying the gene
expression or correction of abnormal genes has been used in approaches for therapeutic
application (Bunnell et al., 1995; McTaggart et al., 2002; Frecha et al., 2010; Matrai et al.,
2010). Gene therapy holds great promise for the treatment of inherited metabolic disorders
such as adenosine deaminase deficiency and cystic fibrosis as well as acquired diseases
such as cancer, cardiovascular and some infectious diseases (Candotti et al., 1012; Isner,
2002; Bunnell BA and Morgan RA, 1998). Current methods for transferring therapeutic
genes can be divided into two large groups: viral and non-viral methods. To the non-viral
delivery systems belong naked DNA, liposomes and DNA-protein complexes
(Ramamoorth M and Narvekar A, 2015). The main problems with non-viral delivery are (i)
relatively low transduction efficiency; (ii) transiency of gene expression; (iii) lack of
specific targeting. Therefore, the application of non-viral systems in gene therapy is low
(Journal of Gene Medicine, © 2015 John Wiley and Sons Ltd). Viral vectors are the most
efficient vehicles for gene transfer in vivo. The major advantages of viral vectors are high
transduction efficiency and specificity of transgene delivery using the cell’s own
biosynthetic machinery. Viral gene delivery can be classified into two general groups: the
viral vectors which integrate into the host cell genome, such as, retroviral, lentiviral and
adeno-associated viral vectors and non-integrating vectors like herpes simplex virus type 1
and adenoviral vectors. Moreover, some of viral vectors; e.g. lentiviruses, have the unique
ability to efficiently replicate in non-dividing cells as they target the nucleus without the
requirement of mitosis (von Schwedler et al., 1994). Nowadays viral vectors are employed
in more than 70% of all clinical gene therapy trials (Journal of Gene Medicine, © 2015
John Wiley and Sons Ltd).
1.1 Retroviruses
Retroviruses are classified into three genera: the oncoretroviruses (e.g. MLV, murine
leukemia virus), the lentiviruses (e.g. HIV, Human Immunodeficiency Virus), and the
spumaviruses including the Human Foamy Virus (HFV) (Coffin et al., 1997; Heneine et
al., 1998). Retroviruses are lipid-enveloped viruses carrying two copies of single-stranded
![Page 10: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/10.jpg)
1 INTRODUCTION 2
positive RNA, which range between 7 to 13 kb in length. The virus enters the cell through
the specific interactions between viral envelope glycoproteins and the cellular receptors
leading to fussion between the viral envelope and the host membrane. The viral RNA
enters the cytoplasm and is reversely transcribed into double-stranded DNA. The viral
DNA is permanently integrated into the host cell chromosomal DNA and called a provirus
(Coffin et al., 1997; Turner and Summers, 1999).
Basic genomic features are common to all retroviruses. Two copies of the long terminal
repeat (LTR) flank the ends of the viral genome (Fig. 1) and contain all of the requisite
signals for gene expression: enhancer, promoter, transcription initiation (capping),
transcription terminator and polyadenylation signal. Each LTR can be divided into three
elements: U3, R and U5. While the promoter region with the regulatory sequences is
contained in the U3 region at the 5’-extremity of the LTR, the polyadenylation signal is
located in the U5 region at the 3’-extremity of the LTR. The sequence identity of the LTR
is important in the process of reverse transcription, because the polymerase jumps from
one end of the template to the other. A sequence named packaging signal (psi, Ψ) is found
near the 5’end of the viral genome (Fig. 1) and is required for specific packaging of the
viral RNA into newly forming virions (Coffin et al., 1997; Turner and Summers, 1999).
Retrovirus genomes contain three essential genes: gag (group-specific antigen), pol
(polymerase), and env (envelope glycoprotein) (Fig. 1). The gag sequence encodes the
three main structural proteins capsid, matrix and nucleocapsid, which are necessary for the
assembly and release of virus and virus-like particles. The pol sequence encodes the
enzymes protease, reverse transcriptase and integrase, which are responsible for the reverse
transcription of the viral genome from RNA to DNA during the infection process and for
Figure 1. Scheme of the genetic organization of MLV, a gammaretrovirus, and HIV-1, a lentivirus. The proviruses of all retroviruses are flanked by Long Terminal Repeats (LTR) and encode gag, pol and env genes. HIV-1 virus carries additionally six regulatory/accessory genes (tat, rev, vif, vpr, vpu and nef).
![Page 11: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/11.jpg)
1 INTRODUCTION 3
the integration of the proviral DNA into the host cell genome. The env sequence encodes
the glycoproteins, necessary for interaction with host receptors and virus entry (Coffin et
al., 1997; Turner and Summers, 1999).
Moreover, lentiviruses possesses several additional genes, i.e. tat and rev encoding
regulatory proteins and vif, vpr, vpu and nef encoding accessory proteins (Turner and
Summers, 1999). The Tat (transactivator of transcription) protein stimulates viral gene
expression during transcription initiation and elongation (Mahlknecht et al., 2008). The
Rev (regulator of expression of viral proteins) protein is required for efficient cytoplasmic
accumulation of viral RNA (Malim and Emerman, 2008). The Vif (virion infectivity
factor) protein counteracts a cellular restriction factor, APOBEC3G, that inhibits HIV-1
(Sheehy et al., 2002). The Vpu (viral protein unknown) degrades CD4 and promotes virus
release by counteracting the cellular restriction factor tetherin (Neil et al., 2006). The Vpr
(viral protein regulatory) arrests cellular proliferation in the G2 phase of the cell cycle,
promotes cellular differentiation and interacts with cellular proteins involved in DNA
repair (Malim and Emerman, 2008). The Nef (negative factor) performs various activities
that promote viral immune evasion and replication (Kirchhoff et al., 2004; Münch et al.,
2005; Schindler et al., 2006).
1.2 Retroviral vectors
Retroviruses provide a well suited platform for the stable transfer of genetic information
into target cells (McTaggart et al., 2002). The 1-st generation of retroviral vectors contains
a single packaging plasmid encoding the all HIV-1 genes besides envelope protein which
was encoded on a separate plasmid (Wei et al., 1981). In the 2-nd generation of retroviral
vector, the HIV-derived packaging component was reduced to the gag, pol, tat and rev
genes. The transfer plasmid contains the viral LTRs and Ψ packaging signal and plasmid
encoded env gene were separated into additional plasmids (Naldini et al., 1996). For
reasons of biosafety, the 3-d generation plasmid systems were developed (Markowitz et
al., 1988). Currently used systems comprise a transfer construct, a packaging construct and
an envelope construct. In the case of lentiviral vectors a fourth plasmid which codes rev
gene is also necessary because it was shown that Rev facilitates export of the RNA from
the nucleus. The transfer construct carrying the transgene of interest contains the LTR
sequences necessary for the genomic integration of the virus into the target cells, the Ψ
signal for packaging the genomic viral RNA into the viral capsid and Rev Response
Element (RRE), a binding site for the Rev protein, needed for lentiviral vectors.
![Page 12: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/12.jpg)
1 INTRODUCTION 4
(Markowitz et al., 1988; Coffin et al., 1997). The gag and pol (gag/pol) genes, which are
required for particle production and transduction of target cells, env gene, that encodes the
envelope glycoproteins, and rev gene, are separated onto three different helper plasmids, in
which the Ψ signal and LTRs are removed (Fig. 2). The tat is eliminated from the 3-d
generation system through the addition of a chimeric 5’ LTR fused to a heterologous
promoter on the transfer plasmid. Expression of the transgene from this promoter is no
longer dependent on Tat transactivation.
Figure 2: Schematic representation of the retroviral vectors and workflow. The gene of interest is cloned in a plasmid (transfer vector) that contains the retroviral regulatory elements (LTR, long terminal repeats) as well as elements to regulate the expression of the transgene. For gammaretrovirus based packaging systems, the transfer vector is co-transfected in HEK293T cells with two additional vectors carrying gag/pol and env genes, respectively. For lentivirus based packaging systems, the transfer vector is co-transfected in HEK293T cells with three additional vectors carrying gag/pol, env and rev, respectively. In the HEK293T cells the viral particles are formed, bud from the cell surface and accumulate in the culture medium (supernatant).
These three or four plasmids are co-transfected into producer cells, usually the human
embryonic kidney HEK293 cell line. The helper plasmids include all the structural proteins
needed in order to package a new virus. Due to the Ψ deletion within the helper plasmid,
the transcribed helper RNA does not get incorporated into the new recombinant virus.
Thus, progeny virions are replicative incompetent. They are able to infect cells and
promote integration of the transgenes into the cellular genome, but no viral particles can be
further generated. This system avoids the possibility of homologous recombination
between the three plasmids, which could give rise to replication-competent retroviruses
![Page 13: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/13.jpg)
1 INTRODUCTION 5
(Miller and Buttimore, 1986; Miller et al., 1986; Naldini et al., 1996; Dull et al., 1998).
The process by which DNA is transferred by a retroviral vector is termed transduction.
Furthermore, self-inactivating retroviral vectors were developed. These vectors are
constructed by deleting the enhancer and/or the promoter within the U3 region of the 3'
LTR. After reverse transcription, the deletion is transferred to the 5’ LTR of the proviral
DNA, resulting in an inactive provirus (Miyoshi et al., 1998; Yu et al., 1986).
1.3 Pseudotyping
One interesting property of retroviral vectors is their ability to be enveloped by different
glycoproteins (GP). The incorporation of heterologous GP into retroviral particles is
termed pseudotyping and is used to alter the target cell tropism or to increase the stability
and infectivity of retroviral vectors (Sanders, 2002). Nowadays the following GPs are
extensively used for pre-clinical and clinical studies due to their attractive cell tropism: the
envelope protein of Gibbon-ape Leukemia Virus (GaLV), Feline Endogenous Virus
(RD114), amphotropic Mirine Leukemia Virus (MLV) and Vesicular Stomatitis Virus
(VSV-G) (Akkina et al., 1998; Neff et al., 2004; Cronin et al., 2005). The most widely
used GPs for pseudotyping retroviral vectors is VSV-G GP (Burns et al., 1993), which
confers a broad tropism and generates stable particles that can be purified and
cryopreserved. GaLV and RD114 pseudotyping have shown excellent gene transfer
efficiencies for primary T lymphocytes and human hematopoietic cells (CD34+) (Bauer et
al., 1995; Bunnell et al., 1995; Uckert et al., 2000, Kelly et al., 2001). However,
pseudotyping of lentiviral vectors with RD114 and GaLV GP showed reduced infectivity.
To overcome this problem, chimeric GPs were developed by replacing the cytoplasmatic
tail of the RD114 and GaLV envelope proteins (designated TR) with that of MLV GP to
increase their incorporation into viral particles (Stitz et al., 2000; Sandrin et al., 2002;
Sandrin et al., 2004). Lentiviral vectors pseudotyped with GaLV/TR and RD114/TR GP
have shown high titer, stability of viral particle and resistance to inactivation in the
presence of human sera.
1.4 Limitations for efficient retroviral gene transfer
Major obstacles associated with retroviral vectors include the production of low-titer viral
stocks and inefficient transduction rates, particularly into specific primary human cells,
such as macrophages and CD34+ hematopoietic stem cells. In the best cases, between 106
![Page 14: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/14.jpg)
1 INTRODUCTION 6
to 107 infective viral particles per mL of cell culture supernatant are produced by
commonly used producer systems (Pear et al., 1993; Dull et al., 1998). These
concentrations are enough for certain in vitro applications. However, high concentrations
of viral stocks are required for gene therapy applications in order to improve transduction
efficiencies (Andreadis et al., 1999). Several techniques to concentrate virus stocks like
optimizing transfection protocols, use of new designed retroviral vectors and/or
ultracentrifugation have been developed (Kotani et al., 1994; Reiser, 2000; Bajaj et al.,
2001; Gatlin et al., 2001; Zhang et al., 2001).
Usually, virus attachment requires the interaction of the viral envelope GP with specific
receptors on the cell surface. The densities of GP on the virions and the appropriate entry
receptors on the targets cells are often low and in the majority of encounters the viral
particle will be repelled by the repulsion between the negatively charged viral and cellular
membranes. Furthermore, the slow diffusion and rapid decay of retrovirus particles are
important reasons for the low transduction efficiencies (Andreadis et al., 2000; Chuck et
al., 1996; Le Doux et al., 1999). Various approaches have been developed to increase the
efficiency of virion attachment and thus gene delivery but they all have significant
limitations and improved methods are still urgently needed.
1.5 Approaches to enhancing retroviral transduction efficiency
Frequently used strategies to increase attachment rates include low speed centrifugation of
virions onto their target cells (Ho et al., 1993; Bahnson et al., 1995; Quintas-Cardama et
al., 2007) and/or treatment with cationic polymers (e.g., hexadimethrine bromide
(polybrene), diethylaminoethyl (DEAD)-dextran) (Hodgson and Solaiman, 1996; Vogt,
1967), and cationic peptides (e.g., protamine sulfate) (Cornetta and Anderson, 1989;
Hodgson and Solaiman, 1996). Positively charged compounds may enhance transduction
efficiency via charge shielding, in which the compounds reduce electrostatic repulsion by
neutralizing virus and cell surface charge (Davis et al., 2004). Moreover, cationic
compounds could allow the virus to overcome electrostatic repulsion by aggregation of the
virus, thereby enhancing the rate of sedimentation of the virus onto the cell surface (Davis
et al., 2002). These methods are often inconvenient, associated with cytotoxicity, cell type
dependent and/or poorly effective. Furthermore, most adjuvants and agents that facilitate
virion attachment are not suitable for transduction of highly sensitive primary human cells
because they affect their viability and functionality.
![Page 15: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/15.jpg)
1 INTRODUCTION 7
The most commonly used and most effective technique to promote viral gene delivery is
coating of cell culture plates, flasks or bags with RetroNectin (Williams et al., 1991;
Hanenberg et al., 1996; Moritz et al., 1996; Hanenberg et al., 1997). RetroNectin is a
chimeric protein that comprises 574 amino acids and contains a cell-binding domain, a
heparin-interacting region and a CS-1 site (Fig. 3). The fibronectin cell-binding and CS-1
sites interact with the very late antigens (VLA) 4 and 5 on the cell surface and the heparin
domain binds the virions, thereby bringing them into close proximity and promoting
transduction (Williams et al., 1991; Hanenberg et al., 1996; Moritz et al., 1996). However,
RetroNectin has to be coated onto plates to capture virions and several washing steps have
to be applied. Thus, the use of this relatively expensive compound is time consuming and
laborious.
Figure 3. Mechanism of RetroNectin mediated increase of transduction efficiencies.
![Page 16: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/16.jpg)
1 INTRODUCTION 8
1.6 Peptide derived from HIV-1 envelope glycoprotein boost HIV-1 infection
To better characterize the interaction of HIV-1 with its cellular receptors, we screened a
library of peptides derived from different regions of the surface envelope glycoprotein
gp120 of HIV-1 (group M, subtype B, strain HxB2) (Gurgo et al., 1988). HIV-1 group M
is the ‘major’ group and is responsible for the majority of the global HIV epidemic
(Hemelaar, 2012). This GP together with gp41 produces by the proteolytic cleavage of the
precursor protein gp160, which is encoded by the env gene of HIV-1. gp120 is responsible
for virus binding to the receptor (CD4) and co-receptors (CCR5 and CXCR4) expressed by
target cells and triggers the subsequent fusion between viral envelope and cell membrane
It has been previously shown, that semen-derived
peptides form amyloid fibrils, termed Semen-derived
Enhancer of Virus Infection (SEVI), promote HIV-1
infection (Münch et al., 2007) (Fig. 4). Under
conditions of limiting viral dilutions SEVI boost the
HIV infection by up to 105-fold (Münch et al., 2007). It
was hypothesized, that positively charged fibrils bind
to negatively charged surface of virions and target
cells. This reduces the charge-charge repulsions
between them and promotes virion attachment and
fusion. (Roan et al., 2009, Brender et al., 2009). Last
studies showed that SEVI improve the efficiency of
retroviral gene transfer (Wurm et al., 2010; Wurm et
al., 2011). However, SEVI has some drawbacks for
usage as an enhancer of viral gene transfer. For
example, the amyloidogenic peptides that form SEVI
are relatively large (38 amino acids) and thus relatively
expensive to produce. Furthermore, it takes several
hours to generate the active amyloid fibrils (Münch et
al, 2007). Finally, sometimes very large amyloid
aggregates are obtained particularly after longer storage
and repeated freeze-thaw cycles that are poorly
effective in boosting retroviral transduction.
Figure 4. Putative mechanism of SEVI action. Abundant semen protein prostatic acid phosphatase (PAP) form amyloid fibrils termed SEVI. The fibrils capture HIV virions and promote their attachment to target cells. (Source: N. Roan and W. Greene, 2007, Cell, 131(6):1044-1046).
![Page 17: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/17.jpg)
1 INTRODUCTION 9
(Kwong et al., 1998). gp120 is composed of five regions called C1–C5 and conserved
among different HIV-1 strains, five highly glycosylated and hypervariable regions called
V1–V5 and contains 30 β-strands and 6 α–
helices (Fig. 5). One of peptides derived
from HIV-1 gp120 efficiently enhanced
HIV-1 infection. This peptide corresponds to
amino acids 413 to 431 of the HIV-1 gp120.
This peptide partially covers the β19 and
β20 strands which proposed to be involved
in co-receptor interaction (Kwong et al.,
1998). We hypothesised that this peptide
might be used as an effective means to
increase retroviral gene transfer in basic
research and clinical applications. Figure 5. Structure of the HIV-1 gp120. Strands ß19 and ß20 overlapping the amino acids 413 to 431. (Source: Kwong et al., 1998, Nature, 393:648-59).
![Page 18: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/18.jpg)
1 INTRODUCTION 10
1.7 Aim of present study
Retroviral and lentiviral gene transfer is the method of choice for the stable introduction of
genetic material into cells and offers many prospects for basic research and for the
treatment of genetic disorders, malignancies and infection diseases. Application of retro-
and lentiviral gene transfer systems is often hampered by low transduction efficiencies,
particularly into specific primary human cell types, such as macrophages and CD34+
hematopoietic stem cells. Various approaches have been developed to increase the
efficiency of gene delivery but they all have significant limitations and improved methods
are urgently needed. Therefore, the aim of the present study was to develop convenient and
broadly applicable tools for effective and safe retroviral gene transfer, based on a peptide
derived from HIV-1 external gp120. To achieve this goal, the following points were
investigated:
• Identification of most effective peptide fragment required for infection
enhancement
• Determination of effect of peptide on cell viability
• Investigation of interaction between peptide and virus particles
• Investigation of interaction between peptide and cells surface
• Determination of effect of peptide on retroviral transduction efficacies and cell
viability in comparison to other enhancer in vitro
• Analysis of peptide in vivo studies using a mouse model
![Page 19: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/19.jpg)
2 MATERIAL AND METHODS 11
2 MATERIAL AND METHODS
2.1 Material
2.1.1 Eukaryotic cells
HEK293T Human renal epithelial cell line which was transformed with adenovirus type 5 and expresses SV40 (simian virus 40) large T-antigen (Graham et al., 1977). The cells were obtained from the American Type Culture Collection (ATCC).
HeLa Human epithelial carcinoma cell line (Gey, 1952). The cells were obtained from ATCC.
