topic 8. lecture 12. generalizations emerging from past evolution
DESCRIPTION
Topic 8. Lecture 12. Generalizations emerging from past evolution History unfolds in time, which makes chronology of past events crucial. However, any history also has a crucial timeless aspect, which can be described by generalizations. - PowerPoint PPT PresentationTRANSCRIPT
![Page 1: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/1.jpg)
Topic 8. Lecture 12. Generalizations emerging from past evolution
History unfolds in time, which makes chronology of past events crucial. However, any history also has a crucial timeless aspect, which can be described by generalizations.
An example of generalizations: complexity is rapidly lost, if selection stops maintaining it.
In a sense, every feature of living beings, both modern and ancient, is a generalization about evolution of their ancestors.
A parasitic plant Epifagus virginiana lost many key genes in its chloroplast genome
Mycobacterium leprae is in the middle of massive genome degeneration
Astyanax mexicana, like many other cave animals, has degenerated eyes
A crustacean parasite of fish, Lernaea carassii, has profoundly simplified morphology
![Page 2: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/2.jpg)
Let us view evolutionary generalizations from three complementary perspectives:
1. Generalizations concerned with evolution at a particular level of organization of life - i. e., with sequences, molecules, cells, organisms, populations, and ecosystems.
2. Generalizations concerned with evolution of the diversity of life. Such generalizations describe patterns in the diversity of life at one moment of time, as well as processes that generate such diversity, i. e., evolution of individual lineages, birth and death of lineages, independent and dependent evolution of different lineages, and evolution in space.
3. Generalizations concerned with evolution of complex adaptations, the most enigmatic aspects of evolution. These generalizations describe genotypical and phenotypical mechanisms of adaptive evolution, origin of novel adaptations, and dynamics of complexity
Because we still lack a comprehensive theory of Macroevolution, generalizations about past evolution often are all what we have.
![Page 3: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/3.jpg)
Level-specific generalizations:
1. Sequences a) Mutation strongly affects sequence evolution, and selfish segments are common b) Functionally important segments and sites of genomes usually evolve slower c) Complex organisms have larger genomes, mostly due to noncoding sequences
2. Molecules a) Life possesses fundamental unity b) A particular function can be performed by very dissimilar molecules c) Rates of evolution vary across sites of a molecule and often change with time
3. Cells a) Networks within a cell are modular b) Networks within a cell consist of a small number of common motifs
4. Multicellular organisms a) Cell differentiation involves combinatorial regulation of gene expression b) In the development of vertebrates one stage is particularly conservative c) Body size often increases, but declines on islands
5. Populations a) Reproduction almost always involves unicellular channels b) Amphimixis is pervasive
6. Ecosystems a) Natural ecosystems can be successfully invaded
![Page 4: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/4.jpg)
Generalizations concerned with diversity of life:
1. Diversity of life at a particular moment of time a) Every individual belongs to a population of at least ~1000 individuals b) At any moment, life mostly consists of compact, disconnected forms c) Genotypes are incompatible if the distance between them exceeds ~1-5%
2. Evolution of a lineage a) Changes of a lineage are continuous, with some caveats b) Genomes evolve at much more uniform rates than phenotypes
3. Birth and death of lineages a) Cladogenesis is often, but not always, triggered by geographic isolation b) Cladogenesis and extinction are extremely unfair processes c) Overall diversity of life fluctuates, with the long-term tendency to increase
4. Independent evolution in multiple lineages a) Evolution is predominantly divergent, but homoplasy is common in simple traits b) Independent evolution eventually leads to speciation
5. Coevolution a) Lineages often coevolve for a long time b) Organisms often imitate each other to avoid been eaten
6. Diversity in space a) Distributions of ranges of species are strongly affected by limited dispersal b) Independent evolution at different localities is often parallel
![Page 5: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/5.jpg)
Generalizations concerned with adaptation and complexity:
1. Genetical aspects of adaptive evolution a) Evolution of both coding and non-coding sequences is important for adaptation b) The target for strong positive selection is narrow at each moment c) Tightly related genes can perform rather different functions
2. Phenotypic aspects of adaptive evolution a) Adaptations can be very general and very specific b) Evolution is irreversible c) Perhaps, all adaptations are imperfect
3. Origin of novelties a) New non-coding regulatory sites, but not new genes, often appear from scratch b) Origin of phenotypic novelties is usually opportunistic and can happen fast
4. Dynamics of complexity a) Complex phenotypes evolve through adaptive intermediate stages b) Complexity is rapidly lost, if selection stops maintaining it c) The overall trend is for complexity to increase
![Page 6: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/6.jpg)
Level-specific generalizations:1. Sequences
Evolution of sequences is undestood relatively well. The two key factors of Darwinian evolution, mutation and selection, are its main forces. However, this is of little help for understanding evolution at higher levels. Whether genotypes drive evolution of phenotypes or it is the other way around is a classical chicken-and-egg problem.
The level of sequences is the simplest of all levels of organization of life.
ACGATCGACGACGATCGATCGACGATCGA
Green, blue, red: targets ofno, negative, and positive selection.
