protein structure ist 444. protein chemistry basics proteins are polymers consisting of amino acids...
TRANSCRIPT
![Page 1: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/1.jpg)
Protein Structure
IST 444
![Page 2: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/2.jpg)
Protein Chemistry Basics
• Proteins are polymers consisting of amino acids linked by peptide bonds
• Each amino acid consists of:– a central carbon atom– an amino group NH2
– a carboxyl group COOH– a side chain (R group)
• Differences in side chains distinguish different amino acids.
![Page 3: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/3.jpg)
![Page 4: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/4.jpg)
O H O H O H O H O H O H O H
H3N+ CH C N CH C N CH C N CH C N CH C N CH C N CH C N CH COO-
Asp Arg Val Tyr Ile His Pro Phe D R V Y I H P F
Protein sequence: DRVYIHPF
repeating backbone structure
repeating backbone structure
CH2 CH2 CH CH2 H C CH3 CH2 CH2 CH2 CH2
COO- CH2 H3C CH3 CH2 HC CH CH2
CH2 CH3 HN N OH NH CH
C
NH2 N+H2
![Page 5: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/5.jpg)
Hydrophobic stays inside, while hydrophilic stay close to water
Oppositely charged amino acids can form salt bridge.
Polar amino acids can participate hydrogen bonding
Side Chains Determine Structure
![Page 6: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/6.jpg)
![Page 7: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/7.jpg)
Steps in Obtaining Protein Structure
Target selection
Obtain, characterize protein
Determine, refine, model the structure
Deposit in repository
![Page 8: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/8.jpg)
Domain, Fold, Motif
• A protein chain could have several domains– A domain is a discrete portion of a protein, can fold
independently, possess its own function
• The overall shape of a domain is called a fold. There are only a few thousand possible folds.
• Sequence motif: highly conserved protein subsequence
• Structure motif: highly conserved substructure
![Page 9: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/9.jpg)
Protein Data BankProtein structures, solved using experimental techniques
Unique structural folds
Different structural folds
Same structural folds
![Page 10: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/10.jpg)
Protein Structure Determination
• High-resolution structure determination– X-ray crystallography (~1Å)– Nuclear magnetic resonance (NMR) (~1-2.5Å)
• Low-resolution structure determination– Cryo-EM (electron-microscropy) ~10-15Å
![Page 11: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/11.jpg)
X-ray crystallography• most accurate
• An extremely pure protein sample is needed.
• The protein sample must form crystals that are relatively large without flaws. Generally the biggest problem.
• Many proteins aren’t amenable to crystallization at all (i.e., proteins that do their work inside of a cell membrane).
• ~$100K per structure
![Page 12: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/12.jpg)
Nuclear Magnetic Resonance
• Fairly accurate
• No need for crystals
• limited to small, soluble proteins only.
![Page 13: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/13.jpg)
Protein Structure Visualization
• http://www.umass.edu/microbio/chime/top5.htm
• http://molvis.sdsc.edu/visres/• Rasmol• Chime• Protein Explorer• DeepView• JmolJava
![Page 14: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/14.jpg)
Secondary Structure Prediction
• Rules developed from PDB data• Chou and Fasman (1974) developed an
algorithm based on the frequencies of amino acids found in a helices, b-sheets, and turns.
• Proline: occurs at turns, but not in a helices.• http://prowl.rockefeller.edu/aainfo/chou.htm• Modern algorithms: use multiple sequence
alignments and achieve higher success rate (about 70-75%)
![Page 15: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/15.jpg)
Ramachandran Plot
a way to visualize dihedral angles φ (phi) against ψ (psi) of amino acid residues in protein structure.
![Page 16: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/16.jpg)
Chou Fasman 1974• measured frequencies at which each amino acid appeared in
particular types of secondary sequences in a set of proteins of known structure
• assigns the amino acids three conformational parameters based on the frequency at which they were observed in alpha helices, beta sheets and beta turns – P(a) = propensity to form alpha helices – P(b) = propensity to form beta sheets – P(turn) = propensity to form beta turns
• also assigns 4 turn parameters based on frequency at which they were observed in the first, second, third or fourth position of a beta turn – f(i) = probability of being in position 1 – f(i+1) = probability of being in position 2 – f(i+2) = probability of being in position 3 – f(i+3) = probability of being in position 4
![Page 17: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/17.jpg)
.