TZM-bl CXCR4-positive HeLa cell clone that was engineered to express CD4 and CCR5. TZM-bl cells contain HIV LTR-driven β-galactosidase and luciferase reporter cassettes that are activated by HIV tat expression. (Wei, 2002). The cells were obtained from the NIH AIDS Reagent Program.
CEM-M7 Human T lymphoid cell line, which expresses luciferase and GFP under control of the LTR promoter (Hsu et al., 2003). The cells were kindly provided by N. Landau (New York, NY, USA).
KG-1 Human acute myeloid leukemia cell line which express transmembrane and soluble forms of CD34. (Koeffler, 1978; Fernández M, 2000). The cells were obtained from ATCC.
HFF Human foreskin fibroblasts cell line. The cells were kindly provided by J. von Einem (Institute of Virology, Ulm, Germany.).
THP-1 Human acute monocytic leukemia cell line (Tsuchiya et al., 1980). The cells were obtained from the American Type Culture Collection. The cells were obtained from ATCC.
K562 Human erythroleukemic cell line (Anderson LC et al., 1979). The cells were obtained from ATCC.
U-87 MG Human astroglioma cell line with epithelial-like morphology (Ponten and Macintyre, 1968). The cells were obtained from the NIH AIDS Reagent Program.
BON Human pancreatic carcinoid cell line (Evers, 1994). The cells were obtained from ATCC.
![Page 20: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/20.jpg)
2 MATERIAL AND METHODS 12
2.1.2 Primary cells
Human Peripheral Blood Lymphocytes (PBL)
Human Peripheral Blood Mononuclear Cells (PBMCs) were separated from buffy coat using a Ficoll gradient. PBL were enriched from the PBMC fraction by an overnight plastic adherence at 37°C to remove adherent monocytes. Lymphocytes were activated for 3 days with 20 U/ml Il2 and 2 µg/ml PHA.
Human Macrophages Monocytes were separated using adherence on plastic. After 45 min, non-adherent cells were removed by rinsing in PBS. Monocytes were differentiated to macrophages by incubation for 7 days with 10 ng/ml GM-CSF.
Human CD34+ cells Cells were received from the Institute for Clinical Transfusion Medicine and Immunogenetics Ulm, and collected by apharesis of G-CSF (granulocyte colony stimulating factor) treated individuals. Cells were maintained in CellGro® SCGM medium (CellGenix Germany) supplemented with 10% FCS, 100 ng/ml rhSCF, 20 ng/ml rhIL-3, 25 ng/ml rhIL-6.
2.1.3 Bacteria
E.coli XL-2 blueTM rec A1, endA1, gyrA96, thi-1, hsdR17, supE44, relA1,
lac [F ́ proAB laclqZΔM15 Tn10 (Tetr) Amy Camr]
Agilent Technologies, Santa Clara, CA, USA)
2.1.4 Nucleic acids
Plasmid DNAs
pBRHIV-1NL4-3_92Th014 The plasmid encodes the HIV-1 NL4-3 provirus. The V3-loop region has been exchanged by the V3-loop of the R5-tropic 92th014.12 isolate (Papkalla et al., 2002).
pBRNL4-3_92Th014.12(R5)nef+_ IRES_g-Luc
The plasmid encodes the pBRNL4-3_92Th014.12 provirus and a Gaussia-luciferase cassette in place of nef.
pSRS11 SF GFPpre Self-inactivating (SIN) retrovirus transfer vector, driving by the Rous sarcoma virus (RSV) promoter in the producing cell. Expression of the green fluorescent protein (GFP) is directed by an internal spleen-focus forming virus promotor (SF) (Schambach et al., 2006b). The plasmid was kindly provided by J. Bohne.
![Page 21: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/21.jpg)
2 MATERIAL AND METHODS 13
M57-DAW MLV gag/pol expression plasmid utilizing an SV promotor (Schambach et al., 2006b). The plasmid was kindly provided by J. Bohne.
phCMV-RD114 Construct expressing endogenous feline virus (RD114) glycoprotein. The plasmid was kindly provided by F.L. Cosset.
phCMV-GaLV Construct expressing Gibbon Ape Leukemia Virus (GaLV) glycoprotein. The plasmid was kindly provided by F.L. Cosset.
phCMV-MLV Construct expressing amphotropic Murine Leukemia Virus (MLV4070A) glycoprotein. The plasmid was kindly provided by F.L. Cosset.
pRRL.cPPT.SFeGFP.pre Self-inactivating (SIN) lentiviral vector, contains the spleen focus-forming virus LTR (SF), the central polypurine tract (PPT), which increase the efficiency of reverse transcription and the posttranscriptional regulatory element (PRE) of woodchuck hepatitis virus (increase infectious titer). (Zufferey et al., 1999; Schambach et al., 2006a). The plasmid was kindly provided by L. Naldini
pMDLg/pRRE CMV-driven expression plasmid that contains gag, pol and Rev-responsible element (RRE) from HIV-1, a binding site for the Rev protein which facilitates export of the TNA from the nucleus (Dull et al., 1998). The plasmid was kindly provided by J. Bohne.
pRSV-Rev Rev cDNA-expressing plasmid in which the joined second and third exons of HIV-1 rev under the transcriptional control of RSV U3 (Dull et al., 1998). The plasmid was kindly provided by D. Trono.
phCMV-RD/TR
Chimeric envelope gp carrying the MLV gp cytoplasmic tail. Relatively short cytoplasmic tail of MLV increases incorporation of RD gp on lentiviral core (Sandrin et al., 2002). The plasmid was kindly provided by F.L. Cosset.
phCMV-GaLV/TR Chimeric envelope gp carrying the MLV gp cytoplasmic tail. Relatively short cytoplasmic tail of MLV increases incorporation of GaLV gp on lentiviral core (Sandrin et al., 2002). The plasmid was kindly provided by F.L. Cosset.
VSV-G Vector which expresses the envelope protein of the vesicular stromatitis virus (VSV-G) (Schindler et al., 2003)
MLV GAG YFP The plasmid encodes MLV gag proteins fused to YFP. The particles are non-infectious (kindly provided by W. Mothes).
![Page 22: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/22.jpg)
2 MATERIAL AND METHODS 14
Molecular weight size marker
1 kb Plus DNA Ladder Life Technologies GmbH, Darmstadt
2.1.5 Proteins
Enzymes
Restriction endonucleases New England Biolab, Ipswich, MA, USA
EDTA-Trypsin Invitrogen/Gibco (Karlsruhe)
RetroNectin
RetroNectin was obtained from TAKARA (TAK T100B) and coated on “Non-Tissue
Culture Treated 96 well plates” (BD 351172) as recommended by the manufacturer.
2.1.6 Peptides
HIV-1 p12 Abcam, Cambridge, UK
PAP248-286 GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
EF-A NITLQCKIKQIINMWQEVG
EF-B NITLQCKIK
EF-C QCKIKQIINMWQ
EF-D KIKQIINMWQ
EF-E QCKIKQ
EF-F QCKIKQIINMW
EF-G KIK
EF-H QIINMWQEVG
EFcon TITLPCRIKQIINMWQGVG
The peptides were synthesized by Celtek Bioscience (Nashville, TN, USA) and
ViroPharmaceutical GmbH & Co KG (Hannover, Germany) using standard Fmoc solid-
![Page 23: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/23.jpg)
2 MATERIAL AND METHODS 15
phase peptide synthesis, purified by preparative RP HPLC and analyzed by HPLC and MS.
Peptides derived from HIV-1 gp120 were dissolved in DMSO (Merck, 1029521000) to 10
mM or 10 mg/ml stocks and stored at -20°C. PAP248-286 was dissolved in PBS at a
concentration of 10 mg/ml and agitated overnight at 37°C and 179 g in a thermomixer to
promote amyloid fibril formation.
2.1.7 Chemical reagent
Agarose Carl Roth GmbH + Co. KG, Karlsruhe
Ampicillin Ratiopharm GmbH, Ulm
Bacto tryptone Becton Dickinson, Franklin Lakes, NJ, USA
Bacto yeast extract Becton Dickinson, Franklin Lakes, NJ, USA
Buffers for restriction digestion New England Biolabs, Ipswich, MA, USA
Calcium chloride dihydrate (CaCl2 x 2H2O) AppliChem GmbH, Darmstadt
CellGro® SCGM medium CellGenix, Germany
CellMask™ Deep Red Thermo Fisher Scientific, Marietta, USA
Chloroquine diphosphate salt Sigma Aldrich, St. Louis, MO, USA
Congo Red Sigma Aldrich, St. Louis, MO, USA
DEAE-dextran Sigma Aldrich, St. Louis, MO, USA
Dimethyl sulfoxide (DMSO) Sigma Aldrich, St. Louis, MO, USA
Disodium hydrogen phosphate dihydrate (Na2HPO4 x 2H2O)
AppliChem GmbH, Darmstadt
DMEM Life Technologies GmbH, Darmstadt
Ethanol Sigma Aldrich, St. Louis, MO, USA
Ethidium bromide AppliChem GmbH, Darmstadt
Fetal calf serum (FCS) Life Technologies GmbH, Darmstadt
Ficoll separation solution Merck KGaA, Darmstadt
Gentamicin Life Technologies GmbH, Darmstadt
Glucose Sigma Aldrich, St. Louis, MO, USA
Granulocyte-macrophage colony-stimulating factor (GM-CSF)
R&D Systems, Wiesbaden-Nordenstadt
![Page 24: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/24.jpg)
2 MATERIAL AND METHODS 16
L-Glutamine Life Technologies GmbH, Darmstadt
Hepes (C8H18N2O4S) Sigma Aldrich, St. Louis, MO, USA
HPLC water VWR International GmbH, Darmstadt
Hydrogen chloride (HCl) VWR International GmbH, Darmstadt
Isopropanol Merck KGaA, Darmstadt
Methanol Merck KGaA, Darmstadt
MTT (3-(4,5-dimethylthiazole-2-yl)-2,5 diphenyltetrazolium bromide
Sigma Aldrich, St. Louis, MO, USA
Penicillin/Streptomycin (Pen/S) Life Technologies GmbH, Darmstadt
Phosphate buffered saline (PBS) Life Technologies GmbH, Darmstadt
PHA (Phytohaemagglutinin) Thermo Fisher Scientific, Marietta, OH, USA
Protamine sulfate Sigma Aldrich, St. Louis, MO, USA
Potassium chloride (KCl) Merck KGaA, Darmstadt
Roti®-Load DNA Carl Roth GmbH + Co. KG, Karlsruhe
RPMI-1640 medium Life Technologies GmbH, Darmstadt
Recombinant Human Interleukin-2 (rhIL-2) Miltenyi Biotec GmbH, Bergisch Gladbach
Recombinant Human Interleukin-3 (rhIL-3) R&D Systems, Wiesbaden-Nordenstadt
Recombinant Human Interleukin-6 (rhIL-6) R&D Systems, Wiesbaden-Nordenstadt
Recombinant Human Stem Cell Factor (rhSCF)
R&D Systems, Wiesbaden-Nordenstadt
SOC medium Life Technologies GmbH, Darmstadt
Sodium ascorbate (C6H7NaO6) Sigma Aldrich, St. Louis, MO, USA
Sodium chloride (NaCl) Merck KGaA, Darmstadt
Sodium hydroxide (NaOH) Merck KGaA, Darmstadt
Sulfuric acid (H2SO4) Sigma Aldrich, St. Louis, MO, USA
SureBlue™ TMB Microwell Peroxidase Substrate
KPL, Gaithersburg, MD, USA
TAE buffer (50x) 5 PRIME, Gaithersburg, MD, USA
Thioflavin T (ThT) stock solution Sigma Aldrich, St. Louis, MO, USA
![Page 25: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/25.jpg)
2 MATERIAL AND METHODS 17
Tris VWR International GmbH, Darmstadt
Tryptone Becton Dickinson, Franklin Lakes, NJ, USA
Trypsin / EDTA, 0.05% Life Technologies GmbH, Darmstadt
Triton X-100 Sigma Aldrich, St. Louis, MO, USA
Tween 20 Sigma Aldrich, St. Louis, MO, USA
2.1.8 Consumables
8-channel manifold for QuikSip™ BT-Aspirator
BRAND GMBH + CO KG, Wertheim
Cell culture flasks Sarstedt, Nümbrecht
Cell culture well plates Greiner Bio-One GmbH, Frickenhausen
Falcons (15 ml and 50 ml) Sarstedt, Nümbrecht
Micro tubes, 1.5 and 2.0 ml, PP, with attached PP cap
Sarstedt, Nümbrecht
Millex-HA Filter Unit 0.45 μm Merck KGaA, Darmstadt
Polystyrene microplates Corning, Corning, NY, USA
MaxiSorp™ Thermo Scientific, Waltham, MA, USA
White plates Thermo Scientific, Waltham, MA, USA
Serological pipettes (5 ml, 10 ml and 25 ml)
Sarstedt, Nümbrecht
µ-Slide VI0.4 Ibidi, Planegg / Martinsried
Tips without filter, Type A/B/E (10, 200, 1,000 μl)
Sarstedt, Nümbrecht
2.1.9 Technical equipment
Centrifuge 5417 R (Rotor: F-45-30-11) Eppendorf AG, Hamburg
Centrifuge 5810 R (Rotor: A-4-81) Eppendorf AG, Hamburg
Multipette plus Eppendorf AG, Hamburg
Thermomixer comfort Eppendorf AG, Hamburg
![Page 26: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/26.jpg)
2 MATERIAL AND METHODS 18
MR Hei-Standard (stirrer) Heidolph Instruments GmbH & Co. KG, Schwabach
Titramax 100 (plate shaker) Heidolph Instruments GmbH & Co. KG, Schwabach
Pipetus® Hirschmann Laborgeräte GmbH & Co. KG, Eberstadt
DISCOVERY Comfort Multichannel Pipette
HTL Lab Solutions Warsaw, Poland
FE20–FiveEasy™ pH-meter Mettler-Toledo, Columbus, OH, USA
VMax Kinetic ELISA Microplate Reader SoftMax Pro 5.3
Molecular Devices, Sunnyvale, CA, USA
HERAsafe® KSP 18 Thermo Fisher Scientific, Marietta, OH, USA
Steri-Cult CO2-Inkubator Modell 3311 Thermo Fisher Scientific, Marietta, OH, USA
Vortex-Genie® VWR International GmbH, Darmstadt
Orion II Microplate Luminometer Software Simplicity
Zylux Corporation, Pforzheim
Thermomax microplate reader Molecular devices, UK
2.1.10 Kits
Tropix® Gal-Screen® assay Applied Biosystems, Foster City, CA, USA
CellTiter-Glo®Luminescent Cell Viability Assay
Promega, Madison, WI, USA
Luciferase Assay System (E1501) Promega, Madison, WI, USA
Wizard® Plus Midipreps DNA Purification System
Promega, Madison, WI, USA
![Page 27: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/27.jpg)
2 MATERIAL AND METHODS 19
2.1.11 Buffers and solutions
2 M CaCl2
Gaussia substrate dilution buffer: 0.1 M Tris, 0.3 M sodium ascorbate,
adjust pH to 7.4
10x HBS
8.18 g NaCl
5.94 g Hepes
0.25 g Na2HPO4 x 2 H2O
dissolved in 100 ml H2O, adjusted to pH 7.12
2.1.12 Media
Bacteria culture media
LB medium
10 g/l bacto tryptone, 5 g/l bacto yeast extract, 8 g/l NaCl, 1 g/l glucose, add 100 mg/l ampicillin prior to use
LB/AMP agar
add 15 g/l agar and 100 mg/l ampicillin to LB medium
S.O.C. medium LifeTechnologies/Invitrogen (Carlsbad)
Cell culture media
DMEM supplemented with
350 μg/ml L-glutamine 120 μg/ml penicillin 120 μg/ml streptomycin sulfate 10% (v/v) heat-inactivated FCS
used for TZM-bl, HEK293T, HeLa, HFF cells
RPMI 1640 supplemented with
350 μg/ml L-Glutamine 120 μg/ml penicillin 120 μg/ml streptomycin sulfate 10% (v/v) heat-inactivated FCS (add 10 ng/ml IL-2, 1 μg/ml PHA to stimulate PBMCs)
used for CEMx-M7, KG-1, K562, Jurkat T, BON and PBLs
![Page 28: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/28.jpg)
2 MATERIAL AND METHODS 20
EMEM supplemented with 350 μg/ml Glutamine 120 μg/ml penicillin 120 μg/ml streptomycin sulfate 1% Non-Essential Amino Acids (NEAA) 1mM Sodium Pyruvate (NaP) 10% (v/v) heat-inactivated FCS used for U-87 MG cells
CellGro® SCGM medium
supplemented with
100 ng/ml rhSCF 20 ng/ml rhIL-3 25 ng/ml rhIL-6 10% (v/v)heat-inactivated FCS used for human CD34+ cells which were obtained from the Institut für Klinische Transfusionsmedizin und Immungenetik, Ulm
2.2 Methods
2.2.1 DNA methods
2.2.1.1 Plasmid DNA preparation
Plasmid DNA for transfection was prepared using the WizardTM
Plus Midiprep Kit
according to the manufacturer´s protocol. The DNA concentration and quality was
determined using a Nano Drop 2000 spectrophotometer.
2.2.1.2 Restriction digest
Plasmid DNA was checked by incubating 1 µg of DNA with 0.5 μl of appropriate
restriction enzymes and 2 μl of the recommended 10 x NEB restriction buffer at 37 °C for
1 h on a thermomixer. Sterile water was added to a final volume of 20 μl.
2.2.1.3 Agarose gel electrophoresis
The restricted plasmid DNA was analysed by agarose gel electrophoresis. 20 µl of the
digested DNA was mixed with 5 µl loading dye and separated on 0.7% agarose gels
(containing 0.05 μg/ml ethidium bromide) in 1 x TAE buffer at 120 V for 30 min using the
Voltage PowerPAC Basic Power Supply. The 1kb+ ladder (Life Technologies GmbH,
Darmstadt) was used as a standard. DNA fragments were visualized with the Gel Doc™
XR system (Bio-Rad).
![Page 29: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/29.jpg)
2 MATERIAL AND METHODS 21
2.2.2 Bacterial methods
2.2.2.1 Bacterial culture
The used plasmids contained a gene coding for ampicillin resistance. Therefore,
transformed bacteria were grown in LB medium or on LB agar plates containing 50 µg/ml
ampicillin. The bacteria were grown in LB medium for 14-16 h at 37 °C on a shaker and
the inoculated LB agar plates were incubated at 37 °C.
2.2.2.2 Bacterial transformation
1 µg of plasmid DNA was incubated with 5 μl of Escherichia coli XL2 BlueTM cells on ice
for 20 min. After the cells were heat-shocked for 30 sec at 42 °C they were incubated on
ice for 2 min, followed by the addition of 200 μl SOC medium. The transformed cells were
incubated at 37 °C on a shaker for 30 min and plated on LB agar plates containing 50µg/ml
ampicillin. The plates were incubated at 37 °C in a compartment drier overnight.
2.2.3 Cell culture
2.2.3.1 Adherent and suspension cell culture
The adherent and suspension cells were maintained at 37 °C in an incubator in 5 % CO2
and 95 % air humidity. The cells were grown in 25 cm2 or 75 cm2 cell culture flasks
(Sarstedt, Nümbrecht) depending on the requirement of cells, in DMEM or RPMI-1640,
respectively. The adherent cells were split by trypsinization twice a week. Trypsin
treatment of cells was performed by removal of the culture medium from the cells. The
cells were washed with PBS and 1-3 ml trypsin was applied to the cells. The cells were
incubated at 37 ºC until they became detached. The cells were collected, centrifuged at
1,300 rpm for 3 minutes, resuspended in the fresh medium and re-seeded at a lower density
in new flasks. Suspension cells were collected and afterwards centrifuged at 1,300 rpm for
3 min and passaged 1:5 in fresh culture medium.