![Page 7: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/7.jpg)
1a) Mutation strongly affects sequence evolution, and selfish segments are common
This sweeping generalization has many facets. The three most important of them are:
i) Evolution of sequences proceeds through individual changes that are supplied by mutation process, first of all by point mutations - single nucleotide substitutions, and short deletions and insertions.
Sister 1: caagccag---cgtctatcatatacgcagactcggctatttacgccacgatcagcatSister 2: catgccagcatcgtctagcatatacacagactc-gctatttacgtcacga-cagcatOutgroup: catgccagcatcgtgtagcatataggcagactc-gctaattacgtcacgatcagtat
del. in. del.
ii) Long new sequences have identifiable sources, instead of appearing from scratch.
Tandem duplication, the simplest manifestation of this pattern.
acagcatcgtgactagctatcgagatca -> acagcatcgtgactagctatagctatcgagatca
iii) Different genome regions evolve at similar overall rates. This is another theory-based evidence for evolution.
Human-mouse divergence at synonymous sites of genes on chromosomes 4 (left) and 22 (right).
Simple explanation: when selection does not care, mutation reigns.
![Page 8: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/8.jpg)
One important special case of this generalization is that transposable elements (TEs) accumulate in many genomes.
A mammalian genome is ~50% TEs, a Drosophila genome is ~10% TEs, and bacterial genomes usually contain very few TEs and other junk.
In mammals, individual TEs are usually fixed, i. e. present in every genotype within a lineage. In Drosophila a individual TE is usually rare.
The distribution of ages of TEs in the human genome. This is measured by divergence from the consensus sequences and grouped into bins that correspond to 25My of divergence.
Often, TEs or their segments become domesticated, i. e. start performing some function for their host.
Mammals Drosophila
![Page 9: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/9.jpg)
This sweeping generalization has many facets. The three most important of them are:
i) Non-synonymous sites of coding genes evolve slower than synonymous sites
ATG TCT GGG CGA GGT AAA GGT GGC AAG GGG CTG GGT AAG GGA GGC GCC AAG CGC CAC CGG ||| ||| || ||| || ||| || ||| || ||| || || || || ||| || || ||| || || ATG TCT GGA CGA GGC AAA GGC GGC AAA GGG CTC GGA AAA GGT GGC GCT AAA CGC CAT CGTAn extreme case: the first 20 codons of histone 4 genes from human and zebra-fish genomes. On average, nonsynonymous substitutions accumulate ~10 times slower than synonymous substitutions.
ii) functional non-coding segments evolve slower than junk segments
Alignment of four genome regions upstream of the transcription start of apolipoprotein gene. The binding site of the key transcription factor (protein) is conserved (sequence motif) and highlighted.
1b) Functionally important segments and sites of genomes usually evolve slower
A nucleotide substitution can kill, but at another location a substitution of even a removal of 1Mb of sequence has no evident impact on the phenotype.
![Page 10: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/10.jpg)
iii) exons evolve slower than introns
Coding exons evolve much slower than introns, and this pattern can be used to determine exon locations by genome comparions.
Alignment of human (top) and mouse (bottom) orthologous genes. Lines connecting the genomes show segments where their similarity is moderate (blue) or high (red). Red boxes below the alignment show predicted exons.
Simple explanation:
Negative (purifying) selection which favors already-commom variants and prevents changes is much more common than positive (Darwinian) selection which favors initially rare variants and promotes changes. One may wonder why beneficial mutations happen at all.
![Page 11: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/11.jpg)
1c) Complex organisms have larger genomes, mostly due to noncoding sequences
Genomes of complex organisms carry only a slightly elevated number of protein-coding genes. In Drosophila, ~50% of its non-coding DNA is apparently doing something, and in mammals this fraction is ~10%.
Simple explanation:Complex organisms need more text to describe themselves, and the extra text comes in the form of functional non-coding sequences (we do not really understand why). Also, complex organisms have "bloated", instead of "lean", genomes.
Organisms Minimal Genome size Number of genes Maxiaml coding fraction (millions) (thousands) (per cent)
parasitic bacteria 0.5-1.5 0.5-1.5 85free-living bacteria 2.5-7.5 2.5-7.0 85unicellular eukaryotes 10-30 7-10 50-70flowering plants 60-120 20-30 25-40most of animals 100-200 15-25 15-20fishes 400-1000 20-30 5-10birds 1000-1500 20 2-3 mammals 2500-3500 20 1.5-2
![Page 12: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/12.jpg)
Level-specific generalizations:2. Molecules
Molecules are the lowest functional level. A molecule is a (relatively) small but fully functional entity, and each one is incredibly complex (protein folding remains a mystery).
DNA as a functioning molecule. tRNA, a non-coding RNA. Hemoglobin, a protein.
Why do we ignore evolution of things like this? Discontinuous, and its connection to the genotype is much more complex.
![Page 13: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/13.jpg)
Simple explanation:Many key features of life are probably forozen accidents, impossible to modify. This allows us to learn something about LUCA.
2a) Life possesses fundamental unity
This unity is most striking, as far as translation machinery is concerned - genetic code, components of ribosomes, tRNAs, aminoacyl tRNA synthetases, etc.
80S ribosome of 70S ribosome ofSaccharomyces Escherichiacerevisiae coli
Many proteins not involved in translation are also universal - almost 50% of E. coli proteins have homologs among human proteins.