A.A.P(a) P(b) P(turn) f(i) f(i+1) f(i+2) f(i+3)
Alanine 142 83 66 0.060 0.076 0.035 0.058
Arginine 98 93 95 0.070 0.106 0.099 0.085
Asparagine 67 89 156 0.161 0.083 0.191 0.091
Aspartic acid 101 54 146 0.147 0.110 0.179 0.081
Cysteine 70 119 119 0.149 0.050 0.117 0.128
Glutamic acid 151 37 74 0.056 0.060 0.077 0.064
Glutamine 111 110 98 0.074 0.098 0.037 0.098
Glycine 57 75 156 0.102 0.085 0.190 0.152
Histidine 100 87 95 0.140 0.047 0.093 0.054
Isoleucine 108 160 47 0.043 0.034 0.013 0.056
Leucine 121 130 59 0.061 0.025 0.036 0.070
Lysine 114 74 101 0.055 0.115 0.072 0.095
Methionine 145 105 60 0.068 0.082 0.014 0.055
Phenylalanine 113 138 60 0.059 0.041 0.065 0.065
Proline 57 55 152 0.102 0.301 0.034 0.068
Serine 77 75 143 0.120 0.139 0.125 0.106
Threonine 83 119 96 0.086 0.108 0.065 0.079
Tryptophan 108 137 96 0.077 0.013 0.064 0.167
Tyrosine 69 147 114 0.082 0.065 0.114 0.125
Valine 106 170 50 0.062 0.048 0.028 0.053
![Page 18: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/18.jpg)
Chou Fasman isn’t Perfect
• Accuracy = 50-85%, depending on the protein
• http://npsa-pbil.ibcp.fr/NPSA/npsa_references.html
• Software and sites for protein predictions
![Page 19: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/19.jpg)
GOR (Garnier, Osguthorpe and Robson)
• Another commonly used algorithm, uses a window of 17 amino acids to predict secondary structure
• rationale: experiments show each amino acid has a significant effect on the conformation of amino acids up to 8 positions in front or behind it.
• a collection of 25 proteins of known structure was analyzed, and the frequency at which each amino acid was found in helix, sheet, turn or coil within the 17 position window was determined – this creates a 17 *20 scoring matrix that is used to
calculate the most likely conformation of each amino acid within the 17 a.a. window
• This window slides down the primary sequence, scoring the most likely conformation for each amino acid based on the neighboring amino acids.
• Accuracy is about 65%
![Page 20: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/20.jpg)
Signal for a Coiled Region
• Gapped in multiple alignments• Small polar residues
–Ala
–Gly (v. small so flexible)
–Ser
–Thr • Prolines rarer in other kinds of secondary
structure
![Page 21: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/21.jpg)
How to Find Patterns Mathematically
![Page 22: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/22.jpg)
Hidden Markov Models
• Hidden Markov Models (HMMs) are a more sophisticated form of profile analysis.
• Rather than build a table of amino acid frequencies at each position, they model the transition from one amino acid to the next.
• Pfam is built with HMMs.
![Page 23: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/23.jpg)
Hidden Markov Models
![Page 24: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/24.jpg)
Sample ProDom Output
![Page 25: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/25.jpg)
Discovery of new Motifs
• All of the tools discussed so far rely on a database of existing domains/motifs
• How to discover new motifs– Start with a set of related proteins– Make a multiple alignment– Build a pattern or profile
![Page 26: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/26.jpg)
Depicting Structure
Beta Sheet
Helix
LoopPDB ID: 12as
![Page 27: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/27.jpg)
PDB New Fold Growth
• Only a few thousand unique folds in nature
• 90% of new structures deposited to PDB in the past three years have similar structural folds
New fold
Old fold
![Page 28: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/28.jpg)
• Secondary structure is context-dependent
• Elements may be predicted to ID topology
• Generally only 50% of a structure is alpha-helix or beta-sheet.
• Beta-strands have necessarily longer range associations.
![Page 29: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/29.jpg)
Secondary Structure• Protein secondary structure takes one of
three forms: Alpha helix Beta pleated sheet Turn
• 2ndary structure is predicted within a small window
• Many different algorithms, not highly accurate• Better predictions from a multiple alignment
![Page 30: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/30.jpg)
Signals for Alpha Helices
• Amphipathic helices interact with core and solvent– Characteristic
hydrophobicity profile
• Prolines disrupt the middles of helices
![Page 31: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/31.jpg)
Signals for beta strands
• Edge strands alternate hydrophobic/hydrophilic
• Center strands all hydrophobic
• Strands are extended so few residues per core span
![Page 32: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/32.jpg)
Antiparallel Beta Sheet Parallel Beta Sheet
Peptide chains have a directionality conferred by their N-terminus and C-terminus. β strands can be said to be directional, indicated by an arrow pointing toward the C-terminus.