2.2.3.2 Isolation of primary blood cells
Buffy-coat (lymphocyte concentrate from 500 ml whole blood), obtained from the
Transfusion Center of the Ulm University Hospital, was diluted 1:3 with PBS containing
2% FCS. Ficoll separating solution was overlayed with the diluted blood and centrifuged at
515 g for 20 min without brakes. The white interphase layer formed by peripheral blood
![Page 30: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/30.jpg)
2 MATERIAL AND METHODS 22
mononuclear cells (PBMCs) was transferred in a fresh tube and washed twice with PBS
containing 2 % FCS.
Peripheral blood lymphocytes (PBL) were enriched from the PBMC fraction by
overnight plastic adherence at 37 °C to remove adherent monocytes. After separation
lymphocytes were cultured in supplemented RPMI culture medium and activated for 3
days with 20 ng/ml IL-2 and 2 µg/ml PHA prior to transduction.
Monocytes-derived macrophages: Monocytes were separated from lymphocytes by
adherence to tissue culture plastic (Nunc™ Cell Culture Treated Flasks, Thermo Scientific,
#136196) for 45 min. Non-adherent cells were removed by rinsing with RPMI medium.
Monocytes were stimulated with 10 ng/ml GM-CSF in RPMI cell culture medium. At day
3 the medium with growth factor was replaced and the cells were used for experiments at
day 7.
2.2.4 Viral methods
2.2.4.1 Virus stocks generation via calcium phosphate transfection of HEK293T cells
R5-tropic HIV-1 was produced by transient transfection of HEK293T cells with the
pBRHIV-1NL4-3_92Th014 construct using calcium phosphate precipitation. The calcium
phosphate transfection is a method for introduction of DNA into mammalian cells based on
the formation of a calcium phosphate-DNA precipitate (Graham and van der Eb, 1973;
Wigler et al., 1977). One day before transfection, 293T cells were seeded in 6-well plates.
At a confluence of 60-70 % the cells were used for transfection. For this 5 μg DNA per
well was mixed with 13 μl 2 M CaCl2 and the total volume was made up to 100 μl with
water. This solution was added dropwise to 100 μl of 2xHBS. The transfection cocktail
was vortexed for 5 sec and added dropwise to the cells. The transfected cells were
incubated for 8-16 h before the medium was replaced by fresh supplemented DMEM. 48 h
post transfection, virus stocks were prepared by collecting the supernatant and centrifuging
it at 805 g for 3 min. Virus stocks were quantified by p24 Elisa (AIDS Reagent and
Reference Programme, SAIC Frederick, USA) and stored at -80 °C.
Retroviral vectors were produced by transient transfection of HEK293T cells with calcium
phosphate using GFP encoding pSRS11 SF GFPpre, M57-DAW (gag/pol plasmid) and
glycoprotein expression plasmid. In the present study retroviral particles were pseudotyped
with Gibbon Ape Leukemia virus (GaLV), endogenous feline leukemia virus (RD114),
Vesicular Stomatitis Virus (VSV-G) or amphotropic Murine Leukemia Virus (MLV)
envelope glycoproteins. 24 hours prior to transfection, HEK293T cells were seed at 2 x 106
![Page 31: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/31.jpg)
2 MATERIAL AND METHODS 23
cells per 100 mm cell culture dish in DMEM 10 % FCS to achieve 70-80 % confluence at
the time of transfection. At the day of transfection DMEM medium was replaced with 10
ml medium containing chloroquine (final concentration of 25 μM). Chloroquine decreases
the intracellular degradation of plasmid DNA in the lysosomes, thus increasing the amount
of plasmid DNA that reaches the nucleus (Walker et al., 1996). Thereafter, 5 μg transfer
vector, 13 μg M57-DAW and 2 μg envelope plasmid were mixed directly with 0.25 mM
CaCl2 in dH2O (total volume - 500 µl). This is then added dropwise to the same volume of
2xHBS buffer where a precipitation of calcium phosphate occurs. The transfection cocktail
was vortexed for 5 sec and added dropwise to the cells. The medium was changed after 16
hours to avoid cell toxic effects of the chloroquine treatment. Supernatant containing the
viral particles was collected 48 hours after transfection, centrifuged at 805 g for 3 min and
used immediately for transduction or stored at -80ºC until required.
Luciferases expressing retroviral vectors were generated by co-transfecting a luciferase
encoding mouse leukaemia virus vector with M57-DAW and GaLV, RD114, VSV-G or
MLV glycoprotein expression plasmids using calcium phosphate precipitation as described
above.
Lentiviral vectors encoding GFP were generated by transient transfection of 293T cells as
described above. 4 µg pRRL.cPPT.SFeGFP.pre, 8 µg pRSV-Rev, 4 µg pMDLg/pRRE and
2-4 µg appropriate chimeric envelope glycoprotein with the cytoplasmic tail derived from
the MLV gp: phCMV-RD114/TR, phCMV-GaLV/TR, Ampho MLV (kindly provided by
F.L. Cosset) or VSV-G were used.
Luciferase encoding lentiviral particles were generated by cotransfection of an env-deleted
pBRHIV-1 NL4_3 derivative encoding luciferase instead of nef and constructs expressing
VSV-G, MLV or chimeric envelope glycoprotein derived from GaLV and RD114.
2.2.4.2 Determination of titer of retro- and lentiviral supernatants
Titers (transducing units/ml) of the viral supernatants were determined by transducing 105
HeLa cells with serial dilutions of viral supernatant.After 3 days post-transduction the
percentage of GFP positive cells was determined by FACS analyses.
![Page 32: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/32.jpg)
2 MATERIAL AND METHODS 24
2.2.4.3 Effect of EF-C on infection of TZM-bl reporter cell line
One day before infection, TZM-bl cells were seeded (10.000 cells/well) in F-96-well plates
(Greiner Bio-one, Frickenhausen). Virus stocks were normalized based on their amounts of
HIV-1 p24 capsid antigen. Infections were performed with 0.1 or 1 ng p24. 40 µl viral
stocks were treated with the 40 µl various dilutions of peptides, vortexed and incubated for
5 min room temperature. Concentrations of peptide during preincubation with virus were
100, 10, 1, 0.1 and 0.0 µg/ml. Subsequently, 20 µl of these virus stocks were used to infect
180 µl cell cultures. Infection rates were determined 2 or 3 days post infection by
quantifying β-galactosidase in cellular lysates.
2.2.4.4 Effect of EF-C on transduction efficiencies of different cell line
One day before transduction, adherent cells were seeded (10,000 cells/well) in F-96-well
plates (Greiner Bio-one, Frickenhausen). 200,000 suspension cells were seeded on the day
of experiment. Virus stocks were normalized based on their HeLa-transducing units
content. Transduction experiments were performed with viral vector stocks at a MOI of 1.
40 µl viral stocks were treated with the 40 µl various dilutions of peptides, mixed and
incubated for 5 min at room temperature. Concentrations of peptide during pre-incubation
with virus were 100, 10, 1, 0.1 and 0.0 µg/ml. Subsequently, 20µl of these virus stocks
were used to infect 180 µl cell cultures. After overnight incubation, supernatants were
removed and cells were further cultivated in 200 µl fresh media. Infection rates were
determined 2 or 3 days post infection by quantifying β-galactosidase or luciferase activities
in cellular lysates. After 3 days post transduction, cells were used for FACS analyses or
analysed by detecting luciferase activity in the cell supernatant.
2.2.4.5 Effect of EF-C on transduction efficiencies of primary cells
Transduction experiments with primary cells were performed with viral vector stocks at a
MOI of 1 and 10. Primary cells (PBL, macrophages, CD34+) were resuspended in virus
stocks containing 50, 25 and 0 µg of EF-C. After 4 hours incubation at 37 °C, cells were
washed and further cultivated in their own specific growth media. GFP positive cells were
determined 3 or 4 days later by using flow cytometry analysis.
2.2.4.6 EF-C mediated pull down assay
900 µl of R5-tropic HIV were mixed with 100 µl of EF-C (final concentration: 50 µg/ml)
or PBS. After 10 min incubation at the room temperature, stocks were centrifuged for 5
![Page 33: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/33.jpg)
2 MATERIAL AND METHODS 25
min at 10,000 g. Fig. 16a, b: The supernatants were collected and the pellets resuspended
to the original volume in PBS and cell culture medium DMEM. Both, pellets and
supernatants were used to infect TZM-bl cells. Infection rates were measured at day 2 post-
infection using β-galactosidase screen assay. Fig. 16c: The supernatant was collected and
the resulting pellet resuspended in 100 µl DMEM. The amount of HIV-1 p24 capsid
antigen in EF-C precipitated pellet and in the original virus stock was determined by a
HIV-1 p24 ELISA.
2.2.4.7 Comparison of infection enhancing activity of EF-C and others enhancers
Fig. 21a: 40 µl of freshly prepared EF-C, polybrene, protamine sulphate, DEAD dextran
and SEVI fibrils (obtained after overnight agitation) were serially diluted in PBS and
subsequently incubated with equal volumes of HIV-1 containing 0.1 ng p24 antigen.
Peptide concentrations during preincubation with virus were 50, 25, 12.5, 6.25, 3.1, 1.56,
0.78, 0.0 µg/ml. After 5 min incubation at room temperature 20 µl of these mixtures were
added to 180 µl TZM-bl cells (1 x 104/well) seeded the day before. After overnight
incubation, supernatants were removed and cell were further cultivated in fresh media.
Infection rates were determined 2 days later by quantifying β-galactosidase activities in
cellular lysates.
Fig. 22: 120.000 KG-1 cells were plated in 96-well plate in 100µl RPMI. Transduction
experiments were performed with viral vector stocks at a MOI of 1. 10µl of different
dilution of EF-C (1,000; 500; 250 µg/ml) or polybrene/protamine sulphate (320 µg/ml; 160
µg/ml) were added to 90µl VS, mixed and incubated for 5 min at room temperature. 100 µl
KG-1 cells were transduced with 100 µl of these mixtures. After overnight incubation,
supernatants were removed and cell were further cultivated in fresh RPMI media.
Transduction rates were measured 5 day later by FACS.
2.2.4.8 Coating experiments using EF-C and RetroNectin
RetroNectin was obtained from TAKARA (TAK T100B) and coated on “Non-Tissue
Culture Treated 96 well plates" (BD Biosciences #351172) as recommended by the
manufacturer.
Fig. 23b: 50, 10, 1 and 0 µg of EF-C per well were used to coat Costar 96 well plates over
night at 4°C. The next day, peptide was removed and plates were incubated with HIV-1 for
1 or 4 hrs. Wells were then washed once in PBS and bound virus was determined by p24
ELISA.
![Page 34: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/34.jpg)
2 MATERIAL AND METHODS 26
Fig. 24a: Four different microtiter plates (A: Thermo Scientific NuncTM Nunc F96
MicroWell™ Plates Polystyrene Clear No.:167008; B: Thermo Scientific NuncTM Nunc
F96 MicroWell™ Plates Polystyrene Clear No.: 442404; C: CORNING (96 well)
EIA/RIA Flat Bottom, High Bind, Nonsterile No.: 3590; D: CORNING (96-Well) Multiple
Well Cluster Plate TC Treated No.: 3596) were coated overnight at 4 °C with 10, 1, 0.1,
and 0.0 µg freshly diluted EF-C (50 µl each). Thereafter, the peptide solutions were
removed, wells washed and 50 µl HIV-1 R5 (0.1 ng p24 antigen) was added. After 4 hrs
incubation at 37 °C, virus was removed and 1 x 105 TZM-bl cells (200 µl) per well were
added, and 2 days later infection rates were determined by Gaussia-luciferase assay.
Fig. 24b: 50, 10, 1 and 0 µg of EF-C per well were added to Costar 96 well plates and
incubated overnight at 4 °C. Peptide was then removed and 50 µl of a lentiviral vector
containing the GaLV env was added to each well. 4 hrs later, the inoculum was removed
and wells were either washed once in PBS or left untreated. Thereafter, 1 x 106 KG-1 cells
were added. After 5 days, transduction rates were determined using FACS analysis.
2.2.4.9 Fusion assay.
This sensitive flow cytometry-based HIV-1 virion-fusion assay was conducted essentially
as described (Cavrois et al., 2002; Cavrois et al., 2004). VSV-G HIV-1 NL4.3 Env- GFP
containing BlaM-Vpr chimeric proteins were produced by triple-transfection of 293T cells.
Medium only and VSV-G HIV-1 NL4.3 Env- GFP BlaM-Vpr virions were incubated with
EF-C at the indicated concentrations and then added to TZM-bl cells. After 4 hours, cells
were washed and loaded with CCF2/AM dye overnight at room temperature. Fusion was
monitored by BD FACSCanto II Flow Cytometer and the corresponding software BD
FACS Diva. Since EF-C caused some auto-fluorescence in this assay, samples containing
EF-C in the absence of virus were used as negative control and subtracted from all values.
2.2.4.10 ß-galactosidase assay
HIV-1 infection rates in TZM-bl cells were quantified by removing the cell culture
medium 2 or 3 days post infection, adding 50 µl of 1:1 dilution of Gal-sceen® substrate
(Applied Biosystems, T1027) in PBS to each well. After 30 min incubation at room
temperature, 40µl of the cell lysates were transferred into a F-96-Nunclon-delta white
micro-well plate (NuncTM, Langenselbold) and the light emission was monitored with an
Orion Microplate Luminometer (Berthold Detection systems, Pforzheim). The enzyme
![Page 35: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/35.jpg)
2 MATERIAL AND METHODS 27
activity was measured as relative light units/second (RLU/sec) using the computer program
Simplicity 4.02 (Berthold Detection systems, Pforzheim).
2.2.4.11 Luciferase Assay
To detect transduction rates of luciferase encoding lentiviral and retroviral vectors,
suspension cells were pelleted by centrifugation at 1,300 rpm for 3 min. The supernatant
was then removed and cells were lysed in 40 µl 5-fold diluted Luciferase Cell Culture
Lysis Reagent (Promega, E1531). When adherent cells were used, the supernatant was
removed, and 40 µl Luciferase Lysis Buffer added. After 5 min, cells were resuspended
and 30 µl of the lysates were transferred into white microtiter plates. Thereafter, 70µl
luciferase substrate reconstituted in luciferase buffer (Luciferase Assay system, Promega,
E1501) was added, and luminescence was measured using a luminometer (Orion
microplate luminometer).
2.2.4.12 Cell Viability
To determine the effect of the peptides on cellular metabolic activity, different cell lines
were incubated with various concentrations of peptides under experimental conditions
corresponding to those used in the respective infection and transduction assays in the
absence of virus. After 2 or 3 days of incubation, CellTiter-Glo® Luminescent Cell
Viability Assay (Promega, G7571) was used as recommended by the manufacturer. Cells
were treated for three days with the indicated final concentrations of fibrils. Thereafter,
CellTiter-Glo® Buffer was thawed, equilibrated to room temperature, and mixed with
CellTiter-Glo® Substrate. The cell culture medium was removed, 100 µl fresh medium and
100 µl CellTiter-Glo® Reagent were added, agitated for 2 minutes to induce cell lysis,
pipetted into white lumiplates, and incubated for 10 min to stabilize the luminescence
signal. Luminescence intensities were the recorded in a luminometer (Orion microplate
luminometer).
2.2.4.13 Flow cytometric analysis
Adherent cells were washed once in PBS, trypsinized, resuspended in DMEM + 10% FCS,
transferred into FACS tubes, and pelleted for 3 min at 1,300 rpm. The supernatant was
removed, and after an additional washing step in PBS and subsequent centrifugation, cells
were fixed with 200 μl FACS buffer containing 2% paraformaldehyde and incubated for 30
min at 4 °C. Suspension cells were resuspended, transferred into FACS tubes, washed one
![Page 36: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/36.jpg)
2 MATERIAL AND METHODS 28
time in PBS and fixed as described above. FACS analysis was performed using the BD
FACSCanto II Flow Cytometer and the corresponding software BD FACS Diva.
2.2.5 Imaging methods
2.2.5.1 Fluorescence microscopy
To detect the interaction of EF-C fibrils with virion, fibrils were labelled with a
Rhodamine B dye (Rho-EF-C). 10 µl of Rho-EF-C (250 µg/ml) were mixed with 90 µl of a
MLV GAG YFP virus-like particles and 30 μl of this mixture were transferred to an IBIDI
μ-slide VI0.4 chamber (Ibidi) for visualization. To investigate the interaction of EF-C with
cells, 5 x 104 HeLa cells were seeded in 8 well slides and incubated overnight. Prior to
imaging, cell membranes were stained with CellMask™ Deep Red according to the
manufacturer's instruction (Invitrogen) and virus or Rho-EF-C/virus mixtures were added
to cells. For EF-C coating experiments on plastic slides and 3D reconstitution, EF-C (50
µg/ml) was stained with ProteoStat® Amyloid Plaque Detection Kit (Lörrach, Germany)
as per manufacturer’s instructions. EF-C was incubated for 10-12 hours on IBIDI slide.
Afterwards, EF-C was thoroughly washed with PBS and further incubated with YFP
labelled MLV-Gag virions for 1 hour. EF-C/virion complex was washed with PBS to
remove unattached virions. Fluorescence images were taken with the AxioVision software
ZEN 2009 using Zeiss LSM 710 confocal scanning equipment with a 63 × 1.4 NA
immersion oil objective.
2.2.5.2 Atomic force microscopy (AFM)
A 10 µg/ml infection-enhancing EF-C stock solution, prepared by diluting the peptide
dissolved in DMSO into Mili-Q water was further diluted to give a final concentration of 5
µg/ml. Next, 10 µL were added to a freshly cleaved mica surface and dried at 65 °C
overnight to remove DMSO. AFM measurements were performed on a Multimode III
AFM (Bruker) Images were analysed with the SPIP software version 5.1.5 (Image
Metrology A/S, DK). More than 50 individual fibrils were extracted and their geometrical
parameters were then analyzed to calculate the corresponding fibril diameters. Dr.
Christoph Meier (Institute for Organic Chemistry III/Macromolecular Chemistry,
University Ulm, Germany) performed the AFM analysis of the samples.
![Page 37: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/37.jpg)
2 MATERIAL AND METHODS 29
2.2.6 Proteomic methods
2.2.6.1 Thioflavin T (ThT) binding.
ThT stock solution (Sigma) was prepared by adding 8mg ThT to 10ml phosphate buffer
(10mM phosphate, 150mM NaCl, pH 7.0). This solution was filtered through a 0.2 µm
syringe filter, and further diluted 50-fold in PBS. 1.5 µl of a 1 mg/ml peptide stock
solutions were added to 148.5 µl Thioflavin T solution. Mixtures were vortexed and
transferred into Corning® CellBIND® 96 Well Flat Clear Bottom Black Polystyrene
Microplates (Corning). Fluorescence emission intensities were measured from 470 to 590
nm (band-pass 10 nm) using a spectrofluorometer (SAFAS flx Xenius n°5473, SAFAS).