![Page 14: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/14.jpg)
2b) A particular function can be performed by very dissimilar molecules
Despite the fundamental unity of life, there are some cases when the same function, either simple or complex, is performed by clearly non-homologous molecules, similar only to the extent dictated by this function.
Simple explanation:Apparently, this is a general law of nature: every complex task can be performed more or less equally well in many rather different ways. Without common ancestry, each species would probably use its own way hydorolize pyrophosphate.
Inorganic pyrophosphatases comprise two non-homologous families, I and II.
Archaeal and eukaryotic replicative DNA polymerases (families A and B) and bacterial replicative DNA polymerases (family C) perhaps are non-homologous.
![Page 15: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/15.jpg)
2c) Rates of evolution vary across sites of a molecule and often change with time
In almost every RNA or protein molecule there are sites that evolve very conservative and sites that evolve as fast as junk DNA (i. e., at mutation rate) or even faster.
A typical segment of an alignment of several orthologous proteins from different species.
![Page 16: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/16.jpg)
Distribution of amino acid replacements along the Neisseria gonorrhoeae transmembrane porin sequence. Each dot represents one replacement. Obviously, sequence segments exposed outside the cell evolve much faster, probably due to positive selection.
Simple explanation: a site can be under negative selection, no selection, or positive selection.
![Page 17: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/17.jpg)
The rate of evolution within a molecule is not only heterogeneous across sites at any moment of time, but it also can change at a particular site while the molecule evolves. This occasionally includes the most drastic, qualitative changes - a nucleotide or amino acid replacement which was forbidden by selection may become permitted, or other way around.
Hs 1 MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK 60Ag 1 MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK 60
Hs 61 EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP 120Ag 61 EQVTSVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDHSGKSEEGAPQEGILEDMPVDP 120
Hs 121 DNEAYEMPSEEGYQDYEPEA 140Ag 121 DNEAYEMPSEEGYQDYEPEA 140
In humans, T at the 53rd site of a protein alpha-synuclein is pathogenic. However, in spider monkey normal alpha-synuclein contains this T. Probably, some other deviation of spider monkey alpha-synuclein from its human ortholog renders T at the 53rd site harmless. Thus, we can call this T a compensated pathogenic deviation (CPD).
As many as 10% of deviations of a non-human protein from its human ortholog would be deleterious, if placed into the human molecule individually.
![Page 18: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/18.jpg)
CDPs are very common in tRNAs. Three of them are present in mitochondrial tRNASer of Ursus maritimus (polar bear). Nucleotides corresponding to human pathogenic mutations are shown in red; predicted compensatory substitutions are shown in blue; and other deviations from the human ortholog, those unrelated to the pathogenic mutations or their compensations, are shown in green. Nucleotides found in healthy humans are shown in orange alongside the nonhuman sequence.
At least five mechanisms of compensation are known for pathogenic mutations that destroy a Watson-Crick pair in one of the four tRNA stems.
![Page 19: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/19.jpg)
Level-specific generalizations:3. Cells
Cells is not the lowest functional level - molecules is - but it is the first living level. Thus, in cells we encounter a staggering degree of complexity.
Unicellular green alga Acetabularia is ~5cm tall
A ciliate Stentor Human Hippocampalneuron
A cell contains a large number of functional units - promoters, mRNAs, ribosomes, and proteins. These units interact with each other, forming networks. Networks that describe the following 3 processes are particularly important:
transcription of genes physical interactions functional interactions of proteins of proteins
![Page 20: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/20.jpg)
Transcriptional regulatory network of the Saccharomyces cerevisiae. Transcription factor genes are green, regulated genes are brown, and those with both functions are red.
![Page 21: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/21.jpg)
Network of protein complexes in S. cerevisiae. Different functions are shown by colors. The gray edges connect complexes that share protein components. Exemplar complexes from each function are expanded to show individual proteins.
![Page 22: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/22.jpg)
A standard map of biochemical pathways, representing the metabolic network of the cell.
Networks of interacting units (produced by evolution!) is the essense of cells.But can we formulate any useful generalizations about them?
![Page 23: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/23.jpg)
3a) Networks within a cell are modular
Modularity of a network simply means that interactions between some components are tight and other interactions are loose.
Complexes of physically interacting proteins are modules.
![Page 24: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/24.jpg)
The genome of yeast Saccharomyces cerevisiae encodes ~7,000 proteins. Within the cell, they form ~700 different complexes of physically interacting proteins. Such complexes are modules, but this is not the whole story. Often, a protein can participate in several complexes. Some proteins always stick together and form "cores". Other proteins form "submodules" that can attach to different cores.
A protein complex, consisting of the core, 3 submodules, and other attachments.
![Page 25: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/25.jpg)
Modularity is also pervasive in transcruption and metabolic networks.
Transcription factors (boxes) separately regulate genes involved in different processes.
![Page 26: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/26.jpg)
Simple explanation: Well, nothing is going to be simple here! We only might assume that, perhaps, networks within cells are modular because such networks are evolvable and designable, and not because they are optimal.
Modules, associated with different functions, in the metabolic network in Escherichia coli.