Adjacent β strands can form hydrogen bonds in antiparallel, parallel, or mixed arrangements.
Antiparallel β strands alternate directions so that the N-terminus of one strand is adjacent to the C-terminus of the next. This produces the strongest inter-strand stability because it allows the inter-strand hydrogen bonds between carbonyls and amines to be planar, which is their preferred orientation.
![Page 33: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/33.jpg)
Beta Sheet (Antiparallel)
![Page 34: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/34.jpg)
R groups don’t form these secondary structures, but block formation of the secondary
structures . The bonds forming the structures are from the amino and carboxy groups of the amino acid residues.
![Page 35: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/35.jpg)
Signal for a Beta Strand
![Page 36: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/36.jpg)
Creating Beta Sheets
• Large aromatic residues (Tyr, Phe and Trp) and β-branched amino acids (Thr, Val, Ile) are favored to be found in β strands in the middle of β sheets. Interestingly, different types of residues (such as Pro) are likely to be found in the edge strands in β sheets
![Page 37: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/37.jpg)
Protein Classification
• Family: homologous, same ancestor, high sequence identity, similar structures
• Super Family: distant homologous, same ancestor, sequence identity is around 25%-30%, similar structures.
• Fold: only shapes are similar, no homologous relationship, low sequence identity.
• Protein classification databases: Pfam, SCOP, CATH, FSSP
![Page 38: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/38.jpg)
Pfam
• http://www.sanger.ac.uk/Software/Pfam/
• Protein sequence classification database
• As of Pfam 24.0 (October 2009, 11912 families)
• Multiple sequence alignment for each family, then modeled by a HMM model
![Page 39: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/39.jpg)
SCOP: Structural Classification of Proteins
http://scop.mrc-lmb.cam.ac.uk/scop/Protein structure classification database, manually curated110800 Domains, 38221 PDB entries
Class # folds # superfamilies # families
All alpha proteins 284 507 871
All beta proteins 174 354 742
Alpha and beta proteins (a/b) 147 244 803
Alpha and beta proteins (a+b) 376 552 1055
Multi-domain proteins 66 66 89
Membrane and cell surface 58 110 123
Small proteins 90 129 219
Total 1195 1962 3902
![Page 40: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/40.jpg)
SCOP
• Nearly all proteins have structural similarities with other proteins and, in some of these cases, share a common evolutionary origin.
• The SCOP database, created by manual inspection and automated methods, aims to provide a detailed and comprehensive description of the structural and evolutionary relationships between all proteins whose structure is known.
• SCOP provides a broad survey of all known protein folds, detailed information about the close relatives of any particular protein, and a framework for future research and classification.
![Page 41: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/41.jpg)
The Problem• Protein functions determined
by 3D structures
• ~ 30,000 protein structures in PDB (Protein Data Bank)
• Experimental determination of protein structures time-consuming and expensive
• Many protein sequences available
sequence
proteinstructure
function
medicine
![Page 42: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/42.jpg)
Protein Structure Prediction
• In theory, a protein structure can be solved computationally
• A protein folds into a 3D structure to minimizes its free potential energy
• The problem can be formulated as a search problem
for minimum energy– the search space is enormous– the number of local minima increases exponentially
Computationally it is an exceedingly difficult problem
![Page 43: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/43.jpg)
Who Cares?• Long history: more than 30 years• Listed as a “grand challenge” problem• IBM’s big blue• Competitions: CASP (1992-2006)
• Useful for– Drug design– Function annotation– Rational protein engineering– Target selection
![Page 44: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/44.jpg)
Observations• Sequences determine structures
• Proteins fold into minimum energy state.
• Structures are more conserved than sequences. Two protein with 30% identity likely share the same fold.
![Page 45: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/45.jpg)
What determines structures?