2.2.6.2 CongoRed interaction.
Peptide solutions (10 µl) were placed into 1.5 ml tubes and 200 µl CongoRed (CR, Sigma
Aldrich, HT60-1KT) was added. The solutions were vortexed and incubated for 2 min at
room temperature. Stained amyloid was pelleted by centrifugation at 14,000 rpm for 5 min.
The supernatant was removed and the red pellet dissolved in DMSO (100 µl). This solution
was transferred into a 96-well plate and the optical density was measured at 490/650 nm
using Thermomax microplate reader (Molecular Devices Vmax).
2.2.6.3 ζ-potential measurement
For analyzing ζ-potentials of the fibrils, 50 µl of freshly prepared EF-C (1 mg/ml) were
diluted to 1 ml of an aqueous solution of KCl (10-3 M). The ζ -potential was derived from
the electrophoretic mobility of the peptides and measured using a Zeta Nanosizer (Malvern
Instruments, UK) and the corresponding DLS Nano software. Each measurement was
performed in triplicate. ζ-potentials of the buffers were measured and the values of each
buffer were subtracted from all corresponding samples.
![Page 38: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/38.jpg)
3. RESULTS 30
3. RESULTS
3.1 Identification of gp120 fragments that promote HIV-1 infection
To analyse the interaction of HIV-1 with its cellular receptors, synthetic peptides
corresponding to different regions of the external viral glycoprotein gp120 of HIV-1 strain
HxB2 were tested. For this purpose, a CCR5 tropic HIV-1 (R5 HIV-1) virus stock was
generated by transient transfection of HEK293T cells with proviral DNA. The viral titer
was determined by p24 ELISA and virus dilution containing 1 ng p24 antigen was treated
with different concentrations of freshly prepared gp120 fragments. After 5 minutes of
incubation, these mixtures were then used to infect the TZM-bl reporter cell line. Infection
rates were determined 3 days later by β-galactosidase assay. Surprisingly these rates
showed that one of the tested gp120 fragments (Enhancing Factor A; EF-A) efficiently
enhanced HIV-1 infection. In the presence of 12.5 µg/ml of EF-A infection rates of R5
HIV-1 were increased by 34 fold relative to control infections containing no peptide (0
µg/ml) (Fig. 6a). This peptide with the sequence NITLQCKIKQIINMWQEVG
corresponds to amino acids (aa) residues 413 to 431 of the HIV-1 gp120.
Figure 6. Identifikation of gp120 fragments that enhance HIV-1 infection. (a) The EF-A gp120 fragment enhances HIV-1 infection. Virus was treated with indicated concentrations of the peptide and mixtures were then used to infect TZM-bl reporter cells. Infection rates were determined 3 days after infection using β-galactasidase assay. The numbers above the bars give the n-fold enhancement of infection relative to that measured in the absence of EF-A. RLU/s, relative light units per second; the asterisk indicates over-infection. Data represent mean values ±SD obtained from triplicate infection. (b) Overview of analyzed gp120 fragments. The localization in the HIV-1 Env precursor is indicated schematically. Segments of gp120 are designated as follows: black boxes, conserved regions C1–C5; white boxes, variable regions V1–V5. Numbers correspond to the amino acid position in the HIV-1 strain HxB2 gp120 sequence. Active peptides are indicated in red. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 39: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/39.jpg)
3. RESULTS 31
Treatment of virus with 25 µg/ml of EF-A and subsequent infection of TZM-bl cells
caused massive virus induced cytopathic effect (CPE) which was observed by light
microscopy (data not shown). The reason for this phenomenon is overinfection of cells
(Fig. 6a). The cells became rounded, fused with adjacent cells and form a giant,
multinucleate cells called syncytia.
To confirm this effect of EF-A and to determine the minimal peptide fragment required for
infection enhancement, next seven length variants (B to H) of EF-A and another peptide
(EFcon) representing the consensus sequence of all strains of HIV-1 group M subtype were
synthesized (Fig. 6b). These peptides were analysed using the infectivity assay described
above. The peptides corresponding to C- (EF-B) and N-terminal (EF-H) halves of EF-A
did not enhance HIV-1 infection (Fig. 7), whereas peptides that contain the core region of
EF-A (aa residues 419 to 427 of gp120) promoted HIV-1 infection (Fig. 7). Moreover, the
size of peptide has played a decisive role, because too small peptides (EF-E and EF-G) did
not augment infection. In detail, treatment of 0.1 ng virus with 100 µg/ml of EF-C, EF-D,
EF-F and EFcon boosted HIV infection between 17 to 27 fold, while EF-B and EF-H
displayed no or slight effects (Fig. 7). The small 12-aa peptide (EF-C) with the sequence
QCKIKQIINMWQ was identified as the most effective enhancer (Fig. 7). This peptide has
been named Enhancing Factor C (EF-C).
Figure 7. Activity of various synthetic gp120 fragments in promoting HIV-1 infection. 0.1 ng R5 HIV-1 virions were treated with equal amount of different concentrations of freshly prepared gp120 fragments. After 5 min incubation, these mixtures were used to infect TZM-bl cells. Infection rates determined 2 days later by β-galactosidase assay. Shown are average values derived from triplicate measurements +/- SD. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 40: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/40.jpg)
3. RESULTS 32
3.2 gp120 fragments are not cytotoxic.
To analyse possible cytotoxic effects, freshly dissolved peptides, which enhanced HIV-1
infection, were incubated with TZM-bl cells for three days and then the metabolic activity
in these samples was assessed by CellTiter-Glo® Luminescent Cell Viability Assay
(Promega). This method is based on the use of the luciferase reaction to measure the
amount of ATP from metabolically active (viable) cells. Quantification of intracellular
ATP levels showed that none of the tested peptides affected cell growth and viability (Fig.
8a). Next, the effect of the most potent HIV enhancing peptide, EF-C, on the viability of
different cell lines and primary cells was tested using the same bioluminescence assay. The
TZM-bl cell line, a Jurkat leukaemic T-cell line, a progenitor like cell line (KG-1), a B/T
cell hybrid cell line (CEM-M7) and primary peripheral blood mononuclear cells (PBMC)
were incubated with various concentrations of EF-C peptide for 3 days. The cell viability
assay showed that EF-C has no toxic effects for the indicated cells (Fig. 8b), a high
metabolic activity was determined for all tested cells even in the presence of 100µg/ml of
EF-C.
3.3 gp120 peptides that enhance HIV infection form amyloid fibrils
Dissolving the peptide in Dimethylsulfoxid (DMSO) (10 mg/ml) prior to introduction into
the aqueous solution (1 mg/ml) promoted the formation of a turbid solution. This property
of EF-C seemed similar to earlier observations with SEVI. Freshly dissolved solution of
Figure 8. gp120 derived fragments are not cytotoxic. (a) Indicated peptide solutions were incubated with 1 x 105 TZM-bl cells for 3 days at 37°C. Metabolic activity was determined by CellTiter-Glo® Luminescent Cell Viability Assay (Promega). Shown are average values derived from triplicate measurements +/- SD. Concentrations shown are final cell culture concentrations. (b) Indicated cells were incubated with EF-C peptide for three days and cellular ATP concentrations were measured by the Cell Viability Assay. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 41: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/41.jpg)
3. RESULTS 33
chemically synthesized PAP248-286 is unable to increase infection. Upon overnight
agitation of PAP248-286 at 37 °C the solution became turbid and the enhancement activity
was restored (Münch et al., 2007). Biochemical and biophysical analyses showed that
positively charged amyloid fibrils were thereby formed. It was hypothesized that these
fibrils decrease the electrostatic repulsion between negatively charged viral and cell
membranes (Münch et al., 2007; Roan et al., 2007; Ye et al., 2009).
To determine whether the gp120 fragments may also form amyloid aggregates, the
reactivity of a freshly prepared peptide solutions to the amyloid specific dyes Thioflavin T
(ThT) (Biancalana et al., 2009) and Congo Red (Puchtler and Sweat, 1965; Elghetany and
Saleem, 1988) was analysed as described for SEVI (Münch et al., 2007). ThT is a
benzothiazole dye that exhibit enhanced fluorescence upon binding to β-sheet structure of
amyloid proteins and is commonly used to diagnose amyloid fibrils. ThT fluorescence
scans showed that solutions containing the peptides EF-C, EF-A, EFcon, EF-D and EF-F
displayed increased fluorescence intensities (Fig. 9a). Further evidence that gp120 derived
peptides form amyloid aggregates was derived by a Congo Red (CR) staining assay. Congo
red is a hydrophilic chemical agent that binds to amyloid fibrils and causes an apple green
birefringence under polarized light. In contrast to the PBS control, the EF-C, EF-A, EFcon,
EF-D and EF-F solutions formed a red coloured pellet after centrifugation, indicating the
dye specifically intercalated into the amyloid (Fig. 9b).
Figure 9. Formation of amyloid material by the indicated gp120 fragments monitored by (a) Thioflavin T fluorescence and (b) Congo Red staining. OD, optical density; CPS, counts per second. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 42: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/42.jpg)
3. RESULTS 34
Notably, ThT fluorescence intensities and results from Congo Red staining correlated with
the activity of gp120 fragments to increase virus infection and EF-C showed the highest
values (Fig. 10). In addition, EF-C, which was direct dissolved in PBS, contained only
minor amounts of Congo Red stainable material and was largely inactive. This indicates
that the activity of the gp120 fragments to enhance infection emerges from the presence of
amyloid aggregates.
For further clarification of the mechanism underlying infectivity enhancement, structure
and morphology of EF-C was analysed using atomic force microscopy (AFM) and ζ (Zeta)
potential measurement. AFM is a powerful technique that enables to visualize nanoscale
structures (e.g., amyloid fibrils) in an aqueous environment and measure their properties
(e.g., fibril size) (Stine et al., 1996; Mostaert et el., 2006). AFM analyses of an aqueous
EF-C peptide solution obtained immediately after diluting the peptide DMSO stock (10
mg/ml) tenfold in water (1 mg/ml) revealed the formation of fibrillary aggregates with a
diameter of 3.4 ± 0.1 nm (Fig. 11). This is significantly smaller than the diameter of SEVI
fibrils derived after overnight agitation (5.3 ± 0.1 nm) (Fig. 11), therefor I referred to EF-C
fibrils also as nanofibrils herein after.
Figure 10. Amyloid characteristics correlate with enhancement of HIV-1 infection. Values were derived from experiments shown in Fig. 7 and 9 a, b. Correlation analyses were performed with GraphPad Prism 5 software. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 43: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/43.jpg)
3. RESULTS 35
To determine the surface charge of the fibrils, the ζ-potential of the EF-C fibrils was
analysed. ζ-potential measurements showed that EF-C fibrils exhibit positive charges of
+17.7 ± 1.7 mV, similar to that of SEVI (+17.8 ± 1.1 mV). Summarized, this results show
that the EF-C peptide adopts a fibrillary structure with a β-sheet arrangement and a positive
surface charge.
3.4 Formation of EF-C fibrils can be achieved in several solvents and their virus enhancing activity is stable
For certain experimental setups it might be beneficial to dilute EF-C stocks (10 mg/ml in
DMSO) in other buffers than PBS to form fibrils. To test this, I diluted a 10 mg/ml DMSO
stock of EF-C in PBS, H2O or the cell culture media RPMI 1640 (Gibco) and DMEM
(Gibco). The resulting 1 mg/ml solutions were further diluted 3-fold and mixed with 1 ng
p24 antigen of R5 HIV-1. 105 TZM-bl cells in 180 µl were then inoculated with 20 µl of
these mixtures and infection rates were determined by luciferase assays 2 days later. EF-C
preparation in all tested solvents showed similar results and enhanced HIV-1 infection
from 12 x 104 RLU/s measured in the absence of peptide to 9.5-10 x 106 RLU/s if virions
were exposed to 100 µg/ml EF-C (13-fold enhancement) (Fig. 12a). Thus, amyloid fibrils
can be formed in different solvents that might be advantageous for several approaches, e.g.
in experiments with cells depending on specific media.
To find out how long the dilutions peptide in PBS retain their virus enhancing activity, a
10 mg/ml DMSO stock of EF-C was diluted twice in PBS (final concentration: 100 µg/ml).
Dilutions were then stored at 4°C or -20°C. After 2 weeks, both samples and a freshly
prepared EF-C solution were further diluted with 0.1 ng p24 antigen of HIV-1 and
analysed for their HIV enhancing activity 2 days later. Infection assays revealed that the
stored peptide solutions increased virus infection with almost the same activity as the
Figure 11. Atomic force microscopy image of SEVI and EF-C fibrils.
![Page 44: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/44.jpg)
3. RESULTS 36
freshly prepared peptide (Fig. 12b). Thus, EF-C peptide could be stored for at least two
weeks without losing its enhancing activity.
3.5 EF-C fibrils increase viral attachment and fusion
Like SEVI, EF-C fibrils are derived from a peptide with a net positive charge, suggesting
that the respective fibrils enhance infection by neutralizing the repulsion between the
negatively charged viral and cellular membranes (Münch et al., 2007). To directly
visualize the interaction of EF-C nanofibrils with virions, I labelled the nanofibrils with a
Rhodamine B dye (Rho-EF-C) and controlled their enhancing activity. Rho-EF-C fibrils
increase virus infection as efficiently as the unlabelled fibrils (Fig. 13a). After that, I
mixed labelled fibrils with CFP-labelled retroviral particles (MLV-CFP) and monitored
their interaction using fluorescence confocal microscopy (Fig. 13b). All virions (green)
associated with the fibrils (red) within seconds. In the presence of EF-C, no individual viral
particles could be detected, highlighting efficient and stable complex formation between
virions and fibrils (Fig. 13b).
Figure 12. The virus enhancing activity in EF-C dilutions is active in various solvents and media and is stable. (a) A 10 mg/ml DMSO stock of EF-C was diluted in either PBS, H20 or cell culture media RPMI1640 (Gibco) and DMEM (Gibco). Indicated concentrations of solutions were mixed with 1 ng R5 HIV-1. These mixtures were added to TZM-bl cells. Infection rates were determined 2 days later by luciferase assay. Shown are average values derived from triplicate measurements +/- SD. Concentrations given on the x-axes are EF-C concentrations during virion treatment. (b) Freshly prepared EF-C solution and samples, which were diluted and stored at 4°C or -20°C for two weeks, were analyzed for their HIV enhancing activity in TZM-bl cells as described above. Shown are average values derived from triplicate measurements +/-SD. Concentrations given on the x-axes are EF-C concentrations during virion treatment. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 45: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/45.jpg)
3. RESULTS 37
To further clarify the mechanism underlying EF-C-mediated infectivity enhancement, I
studied whether the fibrils increase virion attachment to the cell surface and subsequent
fusion into the target cells. 10µl of Rho-EF-C (250µg/ml) were added to 90µl CFP labelled
MLV virus, and the mixtures were then added to HeLa cells. Fluorescence microscopy
after 2 and 4 hours of incubation revealed that the amount of viral particles attached to the
cell surface in the presence of fibrils is drastically increased (Fig. 14a). The viral uptake
and internalization of fibrils was evident from the loss of fluorescence intensities after 24
hours (Fig. 14a). In parallel, the HeLa cells were inoculated with MLV-CFP alone. Images
obtained after 24 hours of incubation showed that only few viral particles were entry into
the cells (Fig. 14b).
Figure 13. EF-C fibrils bind viral particles. (a) Rho-labelled peptide boosts HIV infection as efficiently as unlabelled EF-C. Both peptides were dissolved in DMSO, diluted in PBS and used to treat HIV-1 particles that were subsequently used to inoculate TZM-bl cells. Infection rates were determined 2 days later by ß-galactosidase assay. Shown are average values from triplicate measurements. Concentrations given on the x-axes are EF-C concentrations during virion treatment, cell culture concentrations were 10-fold lower. (b) Confocal microscopy images of MLV-CFP virions alone, Rho-Envitra alone, or mixtures thereof including a 5-fold magnification of the latter. Scale bars, 15 µm. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 46: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/46.jpg)
3. RESULTS 38
To confirm the idea that EF-C efficiently delivers virions to the cell membrane and
enhances viral fusion, a flow cytometry-based HIV-1 virion-fusion assay was performed
(Cavrois et al., 2002). Therefore I produced VSV-G pseudotyped lentivirus particles
carrying a β-lactamase reporter protein (BlaM) which fused to the amino terminus of the
virion protein Vpr (BlaM-Vpr). During the fusion, BlaM-Vpr protein transfer into the
target cell and this transmission can be monitored by the enzymatic cleavage of CCF2, a
fluorescent dye substrate of β-lactamase, loaded into the target cells. Cleavage of the β-
lactam ring changes the fluorescence emission spectrum and this change can be detected
by flow cytometry. I inoculated TZM-bl cells with either PBS-treated or EF-C-treated
virus. After 4 hours, cells were washed and loaded with CCF2/AM dye overnight. Next
Figure 14. Kinetics of fibril/virion interaction wi th cells. (a) HeLa cells were inoculated with MLV-CFP in the presence of Rho-EF-C and images were taken at indicated time points. Final concentration of Rho-EF-C is 25µg/ml. Upper panel: all three channels are shown (red –fibrils, green – virus, blue – cell membrane. Lower panel: only the green (virus) channel is shown for the same pictures as in the upper panel. Scale bars, 15 µm. (b) HeLa cells (blue) were inoculated with either MLV-CFP (green) alone or in the presence of Rho-EF-C (red) and analysed by confocal microscopy after 24 hours. Scale bars, 15 µm. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 47: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/47.jpg)
3. RESULTS 39
day, the cells were washed and fusion was monitored with a BD FACSCanto II Flow
Cytometer (Becton Dickinson, San Jose, CA) (Fig. 15). Since EF-C caused some auto-
fluorescence in this assay, samples containing EF-C in the absence of virus were used as
negative control and subtracted from all values. Treatment of BlaM-Vpr with 50 µg/ml EF-
C resulted in 47% fused cells, whereas only 2.8% were fused in the absence of the
enhancer (Fig. 15). Thus, addition of EF-C fibrils increased attachment and subsequent
fusion of the viral particle to the target cells.
3.6 EF-C fibrils allow to concentrate viral particles
Nowadays, time-consuming ultracentrifugation is the most commonly used method to
concentrate retroviral stock solutions (Reiser, 2000; Bajaj et al., 2001; Gatlin et al., 2001;
Zhang et al., 2001). The efficient formation of macroscopic complexes between virions
and EF-C fibrils (Fig. 13b) prompted me to test whether this allows precipitation and
concentration of virions in a bench-top centrifuge. For this purpose R5 tropic HIV was
mixed with EF-C or PBS and centrifuged for 5 min at 10,000 g. The supernatants (used-up
medium) were taken and the pellets resuspended to the original volume in PBS and cell
culture medium DMEM (Fig. 16a). Both, pellets and supernatants were used to infect
TZM-bl cells. Βeta-galactosidase screen assay performed 2 days later showed that only the
pelleted fraction of EF-C increased reporter gene expression whereas the respective
supernatants lacked any virus enhancing activity demonstrating that the infectivity
Figure 15. EF-C fibrils enhance virion fusion. TZM-bl cells were transduced with a VSV-G pseudotyped BlaM-Vpr lentiviral vector in the presence of the indicated concentrations of EF-C and virion fusion was determined by FACS. The numbers in panels indicate the percentages of fused cells. Percentages from lower panel were subtracted from upper panel.