Hierarchical organization of modularity in metabolic networks.
![Page 27: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/27.jpg)
3b) Networks with a cell consist of a small number of common motifs
Network motifs are patterns of interconnections that recur in many different parts of a network. All networks within cells consist mostly of a small number of motifs that evolved independently.
Much of the network of transcriptional interactions in Escherichia coli is composed of repeated appearances of three motifs. Each motif has a specific function in determining gene expression.
Feedforward loop: a transcription factor X regulates a second transcription factor Y, and both jointly regulate one or more operons Z1...Zn.
Example of a feedforward loop (L-arabinose utilization).
![Page 28: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/28.jpg)
SIM motif: a single transcription factor, X, regulates a set of operons Z1...Zn. X is usually autoregulatory. All regulations are of the same sign. No other transcription factor regulates the operons.
Example of a SIM system (arginine biosynthesis).
DOR motif: a set of operons Z1...Zm are each regulated by a combination of a set of input transcription factors, X1...Xn. DORs are detected as dense regions of connections.
Example of a DOR (stationary phase response).
![Page 29: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/29.jpg)
The most common motif in metabolic networks that regulate enzyme activity: negative feedback loop. Again, such loops evolved independently very many times in different metabolic pathways.
Simple explanation: Apparently, there are not too many feasible solutions for each of the simple regulatory tasks that a part of the network has to perform. We may be dealing with unique optimality here, as far as the overall structure of regulatory interactions is considered.
![Page 30: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/30.jpg)
Level-specific generalizations:4. Multicellular organisms
A cell is alive, but often cells are not independent. Multicellular organisms evolved from unicellular five times. Multicellular organisms are as complex as constituent cells, if not more. Obviously, cell differentiation, pattern formation, and overall properties of organisms are all essential.
Cell differentiation Pattern formation Overall phenotype
![Page 31: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/31.jpg)
4a) Cell differentiation involves combinatorial regulation of gene expression
The genome of a multicellular organism programs development of many different cell types, although it contain only slightly more genes that the genome of a unicellular organism. Greater complexity of multicellular organisms appears because, on average, their genes are regulated by a much larger number of transcription factors.
a, Simple eukaryotic transcriptional unit. A simple core promoter (TATA), upstream activator sequence (UAS) and silencer element. b, Complex metazoan transcriptional control modules consisting of multiple clustered enhancer modules interspersed with silencer and insulator elements.
Simple explanation: Opportunism or optimality? - we do not know.
![Page 32: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/32.jpg)
4b) In the development of vertebrates one stage is particularly conservative
The embryonic development of all vertebrates shows remarkable similarities at the early - but not the earliest - stage called the pharyngula. At this stage all vertebrates have notochord, dorsal hollow nerve cord, post-anal tail, and a series of paired branchial grooves, matched on the inside by a series of paired gill pouches. The pattern is known since XIX centry, as Von Baer's law.
Simple explanation:
Perhaps, early stage of development are less evolvable, because their changes afect all subsequent stages.
![Page 33: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/33.jpg)
Body size is plotted against time, for species of Borophaginae (a clade of extinct carnivors).
4c) Body size often increases with time, but declines on islands
This pattern is known as Cope's rule, and has been observed repeatedly. Larger animals are apparently more prone to extinction.
Clearly, this pattern cannot be universal! Indeed, there are many exceptions. In fact, on islands body size of many - but again not all - organism declines, a pattern known as Foster's Rule.
![Page 34: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/34.jpg)
Skeleton of a Cretan Dwarf Elephant.
The Pygmy Mammoth (Mammuthus exilis) was a dwarfed descendant of full-sized mammoths that lived on an island known as Santa Rosae.
Wrangel island - the range of another dwarfed mammoth, extinct only ~3,500ya.
Simple explanation:
Clearly, this is a mess!
![Page 35: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/35.jpg)
Level-specific generalizations:5. Populations
Here the complexity of our object drops again - a part may be more complex than the whole, if we can view parts as black boxes. Populations are sets of similar individuals, and we care only about those properties of inviduals that describe them as members of such sets, without looking under the hood.
Organism Individual Population of individuals
Complexity of life peaks at cells and organisms - lower and upper levels are simpler.
![Page 36: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/36.jpg)
5a) Reproduction almost always involves single-cell channels
Why to recreate big organisms from single cells, every generation?
Some other examples of vegetative reproduction
Even when reproduction is nominally vegetative - for example, a branch of a moss becomes an independent organism - all the cells of this branch may originate from a single apical meristemal cell.
Even mitochondria in female germline in mammals go through drastic bottlenecks - all mitochondia of a newborn are descendants of just 3-4 stem maternal mitochondria. Why?
Simple explanation: Perhaps, single-cell channels make selection more efficient, and thus reduce the mutation load.
![Page 37: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/37.jpg)
5b) Amphimixis is pervasive
Why is such a crazy process - alternation of syngamy and meiosis - ubiquitous?
Simple explanation: There is no definite explanation for the ubiquity of amphimixis. Almost 20 hypotheses have been proposed, and 3 or 4 among them make sense. We will consider this issue later.
Indeed, apomixis (asexual reproduction) is very common, but almost never represents the only mode of reproduction. The only known exception are bdelloid rotifers.
An obligately apomicticbdelloid rotifer.
![Page 38: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/38.jpg)
Level-specific generalizations:6. Ecosystems
As you know, ecosystems consist of interacting populations.
6a) Natural ecosystems can be successfully invaded.
An invasion present a paradox: why should an invader should be successful within the new environment, to which it never had a chance to adapt? Apparently, natural ecosystems have a lot of empty niches.
Simple explanation: There are several hypotheses but none is universally accepted. Still, it is clear that the problem is an evolutonary one.
Purple loosestrife, Lythrum salicaria, a very successful invader of European origin in North America.
Elodea canadensis, a very successful invader of North American origin in Eurasia.
![Page 39: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/39.jpg)
Generalizations concerned with diversity of life:
1. Diversity of life at a particular moment of time a) Every individual belongs to a population of at least ~1000 individuals b) At any moment, life mostly consists of compact, disconnected forms c) Genotypes are incompatible if the distance between them exceeds ~1-5%
2. Evolution of a lineage a) Changes of a lineage are continuous, with some caveats b) Genomes evolve at much more uniform rates than phenotypes
3. Birth and death of lineages a) Cladogenesis is often, but not always, triggered by geographic isolation b) Cladogenesis and extinction are extremely unfair processes c) Overall diversity of life fluctuates, with the long-term tendency to increase
4. Independent evolution in multiple lineages a) Evolution is predominantly divergent, but homoplasy is common in simple traits b) Independent evolution eventually leads to speciation
5. Coevolution a) Lineages often coevolve for a long time b) Organisms often imitate each other to avoid been eaten
6. Diversity in space a) Distributions of ranges of species are strongly affected by limited dispersal b) Independent evolution at different localities is often parallel
![Page 40: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/40.jpg)
Generalizations concerned with diversity of life:
As long as we are ready to ignore the complexity of life, evolution of its diversity is understood reasonably well.
1. Diversity of life at a particular moment of time
1a) Every individual belongs to a population of at least ~1000 individuals
Simple explanation: Population genetic theory demonstrates that a small population will soon become extinct due to inefficient selection against new deleterious mutations. We will consider this theory later.
This fundamental fact is so familiar that it is often taken for granted - although it should not.
Loch-Ness monster does not exist - there must be at least 1000 of them.
The same is probably true for yeti.
Mating ball of Garter snakes.
![Page 41: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/41.jpg)
1b) At any moment, life mostly consists of compact, disconnected forms
Indeed, at least among multicellular eukaryotes, we often encounter "good species", i. e. compact sets of similar and compatible organisms.
Often, a form of life is not very compact phenotypically, but it still compatible and connected within itself, and disconnected from other forms.
![Page 42: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/42.jpg)
Aquilegia formosa Aquilegia pubescens
Sometimes, two compatible phenotypes are connected by only a relatively small number of hybrids, so it is not clear whether to treat them all as one form of life or not.
Occasionally, connection exists even between incompatible genotypes.
Simple explanation: There are probably several reasons behind this generalization:
(i) species might be adapted to discontinuous ecological niches,
(ii) Anagenesis is only rarely coupled with continuous range expansion, and that such expansion cannot be too long - because the Earth is too small.
![Page 43: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/43.jpg)
c) Genotypes are incompatible if the distance between them exceeds ~3- 10%
Very often, incompatible genotypes are also disconnected (again, only within modern organisms). There are no living, fit intermediates between dog and cat ,or horse and donkey.
Two partially compatible, disconnected genotypes (mules are viable, but sterile).
nothing to show
Two incompatible, disconneced genotypes - the most common situation.
![Page 44: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/44.jpg)
Still, compatible genotypes (left and right) may be disconnected, due to geographical isolation (hybrid in the center was produced artificially).
Occasionally, even incompatible genotypes remain connected.
Simple explanation: There is no need to explain why incompatibility increases with dissimilarity. However, a likely reason for a rapid transition to incompatibility is nontrivial and is known as Orr's snowball.
![Page 45: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/45.jpg)
Generalizations concerned with diversity of life:
2. Evolution of a lineage a) Changes of a lineage are continuous, with some caveats
Children aresimilar to parents
A rare exception: symbiogenesisA rare exception: WDG
Simple explanation:
With some exceptions, long parent-offspring leaps within the space of genotypes are just impossible: most of potential genotypes are junk, and a long leap will land you in junk.
![Page 46: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/46.jpg)
b) Genomes evolve at much more uniform rates than phenotypes
At the level of sequences, different lineages can easily accumulate changes at rates that vary within a factor of 1.5-2.0, but variation of rates is rarely large.
Lengths of dog, mouse, and human branches of the unrooted phylogenetic tree in numbers of nucleotide substitutions per a synonymous (Ks) and a nonsynonymous site (Ka).
Sequences evolved almost 3 times faster on the mouse branch than on the human branch - because the number of generations was much higher in the mouse branch.
![Page 47: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/47.jpg)
Simple explanation:
No law of nature prescribes a constant rate of genome evolution. Thus, its approximate uniformity is something of a mystery. We will consider this issue later.
Heterogeneity in rates of phenotypical evolution must be, at least partially, due to heterogeneity of strength of Darwinian natural selection.