![Page 48: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/48.jpg)
3. RESULTS 40
enhancing fibrils of EF-C are pelletable (Fig. 16a, b). The PBS treated virus sample much
less infectious than fibril-treated virus. Thus, centrifugation of HIV-1 with EF-C fibrils
allowed precipitation of essentially all virions. One advantage of this approach is that
metabolized old medium of the virus stock can be easily exchanged by fresh medium of
choice. A second advantage is the possibility to easily concentrate virus by reconstituting
pelleted virus in a lower volume than the original one. To test this, 1,000 µl of EF-C
treated HIV stock was centrifuged at 10,000 g for 5 min. Afterwards, the supernatant was
collected and the resulting pellet resuspended in 100 µl DMEM. The amount of HIV-1 in
each fraction was determined by an HIV-1 p24 ELISA. The EF-C precipitated pellet
contained almost 1.2 µg capsid antigen whereas the original virus stock contained less than
100 ng (Fig. 16c). Thus, EF-C fibrils do not only allow to precipitate virus from a virus
solution but also to increase virus concentration by one single centrifugation step.
Figure 16. Nanofibrils bind viral particles and allow their precipitation and concentration. (a) Schematic drawing of the experimental outline to pellet virions. 10 ml of a virus stock preparation containing used-up medium was treated with PBS (1) or 50 µg/ml EF-C (2) and subjected to low speed centrifugation (5 min; 10,000 g; RT) After removal of used-up medium (3), the pelleted virions were resuspended in fresh medium (4) or buffer (5). Reducing the volume of resuspension medium allows the virus to be concentrated (6). (b) Infectivity of the resulting solutions. (c) p24 ELISA of the original virus stock (1) and EF-C-treated virus that was pelleted and resuspended in 1/10th of the volume of the medium used as the original stock (6). (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 49: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/49.jpg)
3. RESULTS 41
These results are of great importance because this fast and convenient fibril-based
approach allows to replace time-consuming (60-120 min) ultra-centifugation (50,000 g at
4°C) that is normally used to enrich virus. The convenient exchange of old and perhaps
toxic medium by EF-C along with the simultaneous increase of transduction efficiencies
could be particularly attractive for effective gene delivery into primary cells that require
special media. In sum, EF-C allows to precipitate and to concentrate virions by brief
centrifugation and simultaneously increases infection/transduction efficiency.
3.7 EF-C fibrils are potent enhancer of lenti- and retroviral transduction
Since low transduction rates represent a significant problem in retroviral gene transfer, the
effect of EF-C on transduction rates of relevant target cells by retro- and lentiviral vectors
was tested. I generated gamma-retroviral (MLV-derived) and lentiviral (HIV-derived)
particles expressing luciferase or GFP as transgene. These vectors were pseudotyped with
the Gibbon Ape Leukemia Virus (GaLV), the endogenous feline leukemia virus (RD114),
the Vesicular Stomatitis Virus (VSV-G) or the amphotrofic Murine Leukemia Virus
(MLV) envelope proteins. For the lentiviral vector truncated variants of GaLV and RD114
containing mutation in the cytoplasmic domain of Env were used. These Env proteins were
selected because they are commonly used for gene transfer and have already been tested in
animal models and/or in clinical trials (Burns et al., 1993; Dybing et al., 1997; Lee et al.,
2001; Relander et al., 2005).
At first, I analyzed the impact of EF-C on transduction of HEK 293T cells by luciferase
encoding lenti- and retroviral vectors pseudotyped with different glycoproteins. Luciferase
assays performed 2 days after transduction demonstrated that brief exposure to EF-C
enhanced transduction rates of all analysed vectors (Fig. 17a, b). For example luciferase
activities in cellular lysates transduced with untreated retrovirus particles resulted in values
below 5.0 x 105 RLU/s, whereas infection rates of nanofibril-treated virus were increased
up to 6.5 x 106 (RD114) or even 1.4 x 107 RLU/s (MLV) (Fig. 17b). Similar results were
obtained for lentiviral particles with the exception of the VSV-G pseudotype. Reporter
gene activities after infection with untreated vectors were below 3 x 104 RLU/s, but were
markedly increased after transduction with nanofibril-treated virions (1.6 x 105) (Fig. 17a).
The enhancing effect was dose-dependent and largely independent of the viral vector or
envelope. Notably, EF-C did not allow virus transduction in the absence of a functional
![Page 50: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/50.jpg)
3. RESULTS 42
Env protein (Fig. 17a, b). This indicates that EF-C fibrils do not allow unspecific entry
into target cells.
To further examine whether fibrils are suitable for therapeutic application, I examined their
capability to promote retro- and lentiviral transduction in a variety of cell types. GFP
encoding viral vectors commonly used in gene transfer settings (Naldini, 1997; Dull et al.,
1998; Zufferey et al., 1998; Schambach et al., 2006) were produced by transient
transfection of HEK 293T cells. Cell culture supernatants containing retro- or lentiviral
vectors harvested two days later were used for transduction. Treatment of GaLV
pseudotyped retroviral vector (RV-GaLV) with EF-C efficiently enhanced transduction of
the human epithelial cervical cancer HeLa cell line from 5% in the control to 98% after
100 µg/ml EF-C treatment (Fig. 18a). Gene transfer into the skin fibroblast is a promising
approach to treat inherited or acquired dermatological diseases (Wei et al., 1999).
Therefore, I tested whether EF-C nanofibrils enhance gene transfer into foreskin fibroblasts
(HFF) cell line. Treatment of RV-GaLV with EF-C resulted in 40.8% GFP positive cells 3
days post transduction whereas only 1.8% were transduced in the absence of the enhancer
(Fig. 18b), corresponding to a 23-fold enhancement of transduction rates.
Figure 17. EF-C fibrils boost gene transfer by various retro- and lentiviral particles. (a) Lentiviral particles were generated by co-transfection of 293T cells with an env-defective HIV-1 proviral construct containing the luciferase reporter gene and expression plasmids encoding the indicated viral glycoproteins. Freshly harvested virions were treated with the indicated concentrations of EF-C fibrils and used to transduce 293T cells. (b) Retroviral particles were generated by transfection of 293T cells using an MLV-based, luciferase encoding vector, the M57-DAW packaging plasmid and expression plasmids encoding the indicated viral Env proteins. Retroviral particles were treated with EF-C fibrils and used to infect 293T cells. Both panels give average values obtained from triplicate infections +/-SD. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 51: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/51.jpg)
3. RESULTS 43
I also performed experiments in non-adherent KG-1 cells, a human acute myeloid
leukemia cell line that represents an early stage of hematopoietic differentiation and that is
often used in colony formation assays instead of human bone marrow cells (Koeffler et al.,
1978). The rate of GFP expressing cells was 1.5 % in the control whereas treatment with
50 µg/ml EF-C led to GFP expression in 65.8 % of the cells (Fig. 19a). Thus, EF-C does
not only favour transduction of adherent cells but also of those growing non-adherent.
Furthermore, I transduced BON, a human pancreatic carcinoid cell line, and U87MG cell
line, a glioblastoma, astrocytoma cell line with RD114 pseudotyped lentiviral vector (LV-
RD114). Those cell lines have been widely used as models for translational study against
dangerous types of cancers, human pancreatic tumors and human malignant glioma (Yao et
al., 2007; Schmidt et al., 2013). In the presence of 50 µg/ml of EF-C, 83.5 % of BON cells
and 90.7 % of U87MG cells were GFP positive, whereas inoculation with untreated virus
showed transduction rates of 5% and 4.4 % respectively (Fig. 19b). In sum these results
show that EF-C nanofibrils generally facilitate transduction of different cell lines.
Figure 18. The enhancing effect of EF-C fibrils on viral transduction are cell-type independent. (a) FACS analysis of HeLa cells transduced with retroviral particles carrying the GaLV Env that were untreated or treated with the indicated concentrations of EF-C fibrils. (b) Analysis of HFF cells transduced with retroviral particles carrying the GaLV Env by fluorescence microscopy. The numbers in panels indicate the percentages of transduced (GFP+) cells. Scale bars, 50 µm. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 52: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/52.jpg)
3. RESULTS 44
To analyse the transduction enhancing activity of EF-C fibrils in primary cells, I
transduced PHA/IL-2 activated human peripheral blood lymphocytes (PBL) with LV-
RD114 in the presence or absence of nanofibrils. FACS analyses revealed that EF-C
nanofibrils increased the percentage of GFP positive cells after infection with a multiplicity
of infection (MOI) of 1 from 2.3 % to more than 24 % and after infection with a MOI of 10
to a maximum of 44% (Fig. 20a). To test, whether EF-C might also favour transduction of
macrophages that are considered as hard to transduce cells (Leyva et al., 2011),
monocytes-derived macrophages were transduced with a LV-RD114 stocks that were
either treated with EF-C fibrils or PBS. Flow cytometry and fluorescence microscopy 3
days after transduction revealed that 50 µg/ml of EF-C fibrils enhanced lentiviral gene
delivery into macrophages about 13-fold and allowed viral gene expression in almost half
of them (Fig. 20b).
Figure 19. EF-C fibrils potently enhance lentiviral transduction in different cell types. (a) FACS analysis of KG-1 cell line transduced with LV-RD114 that were untreated or treated with the indicated concentrations of EF-C fibrils. The numbers in panel indicate the percentages of transduced (GFP+) cells. (b) Effect of nanofibrils on lentiviral gene transfer into human glioblastoma U87MG cells and human endocrine pancreatic tumour cell line BON. The numbers above the bars indicate n-fold enhancement compared to the titer measured in the absence of peptide. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 53: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/53.jpg)
3. RESULTS 45
Next, I analysed whether EF-C enhances transduction of stem cells. Human CD34+
hematopoietic stem cells (HSC), which represent a major target in gene therapy studies,
were incubated with a LV-RD114 that has been treated with EF-C or PBS prior to
transduction. FACS analyses performed 4 days later showed that transduction of fibrils-
treated vector resulted in more than 25.6% of transduced and GFP positive cells, whereas
inoculation with untreated virus showed transduction rates of only 0.2% (Fig. 20c). These
results demonstrate that EF-C treatment of a vector preparation markedly enhanced gene
transfer into primary cells including HSCs.
3.8 Comparison between EF-C fibrils and other agents used to promote retroviral transduction
Next, I compared the efficiency of EF-C mediated enhancement with commercially
available enhancers like cationic compounds. Positively charged polymers such as
polybrene and (DEAE)-dextran enhance the attachment of the virus and subsequent
infection by bridging interactions between negatively charged viral and cell membranes.
Protamine sulphate is a highly cationic polypeptide derived from the sperm of salmon that
enhances retroviral gene transfer in a similar manner as cationic polymers. HIV enhancing
Figure 20. The enhancing effect of EF-C fibrils on viral transduction in primary cells. (a) Effect of nanofibrils on lentiviral gene transfer into human peripheral lymphocytes (PBL). The numbers above the bars indicate n-fold enhancement compared to the titer measured in the absence of peptide. (b) Analysis of monocytes-derived macrophages transduced with lentiviral particles carrying the RD114 Env by fluorescence microscopy. The numbers in panels indicate the percentages of transduced (GFP+) cells. Scale bars, 50 µm. (c) FACS analysis of CD34+ stem cells transduced with LV-RD114 that were untreated or treated with the indicated concentrations of EF-C fibrils. The numbers in panel indicate the percentages of transduced cells. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 54: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/54.jpg)
3. RESULTS 46
activity of EF-C was also compared with SEVI (Semen-derived Enhancer of Viral
Infection), amyloid fibrils that are generated from the fragments of prostatic acidic
phosphatase (PAP248-286) in semen (Münch et al., 2007). In detail, 0.1 ng R5 HIV-1 viral
stocks were treated with equal concentrations of freshly prepared EF-C, polybrene,
protamine sulfate, DEAE dextran and SEVI fibrils obtained after overnight agitation. After
5 min incubation, these mixtures were used to infect TZM-bl cells. Infection rates
determined 2 days later showed that EF-C fibrils enhanced HIV-1 infection more
efficiently than polybrene, protamine sulfate and DEAE dextran and was also slightly more
effective than amyloid SEVI fibrils obtained after overnight agitation (Fig. 21a).
Next, I tested the effect of EF-C, protamine sulfate, polybrene, DEAD dextran on the
metabolic activity of TZM-bl cells using the CellTiter-Glo® Luminescent Cell Viability
Assay (Promega). The cells were incubated with various concentrations of these
compounds for 3 days. Measurement of intracellular ATP levels showed that DEAD
dextran decrease metabolic activity of TZM-bl cells at the concentration 25 - 50 µg/ml
(Fig. 21b), whereas treatment the cells with EF-C nanofibrils, polybrene and protamine
sulphate has no toxic effect for the cells (Fig. 21b).
Figure 21. Comparison of infection enhancing properties of EF-C fibrils and others enhancers. (a) Indicated compounds were serially diluted and subsequently incubated with HIV particles. 20 µl of these mixtures were used to infect 180 µl TZM-bl cells. Infection rates were determined 2 days later by quantifying ß-galactosidase activities in cellular lysates. Concentrations shown are those during virion treatment. (b) Indicated compounds were incubated with TZM-bl for 3 days and cellular ATP concentrations were measured by the Cell Viability Assay. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 55: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/55.jpg)
3. RESULTS 47
In addition, the effect of EF-C, polybrene and protamine sulphate on transduction rates of
KG-1 cells was tested by retroviral vector carrying the GaLV GP (Fig. 22). For this
experiment, concentrations of polybrene and protamine sulphate were reduced to 8 and 16
µg/ml as recommended by literature (Davis et al., 2002; Cornetta et al., 1989). EF-C
nanofibrils increased the percentage of GFP expressing cells from 1.5 % in the control to
almost 56.2 % after treatment with 25 µg/ml EF-C, whereas only 2.6 % and 6.6 % cells
were transduced after addition of 8 µg/ml of protamine sulphate or polybrene respectively
(Fig. 22). In sum, compared to polybrene, protamine sulphate and DEAE dextran, EF-C
nanofibrils are more effective and less toxic.
3.9 Immobilized EF-C nanofibrils capture virus and increase transduction.
Currently, the most effective method to boost retroviral gene transfer is based on the use of
the fibronectin derivative RetroNectin (Williams et al., 1991; Hanenberg et al., 1996;
Moritz et al., 1996; Hanenberg et al., 1997). RetroNectin needs to first be pre-coated onto
plates. The heparin domain of RetroNectin binds the viral particles this allows to remove
the utilize virus medium. Finally the target cells attach to the cell-binding domain of
RetroNectin. The co-localization of virions and cells in close proximity increased cellular
uptake of the virus. I analysed whether EF-C nanofibrils can be applied in an analogue
Figure 22. Comparison of transduction efficiency of EF-C fibrils, polybrene (PB) and protamine sulphate (PS). Indicated concentrations of enhancers were incubated with GaLV pseudotyped retroviral particles and subsequently used to infect 2 x 105 KG-1 cells. Transduction rates were determined 5 days later by FACS. Concentrations shown are those during cells treatment.
![Page 56: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/56.jpg)
3. RESULTS 48
manner. For this, plastic slides were coated with Rho-EF-C and incubated with YFP-
tagged retroviral particles. Confocal microscopy analyses showed that the fibrils were
immobilised on the surface and efficiently captured virions (Fig. 23a). The binding of
lentiviral particles to the dishes was demonstrated in a p24 ELISA (Fig. 23b). For that,
various concentrations of EF-C were coated on routinely used microtiter plates (Costar,
#3596) over night at 4°C. The next day, peptide was removed and plates were incubated
with HIV-1 for 1 or 4 hrs. Then, the wells were washed once in PBS and bound virus was
determined by p24 ELISA. The results showed that immobilised fibrils capture virions and
this occurred in a time- and dose-dependent manner (Fig. 23b).
To test if immobilized EF-C fibrils enhance viral infection, four microtiter plates obtained
from different providers (A: Thermo Scientific NuncTM Nunc F96 MicroWellTM Plates
Polystyrene Clear, #167008; B: Thermo Scientific NuncTM Nunc F96 MicroWellTM Plates
Polystyrene Clear, #442404; C: CORNING (96 well) EIA/RIA Flat Bottom, #3590; D:
CORNING (96 well) Multiple Well Cluster Plate TC Treated, #3596) were incubated with
freshly diluted EF-C. The next day, the solutions were removed and HIV-1 added. After 4
hours of incubation, the virus inoculum was removed and TZM-bl reporter cells were
plated. In some control samples, the virus inoculum has not been removed and cells were
directly added to the virus (ctrl). Beta-galactosidase assays performed 2 days later revealed
that infection rates of cells added to EF-C coated plates were strongly increased (Fig. 24a).
Figure 23. Coated EF-C fibrils can capture viruses. (a) Z-stack images of immobilised EF-C (top left), virus only (bottom left), immobilized EF-C exposed to virus (right); the upper image shows both channels (merged), the inlets below separately. (n) – number of capture viruses. (b) Indicated amounts of EF-C were used to coat standard cell culture plates over night at 4°C. The next day, peptide was removed and plates were incubated with HIV-1 for 1 or 4 hrs. Wells were then washed once in PBS and bound virus was determined by p24 ELISA. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 57: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/57.jpg)
3. RESULTS 49
Maximum enhancement was observed for all 4 dishes between 1-10 µg EF-C per well
(Fig. 24a). Importantly, infection rates observed in control samples were even lower than
those observed in wells that were coated with nanofibrils and where the whole inoculum
has been removed (Fig. 24a). Similar experiment was performed with GaLV pseudotyped
retroviral vector and KG-1 cells. Analyse of flow cytometric data showed that EF-C
nanofibrils coated onto plates increased the transduction rates of suspension cells by more
than 5-fold (Fig. 24b). Thus, EF-C can be coated onto the surfaces of cell culture dishes
allowing to increases viral infection and transduction rates.
To compare the ability of immobilized RN and immobilized EF-C nanofibrils to promote
retrovirus transduction, both compounds were tested in a site by site approach. Microtiter
plate from BD Bioscience (#351147) that was recommended by TAKARA BIO INC was
coated with RetroNectin. Routinely used microtiter plate from Costar (#3596) was coated
with EF-C. Both plates were then incubated with similar amounts of a RV-GaLV for 4
hours. RN coated microplate was washed as recommended by the manufacturer and EF-C
fibrils coated microplate was washed with 100 µl PBS. Thereafter, KG-1 cells were plated
and the transduction rates were measured by FACS analysis. The results showed that both
Figure 24. Immobilized EF-C nanofibrils capture virus. (a) EF-C fibrils that have been coated on different microtiter plates facilitate viral infection. See text for detail information. (b) Immobilized EF-C fibrils boost lentiviral vector transduction into KG-1 cells. Freshly diluted EF-C was added to Costar 96 well plates and was incubated over night at 4°C. Peptide was then removed and 50 µl of a lentiviral vector containing the GaLV GP was added to each well. 4 hrs later, the inoculum was removed and wells were either washed once in PBS or left untreated. Thereafter, 1 x 106 KG-1 cells were added. After 5 days, transduction rates were determined using FACS analysis. ctrl, control in which the inoculum was not removed. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 58: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/58.jpg)
3. RESULTS 50
compounds dose dependently increased the rate of GFP expressing cells to a maximum of
~ 11% (Fig. 25a). This value was reached in the presence of 1.2 µg of RetroNectin or 10
µg of EF-C. Interestingly, transduction rates in the absence of RetroNectin in BD
Bioscience microtiter plates were lower than those in the absence of EF-C in tissue culture
treated plates from Costar (Fig. 25a), suggesting that cell growth in non-tissue BD
Bioscience plates might be compromised.