In contrast, phenotypes occasionally evolve at very different rates along different branches.
![Page 48: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/48.jpg)
Generalizations concerned with diversity of life:
3. Birth and death of lineages 3a) Cladogenesis is often, but not always, triggered by geographic isolation
Geographical isolation always leads to unlimited divergence. However, this is not the whole story.
![Page 49: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/49.jpg)
A lineage can also split into two even without geographic subdivision. This process is called sympatric speciation.
For example, in a crater lake Apoyo in Nicaragua a new species of cichlids evolved sympatrically in the course of ~10,000 years.
Amphilophus citrinellus (left) is the ancestral form and A. zaliosus (right) is a new species.
Simple explanation:
If a lineage is subdivided into two isoalted parts, these parts are bound to evolve independently and, eventually, will become very dissimilar, disconnected and incompatible- because evolution is primarily divergent. This is trivial.
In contrast, cladogenesis without prior geographical isolation is a complex and fascinating subject, to be considered later.
![Page 50: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/50.jpg)
3b) Cladogenesis and extinction are extremely unfair processes
We already saw this may times.
Simple explanation:
Why should they be fair? Is life fair? Specific reasons for unfairness, however, are not clear, and may be 1) "Key innovations", 2) Ecological opportunities, 3) Chance.
Questions to think about:Can we say that a clade which diversifies faster has a selective advantage over a clade which diversifies slower? Is it true that species from a more diverse clade are more advanced (derived)? Is Amborella a living fossil?
![Page 51: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/51.jpg)
3c) Overall diversity of life fluctuates, with the long-term tendency to increase
Simple explanation:
Initially, the diversity of life was low, so it could only grow from there. However, it is not clear why an equilibrium has not yet been reached.
Reliable data exist only for times since Cambrian, but the tendency is clear.
![Page 52: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/52.jpg)
Generalizations concerned with diversity of life:
4. Independent evolution in multiple lineages 4a) Evolution is predominantly divergent, but homoplasy is common in simple traits
When a complex enough genotype or phenotype is considered, divergence always dominates. Divergence of sequences eventually reaches saturation at ~75%, but divergence of phenotypes is unlimited.
![Page 53: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/53.jpg)
However, homoplasy is also common, as long as we consider simple traits that can only accept a small number of states.
Homo fkVmnasdfrtshnmcvadnmd Macaca fklmnasdfrtshnmcvqdnmd Rattus fklmnatdfrtshnmcvadnmd Mus fkvmnasdfrtshnicvadnmd
In contrast, at the level of complex phenotypes, homoplasy is always superficial.
Simple explanation:
Imagine two hikers wandering in a 41,000,000-dimensional forest, starting from the same location. Thus, at the level of complex genotypes and phenotypes, homoplasy must be forced by similar selection operating on different lineages. In contrast, when we consider a 1-dimensional subspace with only 4 or 20 states, random homoplasy is possible, and is quite common because if an even occurred in one lineage it must be harmless.
![Page 54: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/54.jpg)
4b) Independent evolution eventually leads to speciation
This is always the case, qualitatively. Quantitatively, however, the rates of speciation can vary. On the one hand, lineages which became geographically isolated over 40 Mya may still hybridize and produce fertile offspring.
Platanus orientalis Their hybrid, "London plane" Platanus occidentalis from Asia from North America
On the other hand, host races of insects with high degree of reproductive isolation can appear after ~100 years of different selection.
Simple explanation:
Because independent evolution is mostly divergent and incompatibility increases with dissimilarity, this pattern in inavoidable.
Alphalpha (left) and clover (right) races of pea aphid Acyrthosiphon pisum are reproductively isolated to a large degree.
![Page 55: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/55.jpg)
Generalizations concerned with diversity of life:
5. Coevolution 5a) Lineages often coevolve for a long time
Often, a host and its symbiont or parasite have congruent phylogenies, suggesting their co-divergence (cospeciation). An example of this is provided by mealybugs and their bacteria symbiont Tremblaya.
A spectacular example of a long-term coevolving association are figs and fig wasps, which cospeciate for over 60My.
Simple explanation:
This is not surprising, when the host and the symbiont totally depend on each other.
![Page 56: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/56.jpg)
5b) Organisms often imitate each other to avoid been eaten
Mimicry is a spectacular phenomenon. There are two kinds of mimicry.
Batesian mimics where the mimic resembles the successful species but does not share the attribute that discourages predation.
Palatable viceroy Limenitis archippus (top) mimics bitter monarch Danaus plexippus.
Non-venomous Scarlet kingsnake Lampropeltis triangulum (top) mimics deadly coral snake Micruroides euryxanthus.
![Page 57: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/57.jpg)
Müllerian mimics where the mimic resembles the successful species and shares the anti-predation attribute (dangerous or unpalatable.)
Heliconius erato (above), and H. melpomene (below), a pair of impalatable Müllerian mimics from different areas of Ecuador and Northern Peru. Within any area, the two species are extremely accurate mimics of one another, but major geographic differences in colour pattern have evolved within each species.
Simple explanation:
This is natural selection!A question to think about: Does mimicry constitute an evidence for evolution?(do not tell anybody, but here I disagree with Darwin).