To compare the effects of soluble RetroNectin and EF-C, HIV-1 virus stocks containing 1
ng p24 antigen were incubated with 0, 0.8, 4, 20 µg/ml enhancer and used to infect TZM-
bl cells. EF-C nanofibrils strongly enhanced infection whereas treatment of virus stocks
with RetroNectin had no effect (Fig. 25b). Additionally, the activities of EF-C fibrils and
RetroNectin were compared under conditions in which the target cells were incubated first
with compounds. TZM-bl cells were incubated with 0, 0.8, 4 or 20 µg/ml enhancer and
subsequently infected with HIV-1. Also under these conditions, EF-C nanofibrils potently
favoured infection, whereas levels of infection in cells treated with RetroNectin were
comparable to those not treated by any enhancer (Fig. 25b). In sum these results
demonstrate that in contrast to RetroNectin that is active only if bound on surfaces, EF-C
potently enhanced viral infection when added to virions directly, or when used for
treatment target cells before infection.
Figure 25. Comparison of infection enhancing properties EF-C fibrils and RetroNectin. (a) Coated EF-C fibrils (EN) enhance viral transduction with similar efficiency as RetroNectin (RN). Retroviral particles were added to RN-coated or EN-coated plates and incubated with KG-1 cells. (b) In contrast to RN, EF-C fibrils enhance infection by directly treating virions or cells. Nanofibrils or RN were mixed with cells (left) that were subsequently infected with HIV-1, or mixed with HIV-1 virions (right) that were then used to infect cells. Infection rates were determined 2 days later. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
![Page 59: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/59.jpg)
3. RESULTS 51
Figure 26. Additive effects of RetroNectin and EF-C nanofibrils. Virions were added to RN-coated plates and upon removal of the inoculum, KG-1 cells in the presence or absence of fibrils-treated virus were added. (Reprinted with friendly permission from Yolamanova, Meier et al., 2013, Nature Nanotechnology, 8(2):130-136. Copyright © by Macmillan Publishers Limited)
Finally, it was examined whether EF-C fibrils and
RetroNectin can be used in combination. The plate from
BD Bioscience was coated with 6 µg of RetroNectin and
incubated overnight at 4 °C. The microplate was washed
as recommended by the manufacturer and retroviral
particles pseudotyped with GaLV Env were inoculated.
After 1 hour virus stock was removed and 106 KG-1 cells
were plated in each well. Further RV-GaLV stocks were
treated with EF-C nanofibrils or PBS and after 5 min
incubation these mixture were added to the KG-1 cells.
The results showed that fibrils-treatment increases the
strong enhancement of lentiviral transduction of KG-1
cells by RetroNectin treatment even further by up to 5-
fold (Fig. 26). Hence, both methodologies can be
combined to achieve maximal gene transfer efficiencies.
![Page 60: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/60.jpg)
4. DISCUSSION 52
4. DISCUSSION
4.1 Application of EF-C nanofibrils as enhancer of transduction efficiency.
Retroviral gene transfer is the method of choice for the stable introduction of genetic
material into cells and offers many prospects for basic research and for the treatment of
genetic disorders, malignancies and infectious diseases. The low titer of infectious virions
in the stocks is one of the major limitations of retroviral gene transfer. To produce high-
titered virus stocks various approaches like the development of new viral vectors systems,
the optimization of transfection protocols and ultracentrifugation were established (Kotani
et al., 1994; Reiser, 2000; Bajaj et al., 2001; Gatlin et al., 2001; Zhang et al., 2001).
Furthermore, work with retrovirus vectors is often hampered by low transduction rates,
particularly into primary cells. Transduction efficiency is determined by rate of virus
attachment to the target cell. Viral adsorption can be divided into three steps: (i) passive
diffusion of virions to the proximity of the cell, (ii) nonspecific binding of the virus to the
cell surface and (iii) binding of the viral glycoproteins to a specific cell surface receptor
that triggers the subsequent fusion (Davis et al., 2002). Passive diffusion can hamper by
electrostatic repulsion forces from the negatively charged phospholipid bilayers of
retrovirus and cell. Frequently used strategies to overcome this obstacle are low speed
centrifugation of virions together with their target cells and/or treatment with cationic
compounds, such as the hexadimethrine bromide (polybrene), the diethylaminoethyl
(DEAE)-dextran, protamine sulfate, poly-L-lysine, or cationic liposomes (Hodgson and
Solaiman, 1996; Vogt, PK, 1967; Cornetta et al., 1989; Hennemann et al., 2000). These
compounds are thought to reduce the repulsion forces between the cell and the virus and
mediate the binding of retroviral particle to the cell surface resulting in a higher efficiency
of transduction. The big disadvantage of some cationic polymers, like polybrene and
DEAE-dextran, is their cytotoxicity. Therefore, these compounds are used at only low
concentrations (4–20 μg/ml) (Toyoshima and Vogt, 1969; Manning et al., 1971; Cornetta
and Anderson, 1989). Furthermore, application of polybrene has a negative impact on cell
proliferation in primary cells, such as keratinocytes or human mesenchymal stem cells,
even when it is used at low concentrations (Seitz et al., 1998; Lin et al., 2010). Currently,
the most common method to increase the efficiency of retroviral transduction is coating of
the cell cultures dishes with RetroNectin, a fibronectin derivative which has been
discovered almost 20 years ago (Hanenberg et al., 1996; Moritz et al., 1996; Hanenberg et
al., 1997). When RetroNectin is coated onto cell culture dishes it induces the colocalization
![Page 61: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/61.jpg)
4. DISCUSSION 53
of virus particles and target cells in close proximity resulting in increased transduction
efficiencies. However, utilization of RetroNectin is relatively time consuming and
expensive. Thus, improved convenient, flexible and effective transduction enhancers are
still needed. Novel classes of transduction enhancers are peptide-derived amyloidogenic
fibrils. It has been found that fibrils derived from human semen strongly enhance HIV-1
infection (Münch et al., 2007) and allow to improve viral gene transfer (Wurm et al., 2010;
Wurm et al., 2011). These fibrils, termed semen-derived enhancer of virus infection
(SEVI), bind virions and increase their adsorption to cells and subsequent fusion.
However, SEVI also has some drawbacks for a use as transduction enhancer. Firstly, the
amyloidogenic peptides that form SEVI are relatively large (38 amino acids) and thus
expensive to produce. Secondly, it takes hours to generate the active fibrils (Münch et al.,
2007). Finally, very large aggregates that are less effective in boosting retroviral
transduction may form after long-term storage (Münch J, personal communication).
Newly, Fenard et al. identified the new viral entry enhancer, Vectofusin-1. This histidine-
rich cationic amphipathic peptide efficiently enhance gene transfer of lentiviral vectors into
human CD34+ cells by promoting the adhesion and the fusion between viral and cellular
membranes, without inducing toxicity (Fenard et al., 2013). Vectofusin-1 shows similar
efficiencies as RetroNectin with the advantage that it can be easily synthetized and
purified.
In this study a small HIV-1 gp120-derived peptide named EF-C that instantaneously
formed nanofibrils which greatly increased HIV-1 infection was investigated. This peptide
effectively boosted the efficiency of lenti- and retroviral gene delivery into various cell
types. EF-C nanofibrils increased the efficacy without affecting the specificity of retro- or
lentiviral gene delivery suggesting that the fibrils might also boost recently developed
lentiviral vectors that are based on specific single chain antibodies recognizing their
cognate cell surface antigens (Anliker et al., 2010). This is noteworthy, because many gene
therapy approaches aim to target specific cell types to avoid possible avoid side effect.
Moreover, EF-C allowed to cross-link viral particles and to precipitate them by low speed
centrifugation. The precipitated virions remained fully infectious and could be dissolved in
the medium and volume of choice prior to transduction. Thus, EF-C represents a
convenient and effective tool to concentrate virions, and to remove toxic compounds that
may affect the functionality of the target cells. EF-C facilitated higher efficiency of viral
transduction compared to polybrene, protamine sulphate, DEAE dextran and SEVI. EF-C
was tested as non-cytotoxic for several cell lines and primary cells. Additionally, to
![Page 62: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/62.jpg)
4. DISCUSSION 54
exclude negative effect of EF-C on hematopoietic stem cell differentiation capacity, our
colleagues from Institute for Clinical Transfusion Medicine and Immunogenetics (DRK
Blood Service Baden-Württemberg, Ulm, Germany) examined the CD34+ cells in Colony
Forming Cell Assays. The results showed that EF-C did not affect differentiation capacity
of human stem cells (Yolamanova, Meier et al., 2013). Thus, in contrast to the former
enhancers, it can be used for gene transfer into sensitive primary human cells, such as
macrophages or hematopoietic stem cells. Lack of cytotoxicity in these cell types has also
been reported for amyloid SEVI fibrils (Wurm et al., 2011). When compared to
RetroNectin EF-C fibrils can be used to promote viral gene transfer in a more flexible and
simple manner, because it is/was added to the virions or to the target cell culture prior to
transduction. Usage of EF-C nanofibrils instead of RetroNectin reduces the workflow from
100 minutes (not including the overnight incubation after coating and the second spin-
infection step) to 10 minutes. Notably the highest transduction efficiencies were observed
when RetroNectin and EF-C nanofibrils were combined. Thus, treatment with EF-C has
significant advantages over other methods that are currently employed to increase lenti- or
retroviral transduction efficiencies, EF-C fibrils have no effect on cell viability of the
transduced cells and differentiation capacity of stem cells and might be suitable tool for
gene therapy.
In mice studies, which were carried out in the Department of Experimental Dermatology
and Allergic Diseases (Ulm University, Ulm, Germany), the effects of EF-C nanofibrlis
and RetroNectin on viral gene delivery were compared. For this, lineage depleted bone
marrow cells were transduced ex vivo (i) in the absence of enhancers; (ii) using a
commonly used multi-step RetroNectin protocol including a spin transduction (Zhou et al.,
2001); (iii) or a one-step approach using EF-C-treated virus. The results showed that
RetroNectin and EF-C fibrils increased transduction rates from 3.1 % in the control to 23.9
% and 18.9 %, respectively. Transplantation of these cells into recipient mice showed no
obvious side effects, and engraftment was determined by blood cell analysis 4 and 12
weeks later. The results showed a significantly higher proportion of transduced cells in the
RetroNectin (19.7 % and 12.3 %) and EF-C (13.5 % and 6.1 %) groups compared to the
control mice (0.1 %) (Yolamanova, Meier et al., 2013). Notably, brief EF-C treatment
resulted in almost similar transduction and engraftment rates as the multi-step RetroNectin
protocol, which involves an additional spin-transduction step and thus exposure of the cells
to twice as much virus. Taken together, EF-C represents a convenient and effective tool to
boost lenti- and retroviral gene delivery, to concentrate virions, and to remove toxic
![Page 63: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/63.jpg)
4. DISCUSSION 55
compounds that may affect the functionality of the target cells, and is suitable for ex vivo
gene therapy applications.
A possible drawback of EF-C for clinical application is that it attached to and was taken up
by the cells and would thus be transferred to the patients. However, in the mice studies we
did not observe any side effects after transplantation of EF-C treated cells over 12 weeks of
follow-up. The lack of toxicity in cell culture suggests that the amyloid fibrils may just be
degraded without causing undesired effects. The possible induction of antibodies to EF-C
cannot be excluded but would not represent a major caveat because most clinical gene
transfer studies aim for a single treatment. However, follow-up studies on the fate of
nanofibrils in the cells or tissues seem highly necessary.
4.2. Analysis of the mechanism of fibril-mediated enhancement of viral infection.
Beside the application of amyloidogenic fibrils as efficient transduction enhancer, the
mechanism of fibril-mediated enhancement of viral infection is of great interest. It is
highly likely that EF-C fibrils promote virion attachment by serving as a bridge between
the virions and the cells allowing them to overcome the repulsion between the negatively
charged membranes as it has been proposed for cationic compounds like polybrene and
protamine sulphate (Davis et al., 2002). Indeed, it has been previously established that the
cationic properties of SEVI and other semen-derived amyloidogenic peptides are necessary
for efficiently promoting virus infection (Münch, et al, 2007; Roan et al., 2009; Arnold et
al., 2012). Roan et al. showed that a negatively charged SEVI variant, in which lysines and
arginines were replaced by alanines, was capable to form amyloid fibrils, but does not
efficiently enhance HIV-1 infection (Roan et al., 2009). Moreover, addition of polyanionic
compounds like heparin to fibrils or to the targets cells abrogate the enhancing activity of
SEVI and other semen-derived fibrils as heparin shields the charged surface of the fibrils
(Roan et al., 2009; Arnold et al., 2012). Recently, Zhang et al. identified another 13-
residue peptide in the HIV-1 gp120 glycoprotein which also form amyloid fibrils and
augment HIV-1 infection. They termed this peptide P13 and extend them with three lysine
amino acids at its C-terminus to increase its cationic charge (Zhang et al., 2013). The
modified peptide was designated as P16 and exhibited a pI of 10.48 and a net charge of +3.
It has been also observed that mutation form of P16, which contained alanine residues
instead of tryptophan, formed fibrils but much less enhanced infection. Furthermore,
anionic polymer completely blocked the activity of peptide to boost virus infection. These
![Page 64: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/64.jpg)
4. DISCUSSION 56
interesting observations also show that electrostatic interaction is driving in fibril mediated
HIV infectivity enhancement.
Indeed the EF-C sequence contains positively charged basic residues and has a net charge
of +2 and an isoelectric point of 9.9. Zeta potential measurements revealed that EF-C
nanofibrils display a positively charged surface (+17.7±1.7 mV). Furthermore, our
colleagues from Institute of polymer science (University of Ulm, Germany) constructed a
structural model of the peptide nanofibrils. The resulting fibril model suggests that the
lysine side chain forms a hydrophilic surface with a high density of cationic charges at
physiological pH (Yolamanova, Meyer et al., 2013). Besides, it is conceivable, that the
magnitude of the enhancing effect will depend on the intrinsic capability of both virions
and cells to interact. The results derived from pseudotyped experiment with lentivirus
based virion showed that EF-C fibrils had only a moderate effect on transduction rates of
VSV-G carrying particles (Fig. 17a). The similar results were observed in the same
experiments with SEVI (Münch J, personal communication). I hypothesised that amount of
glycoproteins on the viral envelope can play substantial role in the mechanism of
enhancing activity of amyloid fibrils. HIV-1 virions carry usually only 8 to 10 Env trimers
per virus particle (Zhu et al., 2003), whereas about 400 envelope glycoprotein incorporated
in the VSV-G particle (Brown et al., 2010). The high density of glycoproteins on the
surface of VSV-G particle probably shields the negatively charge of phospholipid bilayer
of virus and makes the amyloid fibrils less effective for enhance infection. It would be
interesting to control in additional experiments whether the degree of virus infection
enhancement indeed correlates with amount of envelope glycoproteins. For this purpose
pseudoparticles with low, median and high amounts of VSV-G glycoprotein should be
generated and used for comparative analyses with amyloidogenic peptides.
Noteworthy, cationic properties do not seem to be an absolute requirement for the
enhancement of HIV infection by amyloid fibrils. Another interesting aspect in the
mechanism of enhancement activity is the self-assemble of peptide into fibrils. It has
previously been shown that amyloid fibrils in semen promote HIV-1 infection, whereas the
monomeric peptide has no effect (Münch et al., 2007; Roan et al., 2011; Arnold et al.,
2012). Albeit the EF-C peptide possesses a positive net charge, H2O or PBS dissolved EF-
C had no effect on infection. However dilution of DMSO-dissolved peptide in H2O or PBS
potently enhanced infection and transduction rates, this solution became turbid and
formation of fibrils could be observed by Thioflavin T binding and Congo red staining.
Existence of amyloid fibrils was further confirmed by atomic force microscopy, X-Ray
![Page 65: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/65.jpg)
4. DISCUSSION 57
powder diffraction and circular dichroism spectroscopy (Yolamanova, Meyer et al., 2013).
Like SEVI, EF-C adopts a classic cross β amyloid structure in which β-sheets run
perpendicular to the axis of the fibrils. This indicates that in addition to cationic properties
of EF-C, fibril formation is a prerequisite for EF-C enhancement activity Moreover, EF-C
is usually even more effective than SEVI in boosting retro- and lentiviral gene transfer.
The reason for this is most likely that EF-C consists of small amyloid nanofibrils, whereas
SEVI forms large amyloid fibrils that may be too immotile to make efficient contact with
the target cells. Interestingly, negatively charged SEVI was capable to slightly enhance
virus infection (Roan et al., 2009). This can be explained by formation of a fibril network,
which captures the virus via hydrophobic interaction. Fibrils-virus complexes, which due
to their large size rapidly sediment onto the target cells, increase the rate of infection.
Since the cross β-sheet structure is common to all amyloid proteins but the ability to
enhance viral infection possess not all amyloid fibers even with positively charge surface.
For example, bacterial amyloid curly protein which also formed positively charged fibrils
(net charge of +5, pI of 9.9) do not enhance viral infection (Hartmann et al., 2012). Hence,
enhancement of virus infection rates is an intrinsic property of amyloid structure.
An interesting question is whether it is just coincidence that gp120 fragments form fibrilar
virion attachment factors or whether HIV-1 generates its own enhancer to facilitate viral
spread. It has been estimated that the sum of soluble, cell- and virion-associated gp120 in
HIV-infected individuals reaches up to 5 µg per ml blood (Cummins et al., 2010). Even if
all gp120 molecules are degraded to EF-C fragments, this would only result in
concentrations of approximately 50 ng/ml of the fibrils, which is far below those required
to enhance HIV infection in vitro. As mentioned above fibril formation is a prerequisite for
EF-C mediated transduction enhancement. For fibril formation EF-C has to be dissolved
first in organic solvent, conditions that are not found in vivo. Altogether, it seems unlikely
that gp120 fragments play a significant role for HIV-1 replication in vivo. Other amyloids,
however, may well play a relevant role in virus spread and the pathogenesis of AIDS
because amyloid deposits are fairly common (Green et al., 2005) and ß-amyloid fibrils
associated with Alzheimer`s or other diseases also promote HIV-1 infection (Wojtowicz et
al., 2002).
In sum, EF-C is an effective, simple, and inexpensive tool to boost viral gene delivery into
various cell types. Moreover, this peptide has great potential as enhancer of viral
transduction because it can be easily modified with various functional groups that raise its
natural ability to self-assemble into nanofibrils and increase their stability in vivo models.
![Page 66: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/66.jpg)
4. DISCUSSION 58
Therefore application of EF-C and its derivatives will significantly facilitate the utilization
of retro- and lentiviral vectors in basic research and potentially in the treatment of human
diseases.
![Page 67: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/67.jpg)
5. SUMMARY 59
5. SUMMARY
Low transduction efficiencies are a common problem in retro- and lentiviral gene transfer.