![Page 58: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/58.jpg)
Generalizations concerned with diversity of life:
6. Diversity in space 6a) Distributions of ranges of species are strongly affected by limited dispersal
For example, there are 13 species of finches on the Galapagos islands, occupying a wide variety of ecological niches.
Simple explanation:
Limited dispersal can strongly affect the outcomes of even slow evolution.
This is a trully pervasive pattern.
![Page 59: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/59.jpg)
6b) Independent evolution at different localities is often parallel
Simple explanation:
This is natural selection! The arrays of ecological niches available for similar organisms at different places tend to be similar.
![Page 60: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/60.jpg)
Generalizations concerned with adaptation and complexity:
1. Genetical aspects of adaptive evolution a) Evolution of both coding and non-coding sequences is important for adaptation b) The target for strong positive selection is narrow at each moment c) Tightly related genes can perform rather different functions
2. Phenotypic aspects of adaptive evolution a) Adaptations can be very general and very specific b) Evolution is irreversible c) Perhaps, all adaptations are imperfect
3. Origin of novelties a) New non-coding regulatory sites, but not new genes, often appear from scratch b) Origin of phenotypic novelties is usually opportunistic and can happen fast
4. Dynamics of complexity a) Complex phenotypes evolve through adaptive intermediate stages b) Complexity is rapidly lost, if selection stops maintaining it c) The overall trend is for complexity to increase
![Page 61: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/61.jpg)
Generalizations concerned with adaptation and complexity:
Of the two main assignments of evolutionary biology, to understand the origin of diversity and of complexity and adaptation of life, the second one is by far the most difficult.
1. Genetical aspects of adaptive evolutionGenetics of adaptive evolution is understood better than it other aspects.
1a) Evolution of both coding and non-coding sequences is important for adaptation
Simple explanation:
It is only natural that adaptation may involve changes both in proteins and in regulation of their synthesis.
![Page 62: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/62.jpg)
1b) The target for strong positive selection is narrow at each moment
In a typical protein sites that are currently under positive selection are rare and interspersed among numerous sites under negative selection.
Simple explanation:
Natural selection is, above all, a conservative force. Also, a large target for positive selection would imply substantial suboptimality of the phenotype, which may be lethal.
Sites that were under recent positive selection are painted red in a primate seminal protein Kallikrein 2 and in HIV-1 protein gp120. Usually, the fraction of such sites is much lower.
Positive selection in non-coding segments also appears to be relatively rare.
![Page 63: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/63.jpg)
1c) Tightly related genes can perform rather different functions
Occasionally, a protein completely changes its function due to not too many changes.
MATEGDKLLGGRFVGSTDPIMEILSSSISTEQRLTEVDIQASMAYAKALEKASILTKTELEKILSGLEKISEESSKGVLVMA+EGDKL.GGRF.GSTDPIME+L+SSI+.+QRL+EVDIQ.SMAYAKALEKA.ILTKTELEKILSGLEKISEE..SKGVVMASEGDKLWGGRFSGSTDPIMEMLNSSIACDQRLSEVDIQGSMAYAKALEKAGILTKTELEKILSGLEKISEEWSKGVFV
MTQSDEDIQTAIERRLKELIGDIAGKLQTGRSRNEQVLTDLKLLLKSSTSVISTHLLQLIKTLVERAAIEIDIIMPGYTH+.QSDEDI.TA.ERRLKELIGDIAGKL.TGRSRN+QV+TDLKLLLKSS.SVISTHLLQLIKTLVERAA.EID+IMPGYTHVKQSDEDIHTANERRLKELIGDIAGKLHTGRSRNDQVVTDLKLLLKSSISVISTHLLQLIKTLVERAATEIDVIMPGYTH
LQKALPIRWSQFLLSHAVALTRDSERLGEVKKRITVLPLGSGALAGNPLEIDRELLRSELDMTSITLNSIDAISERDFVVLQKALPIRWSQFLLSHAVAL.RDSERLGEVKKR++VLPLGSGALAGNPLEIDRELLRSELD..SI+LNS+DAISERDFVVLQKALPIRWSQFLLSHAVALIRDSERLGEVKKRMSVLPLGSGALAGNPLEIDRELLRSELDFASISLNSMDAISERDFVV
ELISVATLLMIHLSKLAEDLIIFSTTEFGFVTLFDAYSTGSSLLPQKKNPDSLELIRSKAGRVFGRLAAILMVLKGIPSTEL+SVATLLMIHLSKLAEDLIIFSTTEFGFVTL.DAYSTGSSLLPQKKNPDSLELIRSKAGRVFGRLAA+LMVLKG+PSTELLSVATLLMIHLSKLAEDLIIFSTTEFGFVTLSDAYSTGSSLLPQKKNPDSLELIRSKAGRVFGRLAAVLMVLKGLPST
FSKDLQEDKEAVLDVVDTLTAVLQAATEVISTLQVNKENMEKALTPELLSTDLALYLVRKGMPIRQAQTASGKAVHLAET++KDLQEDKEAV.DVVDTLTAVLQ.AT.VISTLQVNKENMEKALTPELLSTDLALYLVRKGMP.RQA..ASGKAVHLAETYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQVNKENMEKALTPELLSTDLALYLVRKGMPFRQAHVASGKAVHLAET
KGITINNLTLEDLKSISPLFASDVSQVFSVVNSVEQYTAVGGTAKAAKGI.IN.LTLEDLKSISPLFASDVSQVF++VNSVEQYTAVGGTAK++KGIAINKLTLEDLKSISPLFASDVSQVFNIVNSVEQYTAVGGTAKSS
Delta-crystalline (top) and argininosuccinate lyase (bottom), both of chicken, Gallus gallus.