Here, I have presented a new approach to boost retroviral gene transfer using self-
assembled nanofibrils formed by the 12-amino acid peptide termed EF-C (Enhancement
Fragment C). This peptide was derived from the HIV-1 external envelope glycoprotein
gp120. The fibrils form instantaneously upon dilution of peptide in aqueous media and
adopt a typical amyloid structure that was observed due to Thioflavin T and Congo Red
staining and atomic force microscopy. Measurement of ζ-potential charge of aqueous
solution of EF-C revealed that the nanofibrils have positively charged surface, supposed
that their enhance infection by neutralizing the repulsion between the negatively charged
viral and cellular membranes. My data obtained using confocal fluorescence microscopy
shown that fibrils bind virions and increase their adsorption to cells and subsequent
infection. Addition of EF-C to virus stocks or target cells boosted gene delivery into
multiple cell types, including primary T cells, macrophages and CD34+ stem cells, and
was substantially more effective than other reagents commonly used to increase
transduction. Moreover, like RetroNection, the most commonly used reagent to increase
retroviral transduction, EF-C potently boosts transduction also when immobilized on cell
culture dishes. This effect was confirmed with retro- and lentiviral particles carrying
various viral envelope proteins frequently used for gene transfer and therapy. The
enhancing effect was independent of the viral glycoprotein but still required the respective
cellular receptor(s). Furthermore, the fibrils allow a fast and convenient concentration of
virions without the need of ultracentrifugation. The result presented in this thesis
demonstrate that EF-C nanofibrils provide a convenient, flexible and effective means to
increase retro- and lentiviral gene transfer in basic research and clinical applications.
![Page 68: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/68.jpg)
6. REFERENCES 60
6. REFERENCES
1. Akkina RK, Walton RM, Chen ML, Li Q-X, Planelles V and Chen ISY. High-efficiency gene transfer into CD34+ cells with a human immunodeficiency virus type 1-based retroviral vector pseudotyped with vesicular stomatitis virus envelope glycoprotein G. J Virol 70:2581–2585 (1996).
2. Anderson LC, Nilsson K and Gahmberg CG. K562 – a human erythroleukemic cell line. Int J Cancer 23, 143-147 (1979).
3. Andreadis ST, Roth CM, Le Doux JM, Morgan JR and Yarmush ML. Large-scale processing of recombinant retroviruses for gene therapy. Biotechnol Prog 15:1–11 (1999).
4. Andreadis S, Lavery T, Davis HE, Le Doux JM, Yarmush ML and Morgan JR. Toward a more accurate quantitation of the activity of recombinant retroviruses: alternatives to titer and multiplicity of infection. J Virol 74: 3431–3439 (2000).
5. Anliker B, Abel T, Kneissl S, Hlavaty J, Caputi A, Brynza J, Schneider IC, Münch RC, Petznek H, Kontermann RE, Koehl U, Johnston ICD, Keinänen K, Müller UC, Hohenadl C, Monyer H, Cichutek K and Buchholz CJ. Specific gene transfer to neurons, endothelial cells and hemotopoietic progenitors with lentiviral vectors. Nat Methods 7:929-35 (2010).
6. Arnold F, Schnell J, Zirafi O, Stürzel C, Meier C, Weil T, Ständker L, Forssmann WG, Roan NR, Greene WC, Kirchhoff F, Münch J. Naturally occurring fragments from two distinct regions of the prostatic acid phosphatase form amyloidogenic enhancers of HIV infection. J Virol 86(2):1244-9 (2012).
7. Bahnson AB, Dunigan JT, Baysal BE, Mohney T, Atchison RW, Nimgaonkar MT, Ball ED and Barranger JA. Centrifugal enhancement of retroviral mediated gene transfer. J Virol Methods 54:131–143(1995).
8. Bailey CA, Miller DK and Lenard J. Effects of DEAE-dextran on infection and hemolysis by VSV. Evidence that nonspecific electrostatic interactions mediate effective binding of VSV to cells. Virology 133:111-118 (1984).
9. Bajaj B, Lei P and Andreadis ST. High efficiencies of gene transfer with immobilized recombinant retrovirus: kinetics and optimization. Biotechnol Prog 17(4):587-96 (2001).
10. Bauer TR Jr, Miller AD and Hickstein DD. Improved transfer of the leukocyte integrin CD18 subunit into hematopoietic cell lines by using retroviral vectors having a gibbon ape leukemia virus envelope. Blood 86: 2379-2387 (1995).
11. Biancalana M, Makabe K, Koide A and Koide S. Molecular mechanism of thioflavin-T binding to the surface of �-rich peptide self-assemblies. J Mol Biol 385:1052–1063 (2009).
12. Brender JR, Hartman K, Gottler LM, Cavitt ME, Youngstrom DW and Ramamoorthy A. Helical Conformation of the SEVI Precursor Peptide PAP248-286, a Dramatic Enhancer of HIV Infectivity, Promotes Lipid Aggregation and Fusion. Biophys J. 97(9): 2474–2483 (2009).
13. Brown JC, Newcomb WW and Wertz GW. Helical Virus Structure: The Case of the Rhabdovirus Bullet. Viruses 2(4), 995-1001 (2010).
14. Burns JC, Friedmann T, Driever W, Burrascano M and Yee JK. Vesicular stomatitis virus G glycoprotein pseudotyped retroviral vectors: concentration to very high titer and efficient gene transfer into mammalian and nonmammalian cells. Proc Natl Acad Sci USA 90: 8033–8037 (1993).
15. Bunnell BA and Morgan RA. Gene therapy for infectious diseases. Clin Microbiol Rev 11(1): 42-56(1998).
![Page 69: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/69.jpg)
6. REFERENCES 61
16. Bunnell BA, Muul LM, Donahue RE, Blaese RM and Morgan RA. High-efficiency retroviral-mediated gene transfer into human and nonhuman primate peripheral blood lymphocytes. Proc Natl Acad Sci USA 7739–7743 (1995).
17. Candotti F, Shaw KL, Muul L, Carbonaro D, Sokolic R, Choi C, Schurman SH, Garabedian E, Kesserwan C, Jagadeesh GJ, Fu PY, Gschweng E, Cooper A, Tisdale JF, Weinberg KI, Crooks GM, Kapoor N, Shah A, Abdel-Azim H, Yu XJ, Smogorzewska M, Wayne AS, Rosenblatt HM, Davis CM, Hanson C, Rishi RG, Wang X, Gjertson D, Yang OO, Balamurugan A, Bauer G, Ireland JA, Engel BC, Podsakoff GM, Hershfield MS, Blaese RM, Parkman R, Kohn DB. Gene therapy for adenosine deaminase-deficient severe combined immune deficiency: clinical comparison of retroviral vectors and treatment plans. Blood 120(18):3635-46 (2012).
18. Cavrois M, De Norohna C and Greene WC. A sensitive and specific enzyme-based assay detecting HIV-1 virion fusion in primary T lymphocytes. Nat Biotechnol 20:1151-4 (2002).
19. Cavrois M, Neidleman J, Bigos M and Greene WC. Fluorescence resonance energy transfer-based HIV-1 virion fusion assay. Methods Mol Biol 263: 333-344 (2004).
20. Chuck AS, Clarke MF and Palsson BO. Retroviral infection is limited by Brownian motion. Hum Gene Ther 7: 1527–1534 (1996)
21. Cockrell AS and Kafri T. Gene delivery by lentivirus vectors. Mol Biotechnol 36(3):184-204 (2007).
22. Coelen R, Jose D and May J. The effect of hexadimethrine bromide (polybrene) on the infection of primate retroviruses SSV1/SSAV1 and BaEV. Arch Virol 75: 307–311 (1983).
23. Coffin JM, Hughes SH and Varmus HE. Retroviruses. Cold Spring Harbor Laboratory Press (1997).
24. Cornetta K and Anderson WF. Protamine sulfate as an effective alternative to polybrene in retroviral-mediated gene-transfer: implications for human gene therapy. J Virol Methods 23: 187–194 (1989).
25. Cronin J, Zhang XY and Reiser J. Altering the tropism of lentiviral vectors through pseudotyping. Curr Gene Ther 5(4):387-98 (2005).
26. Cummins NW, Rizza SA and Badley AD. How much gp120 is there? J Infect Dis 201: 1273-4 (2010)
27. Davis H, Morgan J and Yarmush M. Polybrene increases retrovirus gene transfer efficiency by enhancing receptor-independent virus adsorption on target cell membranes. Biophys Chem 97:159-72 (2002).
28. Davis H, Rosinski M, Morgan J and Yarmush M. Charged polymers modulate retrovirus transduction via membrane charge neutralization and virus aggregation. Biophys J 86:1234-42 (2004).
29. Deng H, Liu R, Ellmeier W, Choe S, Unutmaz D, Burkhart M, Di Marzio P, Marmon S, Sutton RE, Hill CM, Davis CB, Peiper SC, Schall TJ, Littman DR and Landau NR. Identification of a major co-receptor for primary isolates of HIV-1. Nature 381(6584):661-6 (1996).
30. Di Nunzio F, Felix T, Arhel N, Nisole S, Charneau P and Beignon A. HIV-derived vectors for therapy and vaccination against HIV. Vaccine 30:2499-509 (2012).
31. Dropulic B. Lentiviral vectors: their molecular design, safety, and use in laboratory and preclinical research. Hum Gene Ther 22:649-657 (2011).
![Page 70: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/70.jpg)
6. REFERENCES 62
32. Dull T, Zufferey R, Kelly M, Mandel RJ, Nguyen M, Trono D and Naldini L. A third-generation lentivirus vector with a conditional packaging system. J Virol 1998 Nov;72(11):8463-71 (1998).
33. Dybing J, Lynch CM, Hara P, Jurus L, Kiem HP, Anklesaria P. GaLV pseudotyped vectors and cationic lipids transduce human CD34+ cells. Hum Gene Ther 8: 1685–1694 (1997).
34. Elghetany MT and Saleem A. Methods for staining amyloid in tissues: a review. Biotech Histochem 63:201–212 (1988).
35. Escors D and Breckpot K. Lentiviral vectors in gene therapy: their current status and future potential. Arch Immunol Ther Exp (Warsz). 58(2):107-19 (2010).
36. Evers BM, Ishizuka J, Townsend CM Jr and Thompson JC. The human carcinoid cell line, BON. A model system for the study of carcinoid tumors. Ann N Y Acad Sci 733:393-406 (1994).
37. Fenard D, Ingrao D, Seye A, Buisset J, Genries S, Martin S, Kichler A and Galy A. Vectofusin-1, a new viral entry enhancer, strongly promotes lentiviral transduction of human hematopoietic stem cells. Mol Ther Nucleic Acids 2:e90 (2013).
38. Feng Y, Broder CC, Kennedy PE and Berger EA. HIV-1 entry cofactor: functional cDNA cloning of a seven-transmembrane, G protein-coupled receptor. Science 272(5263):872-7 (1996).
39. Fernández M, Simon V and Minguell JJ. Production of soluble CD34 by human myeloid cells. Br J Haematol 111(2): 426-31 (2000).
40. Frecha C, Levy C, Cosset FL and Verhoeyen E. Advances in the field of lentivector based transduction of T and B lymphocytes for gene therapy. Mol Ther 18: 1748-1757 (2010).
41. Gaspar HB, Parsley KL, Howe S, King D, Gilmour KC, Sinclair J, Brouns G, Schmidt M, Von Kalle C, Barington T, Jakobsen MA, Christensen HO, Al Ghonaium A, White HN, Smith JL, Levinsky RJ, Ali RR, Kinnon C and Thrasher AJ. Gene therapy of X-linked severe combined immunodeficiency by use of a pseudotyped gammaretroviral vector. Lancet 364(9452):2181-7 (2004).
42. Gatlin J, Melkus MW, Padgett A, Kelly PF and Garcia JV. Engraftment of NOD/SCID mice with human CD34(+) cells transduced by concentrated oncoretroviral vector particles pseudotyped with the feline endogenous retrovirus (RD114) envelope protein. J Virol 75(20):9995-9 (2001).
43. Gey GO, Coffman WD and Kubicek MT. Tissue culture studies of the proliferative capacity of cervical carcinoma and normal epithelium. Cancer Res 12:264–265 (1952).
44. Goffinet C, Allespach I and Keppler OT. HIV-susceptible transgenic rats allow rapid preclinical testing of antiviral compounds targeting virus entry or reverse transcription. Proc Natl Acad Sci U S A 104:1015-20 (2007).
45. Graham FL and van der Eb AJ. A new technique for the assay of infectivity of human adenovirus 5 DNA. Virology 52: 456-467 (1973).
46. Graham FL, Smiley J, Russell WC and Nairn R. Characteristics of a human cell line transformed by DNA from human adenovirus type 5. J Gen Virol 36:59-74 (1977).
47. Green DA, Masliah E, Vinters HV, Beizai P, Moore DJ and Achim CL. Brain deposition of beta-amyloid is a common pathologic feature in HIV positive patients. AIDS 19(4):407-11 (2005).
![Page 71: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/71.jpg)
6. REFERENCES 63
48. Gurgo C, Guo HG, Franchini G, Aldovini A, Collalti E, Farrell K, Wong-Staal F, Gallo RC and Reitz MS Jr. Envelope sequences of two new United States HIV-1 isolates. Virology 164, 531-536 (1988).
49. Journal of Gene Medicine: http://www.wiley.co.uk/genmed/clinical (12.10.2015).
50. Hacein-Bey S, Gross F, Nusbaum P, Hue C, Hamel Y, Fischer A and Cavazzana-Calvo M. Optimization of retroviral gene transfer protocol to maintain the lymphoid potential of progenitor cells. Hum Gene Ther 12(3):291-301 (2001).
51. Hanenberg H, Xiao XL, Dilloo D, Hashino K, Kato I, Williams DA. Colocalization of retrovirus and target cells on specific fibronectin fragments increases genetic transduction of mammalian cells. Nat Med 2, 876–882 (1996).
52. Hanenberg H, Hashino K, Konishi H, Hock RA, Kato I, Williams DA. Optimization of fibronectin-assisted retroviral gene transfer into human CD34+ hematopoietic cells. Hum Gene Ther 8: 2193–2206 (1997).
53. Hartman K, Brender JR, Monde K, Ono A, Evans ML, Popovych N, Chapman MR and Ramamoorthy A. Bacterial curli protein promotes the conversion of PAP248-286 into the amyloid SEVI: cross-seeding of dissimilar amyloid sequences. PeerJ 1:e5 (2012).
54. Hemelaar J. The origin and diversity of the HIV-1 pandemic. Trends in Mol Medicine 18(3):182-192 (2012).
55. Heneine W, Switzer WM, Sandstrom P, Brown J, Vedapuri S, Schable CA, Khan AS, Lerche NW, Schweizer M, Neumann-Haefelin D, Chapman LE and Folks TM Identification of a human population infected with simian foamy viruses. Nat Med 4: 403-407 (1998).
56. Hennemann B, Chuo JY, Schley PD, Lambie K, Humphries RK and Eaves CJ. High-efficiency retroviral transduction of mammalian cells on positively charged surfaces. Hum. Gene Ther 11:43-51 (2000).
57. Ho WZ, Cherukuri R, Ge SD, Cutilli JR, Song L, Whitko S and Douglas SD. Centrifugal enhancement of human immunodeficiency virus type 1 infection and human cytomegalovirus gene expression in human primary monocyte/macrophages in vitro. J Leukoc Biol 53(2):208-12 (1993).
58. Hodgson CP and Solaiman F. Virosomes: cationic liposomes enhance retroviral transduction. Nat Biotechnol 14(3):339-42 (1996).
59. Hsu M, Harouse JM, Gettie A, Buckner C, Blanchard J. and Cheng-Mayer C: Increased Mucosal Transmission but Not Enhanced Pathogenicity of the CCR5-Tropic, Simian AIDS-Inducing Simian/Human Immunodeficiency Virus SHIVSF162P3 Maps to Envelope gp120. J Virol 77, 989–998 (2003).
60. Isner JM. Myocardial gene therapy. Nature 415(6868):234-9 (2002).
61. Kay MA, Glorioso JC and Naldini L. Viral vectors for gene therapy: the art of turning infectious agents into vehicles of therapeutics. Nat Med 7:33-40 (2001).
62. Kelly PF, Carrington J, Nathwani A and Vanin EF. RD114-pseudotyped oncoretroviral vectors. Biological and Physical properties. Ann NY Acad Sci 938:262-76 (2001).
63. Kiem HP, Allen J, Trobridge G, Olson E, Keyser K, Peterson L and Russell DW. Foamy-virus-mediated gene transfer to canine repopulating cells. Blood 109: 65–70 (2007).
64. Kirchhoff F, Schindler M, Bailer N, Renkema GH, Saksela K, Knoop V, Muller-Trutwin MC, Santiago ML, Bibollet-Ruche F, Dittmar MT, Heeney JL, Hahn BH and Munch J. Nef proteins from simian immunodeficiency virus-infected chimpanzees interact with
![Page 72: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/72.jpg)
6. REFERENCES 64
p21-activated kinase 2 and modulate cell surface expression of various human receptors. J Virol 78:6864-6874 (2004).
65. Koeffler HP and Golde DW. Acute myelogenous leukaemia: a human cell line responsive to colony-stimulating activity. Science 200:1153-4 (1978).
66. Kootstra NA and Verma IM. Gene therapy with viral vectors. Annu Rev Pharmacol Toxicol 43:413-439 (2003).
67. Kotani H, Newton PB, 3rd, Zhang S, Chiang YL, Otto E, Weaver L, Blaese RM, Anderson WF and McGarrity GJ. Improved methods of retroviral vector transduction and production for gene therapy. Hum Gene Ther 5(1):19-28 (1994).
68. Kwong PD, Wyatt R, Robinson J, Sweet RW, Sodroski J and Hendrickson WA. Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody. Nature 393:648-59 (1998).
69. Lee H, Song JJ, Kim E, Yun CO, Choi J, LeeB, Kim J, Chang JW and Kim JH. Efficient gene transfer of VSV-G pseudotyped retroviral vector to human brain tumor. Gene Ther 8: 268–273 (2001).
70. Le Doux JM, Davis HE, Morgan JR and Yarmush ML. Kinetics of retrovirus production and decay. Biotechnol Bioeng 63: 654–662 (1999).
71. Lemiale F and Korokhov N. Lentiviral vectors for HIV disease prevention and treatment. Vaccine 27:3443-9 (2009).
72. Leyva FJ, Anzinger JJ, McCoy JP Jr and Kruth HS. Evaluation of transduction efficiency in macrophage colony-stimulating factor differentiated human macrophages using HIV-1 based lentiviral vectors. BMC Biotechnol 11:13 (2011).
73. Lin P, Correa D, Lin Y and Caplan AI. Polybrene inhibits human mesenchymal stem cell proliferation during lentiviral transduction. PLoS One 6:e23891 (2010).
74. Lundberg C, Björklund T, Carlsson T, Jakobsson J, Hantraye P, Déglon N and Kirik D. Applications of lentiviral vectors for biology and gene therapy of neurological disorders. Curr Gene Ther 8(6):461-73 (2008).
75. Mahlknecht U, Dichamp I, Varin A, van Lint C and Herbein G. NF-κB-dependent control of HIV-1 transcription by the second coding exon of Tat in T cells. J Leukoc Biol 83: 718-727 (2008)
76. Malim MH and Emerman M. HIV-1 accessory proteins--ensuring viral survival in a hostile environment. Cell Host Microbe 3:388-398 (2008).
77. Manning JS, Hackett AJ and Darby NB. Effect of polycations on sensitivity of BALD-3T3 cells to murine leukaemia and sarcoma virus infectivity. App. Microbiol 22, 1162-1164 (1971).
78. Markowirz D, Goff S and Bank A. A safe packaging line for gene transfer: separating viral genes on two different plasmids. J Virol 62: 1120-1124 (1988).