Simple explanation:There are often many peaks on the fitness landscape, and the closest peak may be not far away from any point in phase space. A little editing replaces fuction A with function B.
![Page 64: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/64.jpg)
Generalizations concerned with adaptation and complexity:
2. Phenotypic aspects of adaptive evolutionThis is the most difficult, and the least understood, facet of evolutionary biology.
2a) Adaptations can be very general and very specific
Simple explanation:
Why not?
Heart is a general adaptation, necessary for any large active organism.
Coloration of viceroy would not be adaptive without monarch
![Page 65: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/65.jpg)
2b) Evolution is irreversible
Reversals at individual simple traits are common, but a reversal of substantial evolution has never been observed.
Can a hermit crab abandon its dependence on gastropod shells?
Yes, it can! King crabs originated from hermit crabs.
![Page 66: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/66.jpg)
Still, king crabs retained asymmetrical abdomens of their hermit crab ancestors.
Another example: aquatic tetrapods still need air for breezing:
Simple explanation:
Perhaps, fitness landscapes are too complex and variable to allow exact return to the starting point of an evolutionary trajectory.
![Page 67: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/67.jpg)
2c) Perhaps, all adaptations are imperfect
We have no good data to directly suport this hypothesis, because measuring adaptation precisely is currently impossible. However, it seems very likely because:
i) Most of fitness landscapes probably have multiple peaks, and the probability of reaching the highest peak, after climbing strictly up from a random starting point, is very low.
ii) Often, an apparently good adaptation is achieved by a slight modification of a phenotype that performed an unrelated function.
![Page 68: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/68.jpg)
Generalizations concerned with adaptation and complexity:
3. Origin of noveltiesOrigin of new functions is a particularly intriguing aspect of the adaptive evolution.
3a) New non-coding regulatory sites, but not new genes, often appear from scratch
Binding sites of transcription factor Zeste and shown by boxes, the sites in the top two and bottom two species are located differently, indicating their gains and losses.
In contrast, the origin of a protein-coding gene from scratch (i. e., entirely from a non-coding sequence) is a very rare event - so far, only ~10 such occasions have been documented.
Simple explanation:
A typical transcription factor-binding site is small enough to "condence from chaos. In contrast, a random segment very rarely encodes even a slightly useful protein.
![Page 69: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/69.jpg)
3b) Origin of phenotypic novelties is usually opportunistic and can happen fast
Even a novel function tends to appear on the basis of a pre-existing adaptation.
Feathers of flightless dinosaurs allowed birds to evolve flight.
MATEGDKLLGGRFVGSTDPIMEILSSMA+EGDKL.GGRF.GSTDPIME+L+SMASEGDKLWGGRFSGSTDPIMEMLNSOrigin of a crystalline from an enzyme.
Males of a toothed whale narwhal (Monodon monoceros) have a 2-3 m long tusk, which is an incisor tooth on the left side of the upper jaw.
![Page 70: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/70.jpg)
Skeletons of semiaquatic mammals transitional from land to sea in the origin of whales.
Making a whale from a "protohippo" took ~15 My.
Making a human from an ape took ~5My.
Simple explanation:
Evolution is not apt to perform long jumps in the space of phenotypes, and works with pre-existing material. Apparently, under strong positive selection evolutiona can be fast.
![Page 71: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/71.jpg)
Generalizations concerned with adaptation and complexity:
4. Dynamics of complexityHere, generalizations is almost all we have.
4a) Complex phenotypes evolve through adaptive intermediate stages
Simple explanation:
Evolution cannot do it any other way, but we still do not really know how this happens.
![Page 72: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/72.jpg)
4b) Complexity is rapidly lost, if selection stops maintaining it
Simple explanation:
To demolish is easier than to build.
A parasitic plant Epifagus virginiana lost many key genes in its chloroplast genome
Mycobacterium leprae is in the middle of massive genome degeneration
Astyanax mexicana, like many other cave animals, has degenerated eyes
A crustacean parasite of fish, Lernaea carassii, has profoundly simplified morphology
![Page 73: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/73.jpg)
4c) The overall trend is for complexity to increase
There is no law of nature that would force complexity to always increase - because it can easily decline. Still, the overall trend is up.
Simple explanation:
Initially, the complexity was low, so the only direction for it to change was up. This is not the whole story, of course.
![Page 74: Topic 8. Lecture 12. Generalizations emerging from past evolution](https://reader034.vdocuments.mx/reader034/viewer/2022042822/56814487550346895db11d0c/html5/thumbnails/74.jpg)
Quiz:
Formulate your own generalization about evolution at any level of organization of life. This generalization does not need to be sweeping and very important - just make sure that it makes sense.