79. Mátrai J, Chuah MK and Van den Driessche T. Recent advances in lentiviral vector development and applications. Mol Ther 18: 477-490 (2010).
80. McTaggart S and Al-Rubeai M. Retroviral vectors for human gene delivery. Biotechnol Adv 20(1):1-31 (2002).
81. Miller AD and Buttimore C. Redesign of retrovirus packaging cell lines to avoid recombination leading to helper virus production. Mol Cell Biol 6: 2895-2902 (1986).
82. Miller AD, Trauber DR and Buttimore C. Factors involved in production of helper virus-free retrovirus vectors. Somat Cell Mol Genet 12: 175-183 (1986).
![Page 73: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/73.jpg)
6. REFERENCES 65
83. Miyoshi H, Takahashi M, Gage FH and Verma IM. Stable and efficient gene transfer into the retina using an HIV-based lentiviral vector. Proc Natl Acad Sci U S A. 94(19):10319-23 (1997).
84. Miyoshi H, Blömer U, Takahashi M, Gage FH and Verma IM. Development of a self-Inactivating Lentivirus Vector. J Virol 72: 10 8150-8157(1998).
85. Moritz T, Dutt P, Xiao X, Carstanjen D, Vik T, Hanenberg H and Williams DA. Fibronectin improves transduction of reconstituting hematopoietic stem cells by retroviral vectors: Evidence of direct viral binding to chymotryptic carboxy-terminal fragments. Blood 88: 855–862 (1996).
86. Mostaert AS, Higgins MJ, Fukuma T, Rindi F and Jarvis SP. Nanoscale Mechanical Characterization of Amyloid Fibrils Discovered in a Natural Adhesive. J Biol Phys 32: 393-401(2006).
87. Münch J, Schindler M, Wildum S, Rucker E, Bailer N, Knoop V, Novembre FJ and Kirchhoff F. Primary sooty mangabey simian immunodeficiency virus and human immunodeficiency virus type 2 nef alleles modulate cell surface expression of various human receptors and enhance viral infectivity and replication. J Virol 79:10547-10560 (2005).
88. Münch J, Rücker E, Ständker L, Adermann K, Goffinet C, Schindler M, Wildum S, Chinnadurai R, Rajan D, Specht A, Giménez-Gallego G, Sánchez PC, Fowler DM, Koulov A, Kelly JW, Mothes W, Grivel JC, Margolis L, Keppler OT, Forssmann WG and Kirchhoff F. Semen-derived amyloid fibrils drastically enhance HIV infection. Cell 131: 1059-1071 (2007).
89. Neil SJ, Eastman SW, Jouvenet N and Bieniasz PD. HIV-1 Vpu promotes release and prevents endocytosis of nascent retrovirus particles from the plasma membrane. PLoS Pathog 2:e39 (2006).
90. Naldini, L. Blömer U, Gallay P, Ory D, Mulligan R, Gage FH, Verma IM and Trono D. In vivo gene delivery and stable transduction of non-dividing cells by a lentiviral vector. Science 272, 263-267 (1996).
91. Naldini L. Lentiviruses as gene transfer agents for delivery to non-dividing cells. Curr Opin Biotechnol 9:457-463 (1997).
92. Negre O. Fusil F, Colomb C, Roth S, Gillet-Legrand B, Henri A, Beuzard Y, Bushman F, Leboulch P and Payen E. Correction of murine beta-thalassemia after minimal lentiviral gene transfer and homeostatic in vivo erythroid expansion. Blood 117:5321-5331 (2011).
93. Neff T, Peterson LJ, Morris JC, Thompson J, Zhang X, Horn PA, Thomasson BM and Kiem HP. Efficient gene transfer to hematopoietic repopulating cells using concentrated RD114-pseudotype vectors produced by human packaging cells. Mol Ther 9(2):157-9 (2004).
94. Onodera M, Nelson DM, Sakiyama Y, Candotti F and Blaese RM. Gene therapy for severe combined immunodeficiency caused by adenosine deaminase deficiency: improved retroviral vectors for clinical trials. Acta Haemato. 101(2):89-96 (1999).
95. Ott MG, Schmidt M, Schwarzwaelder K, Stein S, Siler U, Koehl U, Glimm H, Kuhlcke K, Schilz A, Kunkel H, Naundorf S, Brinkmann A, Deichmann A, Fischer M, Ball C, Pilz I, Dunbar C, Du Y, Jenkins NA, Copeland NG, Luthi U, Hassan M, Thrasher AJ, Hoelzer D, von Kalle C, Seger R, Grez M. Correction of X-linked chronic granulomatous disease by gene therapy, augmented by insertional activation of MDS1-EVI1, PRDM16 or SETBP1. Nat Med 12: 401-409 (2006).
![Page 74: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/74.jpg)
6. REFERENCES 66
96. Papkalla A, Münch J, Otto C and Kirchhoff F: Nef enhances human immunodeficiency virus type 1 infectivity and replication independently of viral coreceptor tropism. J Virol 76:8455-59 (2002).
97. Pear WS, Nolan GP, Scott ML and Baltimore D. Production of high titer helper-free retroviruses by transient transfection. PNAS 90:8392–8396 (1993).
98. Pollok KE, Hanenberg H, Noblitt TW, Schroeder WL, Kato I, Emanuel D, Williams DA. High efficiency gene transfer into normal and adenosine deaminase deficient T lymphocytes is mediated by transduction on recombinant fibronectin fragments. J Virol 72, 4882–4892 (1998).
99. Ponten J and Macintyre EH. Long term culture of normal and neoplastic human glia. Acta Pathol Microbiol Scand 74: 465-486 (1968).
100. Porter CD, Lukacs KV, Box G. Takeuchi Y and Collins MKL. Cationic liposomes enhance the rate of transduction by a recombinant retroviral vector in vitro and in vivo. J Virol 72: 4832–4840 (1998).
101. Puchtler H and Sweat F. Congo red as a stain for fluorescence microscopy of amyloid. J Histochem Cytochem 13: 693–694 (1965).
102. Quintas-Cardama A, Yeh RK, Hollyman D, Stefanski J, Taylor C, Nikhamin Y, Imperato G, Sadelain M, Rivière I and Brentjens RJ. Multifactorial optimization of gammaretroviral gene transfer into human T lymphocytes for clinical application. Hum Gene Ther 18, 1253–1260 (2007).
103. Ramamoorth M and Narvekar A. Non-viral vectors in gene therapy - an overview. J Clin Diagn Res. 9(1):GE01-6 (2015).
104. Reiser J. Production and concentration of pseudotyped HIV-1-based gene transfer vectors. Gene Ther 7(11):910-3 (2000).
105. Relander T, Johansson M, Olsson K, Ikeda Y, Takeuchi Y, Collins M and Richter J. Gene transfer to repopulating human CD34+ cells using amphotropic-, GALV–, or RD114-pseudotyped HIV-1-based vectors from stable producer cells. Mol Ther 11: 452–459 (2005).
106. Roan NR, Münch J, Arhel N, Mothes W, Neidleman J, Kobayashi A, Smith-McCune K, Kirchhoff F and Greene WC. The cationic properties of SEVI underlie its ability to markedly enhance HIV infection. J Virol 83: 73–80 (2009).
107. Roan NR, Müller JA, Liu H, Chu S, Arnold F, Stürzel CM, Walther P, Dong M, Witkowska HE, Kirchhoff F, Münch J and Greene WC. Peptides released by physiological cleavage of semen coagulum proteins form amyloids that enhance HIV infection. Cell Host Microbe 10(6):541-50 (2011).
108. Sakoda T, Kasahara N, Kedes L and Ohyanagi M. Calcium phosphate coprecipitation greatly enhances transduction of cardiac myocytes and vascular smooth muscle cells by lentivirus vectors. Exp Clin Cardiol 12:133–138 (2007).
109. Sanders DA. No false start for novel pseudotyped vectors. Curr Opin Biotechnol 13: 437−442 (2002).
110. Sandrin V, Boson B, Salmon P, Gay W, Nègre D, Le Grand R, Trono D and Cosset FL. Lentiviral vectors pseudotyped with a modified RD114 envelope glycoprotein show increased stability in sera and augmented transduction of primary lymphocytes and CD34+ cells derived from human and nonhuman primates. Blood 100: 823–832 (2002).
111. Sandrin V, Muriaux D, Darlix JL and Cosset FL. Intracellular trafficking of Gag and Env proteins and their interactions modulate pseudotyping of retroviruses. J Virol 78: 7153-7164 (2004).
![Page 75: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/75.jpg)
6. REFERENCES 67
112. Schambach A, Bohne J, Chandra S, Will E, Margison GP, Williams DA and Baum C. Equal Potency of Gammaretroviral and Lentiviral SIN Vectors for Expression of O6-Methylguanine–DNA Methyltransferase in Hematopoietic Cells. Mol Ther 13(2):391-400 (2006a).
113. Schambach A, Mueller D, Galla M, Verstegen MM, Wagemaker G, Loew R, Baum C and Bohne J. Overcoming promoter competition in packaging cells improves production of self-inactivating retroviral vectors. Gene Ther 13:1524–1533 (2006b).
114. Schindler M, Wurfl S, Benaroch P, Greenough TC, Daniels R, Easterbrook P, Brenner M, Munch J and Kirchhoff F. Down-modulation of mature major histocompatibility complex class II and up-regulation of invariant chain cell surface expression are well-conserved functions of human and simian immunodeficiency virus nef alleles. J Virol 77:10548-10556 (2003).
115. Schindler M, Munch J, Kutsch O, Li H, Santiago ML, Bibollet-Ruche F, Muller-Trutwin MC, Novembre FJ, Peeters M, Courgnaud V, Bailes E, Roques P, Sodora DL, Silvestri G, Sharp PM, Hahn BH and Kirchhoff F. Nef-mediated suppression of T cell activation was lost in a lentiviral lineage that gave rise to HIV-1. Cell 125:1055-1067 (2006).
116. Schmidt L, Kling T, Monsefi N, Olsson M, Hansson C, Baskaran S, Lundgren B, Martens U, Häggblad M, Westermark B, Forsberg Nilsson K, Uhrbom L, Karlsson-Lindahl L, Gerlee P and Nelander S. Comparative drug pair screening across multiple glioblastoma cell lines reveals novel drug-drug interactions. Neuro Oncol 15(11):1469-78 (2013).
117. Seitz B, Baktanian E, Gordon EM, Anderson WF, LaBree L and McDonnell PJ. Retroviral vector-mediated gene transfer into keratocytes: in vitro effects of polybrene and protamine sulfate. Graefes Arch Clin Exp Ophthalmol 236:602-612 (1998).
118. Sheehy AM, Gaddis NC, Choi JD and Malim MH. Isolation of a human gene that inhibits HIV-1 infection and is suppressed by the viral Vif protein. Nature 418:646-650 (2002).
119. Stine WB Jr, Snyder SW, Ladror US, Wade WS, Miller MF, Perun TJ, Holzman TF and Krafft GA. The nanometer-scale structure of amyloid-beta visualized by atomic force microscopy. J Protein Chem 15(2):193-203 (1996).
120. Stitz J, Buchholz CJ, Engelstädter M, Uckert W, Bloemer U, Schmitt I and Cichutek K. Lentiviral vectors pseudotyped with envelope glycoproteins derived from gibbon ape leukemia virus and murine leukemia virus 10A1. Virology 273(1):16-20 (2000).
121. Swaney WP, Sorgi FL, Bahnson AB and Barranger JA. The effect of cationic liposome pretreatment and centrifugation on retrovirus-mediated gene transfer. Gene Ther 4:1379–1386 (1997).
122. Thomas CE, Ehrhardt A and Kay MA. Progress and problems with the use of viral vectors for gene therapy. Nat Rev Genet 4:346-358 (2003).
123. Tiscornia G, Singer O, Ikawa M and Verma IM. A general method for gene knockdown in mice by using lentiviral vectors expressing small interfering RNA. Proc Natl Acad Sci USA 100(4):1844-8 (2003).
124. Toyoshima K and Vogt PK. Enhancement and inhibition of avian sarcoma viruses by polycations and polyanions. Virology 38:414-426 (1969).
125. Turner BG and Summers MF. Structural biology of HIV. J. Mol Biol 285:1-32 (1999).
126. Uckert W, Becker C, Gladow M, Klein D, Kammertoens T, Pedersen L and Blankenstein T. Efficient gene transfer into primary human CD8+ T lymphocytes by MuLV-10A1 retrovirus pseudotype. Hum Gene Ther 11: 1005-1014 (2000).
127. Vannucci L, Lai M, Chiuppesi F, Ceccherini-Nelli L and Pistello M. Viral vectors: a look back and ahead on gene transfer technology. New Microbiol 36:1-22 (2013).
![Page 76: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/76.jpg)
6. REFERENCES 68
128. Vogt PK. DEAE-dextran: enhancement of cellular transformation induced by avian sarcoma viruses. Virology 33: 175–177 (1967).
129. von Schwedler U, Kornbluth RS and Trono D. The nuclear localization signal of the matrix protein of human immunodeficiency virus type 1 allows the establishment of infection in macrophages and quiescent T lymphocytes. Proc Natl Acad Sci U S A 91: 6992-6996 (1994).
130. Walker S, Sofia MJ, Kakarla R, Kogan NA, Wierichs L, Longley CB, Bruker K, Axelrod HR, Midha S, Babu S and Kahne D. Cationic facial amphiphiles: a promising class of transfection agents. Proc Natl Acad Sci U S A 93: 1585-1590 (1996).
131. Wei MQ, Lejnieks DV, Ramesh N, Lau S, Seppen J and Osborne WRA. Sustained gene expression in transplanted skin fibroblasts in rats. Gene Ther 5:840-844 (1999).
132. Wei X, Decker JM, Liu H, Zhang Z, Arani RB, Kilby JM, Saag MS, Wu X, Shaw GM and Kappes JC. Emergence of resistant human immunodeficiency virus type 1 in patients receiving fusion inhibitor (T-20) monotherapy. Antimicrob Agents Chemother 46:1896-1905 (2002).
133. Wei CM, Gibson M, Spear PG, Scolnick EM. Construction and isolation of a transmissible retrovirus containing the src gene of Harvey murine sarcoma virus and the thymidine kinase gene of herpes simplex virus type 1. J Virol 39:935–944 (1981).
134. Williams DA, Rios M, Stephens C and Patel VP. Fibronectin and VLA-4 in haematopoietic stem cell-microenvironment interactions. Nature 352(6334):438-41 (1991).
135. Wigler M, Silverstein S, Lee LS, Pellicer A, Cheng Y and Axel R. Transfer of purified herpes virus thymidine kinase gene to cultured mouse cells. Cell 11: 223-232 (1977).
136. Wollebo HS, Woldemichaele B and White MK. Lentiviral transduction of neuronal cells. Methods Mol Biol 1078:141–146 (2013).
137. Wojtowicz WM, Farzan M, Joyal JL, Carter K, Babcock GJ, Israel DI, Sodroski J and Mirzabekov T. Stimulation of enveloped virus infection by beta-amyloid fibrils. J Biol Chem 277:35019-24 (2002).
138. Wurm M, Schambach A, Lindemann D, Hanenberg H, Ständker L, Forssmann WG, Blasczyk R and Horn PA. The influence of semen-derived enhancer of virus infection on the efficiency of retroviral gene transfer. J Gene Med 12:137-146 (2010).
139. Wurm M, Gross B, Sgodda M, Ständker L, Müller T, Forssmann W-G, Horn PA, Blasczyk R and Cantz T. Improved lentiviral gene transfer into human embryonic stem cells grown in co-culture with murine feeder and stroma cells. Biol Chem 392:887–895 (2011).
140. Yao JC, Zhang JX, Rashid A, Yeung SC, Szklaruk J, Hess K, Xie K, Ellis L, Abbruzzese JL, Ajani JA. Clinical and in vitro studies of imatinib in advanced carcinoid tumors. Clin Cancer Res 13:234–240 (2007).
141. Ye Z, French KC, Popova LA, Lednev IK, Lopez MM and Makhatadze GI: Mechanism of fibril formation by a 39-residue peptide (PAPf39) from human prostatic acidic phosphatase. Biochemistry 48:11582-91 (2009).
142. Yolamanova M, Meier C, Shaytan AK, Vas V, Bertoncini CW, Arnold F, Zirafi O, Usmani SM, Müller JA, Sauter D, Goffinet C, Palesch D, Walther P, Roan NR, Geiger H, Lunov O, Simmet T, Bohne J, Schrezenmeier H, Schwarz K, Ständker L, Forssmann WG, Salvatella X, Khalatur PG, Khokhlov AR, Knowles TP, Weil T, Kirchhoff F and Münch J. Peptide nanofibrils boost retroviral gene transfer and provide a rapid means for concentrating viruses. Nat Nanotechnol 8(2):130-6 (2013).
![Page 77: Ulm University Medical Center Institute of Molecular](https://reader030.vdocuments.mx/reader030/viewer/2022012716/61ae8d7ca1730f5ada6894a6/html5/thumbnails/77.jpg)
6. REFERENCES 69
143. Yi Y, Hahm SH and Lee KH. Retroviral gene therapy: safety issues and possible solutions. Curr Gene Ther 5:25-35 (2005).
144. Yu SF, von Ruden T, Kantoff PW, Garber C, Seiberg M, Ruther U, Anderson WF, Wagner EF and Gilboa E. Self-inactivating retroviral vectors designed for transfer of whole genes into mammalian cells. Proc Natl Acad Sci 83:3194–3198 (1986).
145. Zhou P, Lee J, Moore P and Brasky KM. High efficiency gene transfer into rhesus macaque primary T lymphocytes by combining 32 degrees C centrifugation and CH-296-coated plates: Effect of gene transfer protocol on T cell homing receptor expression. Hum Gene Ther 12:1843–1855 (2001).
146. Zhang B, Xia HQ, Cleghorn G, Gobe G, West M and Wei MQ. A highly efficient and consistent method for harvesting large volumes of high-titre lentiviral vectors. Gene Ther 8(22):1745-51 (2001).
147. Zhang L, Jiang C, Zhang H, Gong X, Yang L, Miao L, Shi Y, Zhang Y, Kong W, Zhang C and Shan Y. A novel modified peptide derived from membrane-proximal region of human immunodeficiency virus type 1 envelope significantly enhances retrovirus infection. J Pept Sci 20:46-54 (2014).
148. Zhou P, Lee J, Moore P and Brasky KM. High-efficiency gene transfer into rhesus macaque primary T lymphocytes by combining 32 degrees C centrifugation and CH-296-coated plates: effect of gene transfer protocol on T cell homing receptor expression. Hum Gene Ther 12:1843–1855 (2001).
149. Zhu P, Chertova E, Bess JJ, Lifson JD, Arthur LO, Liu J, Taylor KA and Roux KH. Electron tomography analysis of envelope glycoprotein trimers on HIV and simian immunodeficiency virus virions. Proc Natl Acad Sci USA 100(26):15812–15817 (2003).
150. Zufferey R, Dull T, Mandel RJ, Bukovsky A, Quiroz D, Naldini L and Trono D. Self-inactivating lentivirus vector for safe and efficient in vivo gene delivery. J Virol 72(12):9873-80 (1998).
151. Zufferey R, Donello JE, Trono D and Hope TJ. Woodchuck hepatitis virus posttranscriptional regulatory element enhances expression of transgenes delivered by retroviral vectors. J Virol 73(4):2886-92 (1999).