• Hydrogen bonds: essential in stabilizing the basic secondary structures
• Hydrophobic effects: strongest determinants of protein structures
• Van der Waal Forces: stabilizing the hydrophobic cores
• Electrostatic forces: oppositely charged side chains form salt bridges
![Page 46: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/46.jpg)
Protein Structure Prediction• Stage 1: Backbone
Prediction– Ab initio folding– Homology
modeling– Protein threading
• Stage 2: Loop Modeling
• Stage 3: Side-Chain Packing
• Stage 4: Structure Refinement
The picture is adapted from http://www.cs.ucdavis.edu/~koehl/ProModel/fillgap.html
![Page 47: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/47.jpg)
State of The Art• Ab inito folding (simulation-based method)
1998 Duan and Kollman36 residues, 1000 ns, 256 processors, 2 monthsDo not find native structure
• Template-based (or knowledge-based) methods– Homology modeling: sequence-sequence alignment,
works if sequence identity > 25%
– Protein threading: sequence-structure alignment, can go beyond the 25% limit
![Page 48: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/48.jpg)
Sample Structure Prediction
....,....1....,....2....,....3....,....4....,....5....,....6 AA |MMSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVG| PHD sec | HHHHHHHHHHHHHHHH EEEEEEEEEEEEE EEEEEEEE | Rel sec |999997899667599999999989997655877843368889999999233399999658| detail: prH sec |000000000221289999999989998762011111000000000000000000000000| prE sec |000000000000000000000000000010000023578889989888536699999720| prL sec |999898889777600000000010001126888865311110000000363300000278| subset: SUB sec |LLLLLLLLLLLLLHHHHHHHHHHHHHHHHLLLLL...EEEEEEEEEEE....EEEEEELL| ACCESSIBILITY 3st: P_3 acc |bbebbeeeeeebbeebbebbeebeeebeeeeeee eebebbebebbbbbb bbbbeb bb| 10st: PHD acc |007006778670077007007706760777777737707007060000005000060500| Rel acc |103021343252044604644672424555547615444425212186671016926120| subset: SUB acc |.......e..e..eeb.ebbeeb.e.beeeeeee.eebeb.e....bbbb...bb.b...|
![Page 49: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/49.jpg)
“Super-secondary” Structure
• Common structural motifs– Membrane spanning (GCG= TransMem)
– Signal peptide (GCG= SPScan)
– Coiled coil (GCG= CoilScan)
– Helix-turn-helix (GCG = HTHScan)
![Page 50: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/50.jpg)
Transmembrane Structures
![Page 51: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/51.jpg)
Signal Peptide
![Page 52: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/52.jpg)
Coiled Coil
![Page 53: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/53.jpg)
Helix Turn Helix
![Page 54: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/54.jpg)
Fig. 9.23
![Page 55: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/55.jpg)
Finding Information in Protein Sequences
![Page 56: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/56.jpg)
There Are Many Meaningful Protein Signals
• Predicting protein cleavage sites
• Predicting signal peptides
• Predicting transmembrane domains
![Page 57: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/57.jpg)
Signal Peptides
• Proteins have intrinsic signals that govern their transport and localization in the cell.
• Noble Prize to Gunter Blobel in 1999 for describing protein signaling.
• Proteins have to be transported either out of the cell, or to the different compartments - the organelles - within the cell.
![Page 58: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/58.jpg)
Signal Peptides
• Newly synthesized proteins have an intrinsic signal that is essential for governing them to and across the membrane of the endoplasmic reticulum, one of the cell’s organelles.
• How do large proteins traverse the tightly sealed, lipid-containing, membranes surrounding the organelles?
![Page 59: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/59.jpg)
Signal Peptides
• The signal consists of a peptide: a sequence of amino acids in a particular order that form an integral part of the protein.
• Specific amino acid sequences (topogenic signals) determine whether a protein will pass through a membrane into a particular organelle, become integrated into the membrane, or be exported out of the cell.
![Page 60: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/60.jpg)
![Page 61: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/61.jpg)
![Page 62: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/62.jpg)
Signal Peptides
• Software exists that can predict the signal peptide sequences.
• The SignalP World Wide Web server predicts the presence and location of signal peptide cleavage sites in amino acid sequences from different organisms:– Gram-positive prokaryotes– Gram-negative prokaryotes– Eukaryotes.
![Page 63: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/63.jpg)
Signal Peptides
• The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction based on a combination of several artificial neural networks.
• Artificial neural networks are collections of mathematical models that emulate some of the observed properties of biological nervous systems and draw on the analogies of adaptive biological learning.
![Page 64: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/64.jpg)
Patterns in Unaligned Sequences
• Sometimes sequences may share just a small common region– common signal peptide– new transcription factors
• MEME: San Diego Supercomputing Facility
– http://www.sdsc.edu/MEME/meme/website/meme.html
• MEME uses Hidden Markov Models
![Page 65: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/65.jpg)
Protein Secondary Structure• CATH (Class, Architecture,Topology,
Homology) http://www.biochem.ucl.ac.uk/dbbrowser/cath/
• SCOP (structural classification of proteins) -hierarchical database of protein folds http://scop.mrc-lmb.cam.ac.uk/scop
• FSSP Fold classification using structure-structure alignment of proteins http://www2.ebi.ac.uk/fssp/fssp.html
• TOPS Cartoon representation of topology showing helices and strands
• http://tops.ebi.ac.uk/tops/
![Page 66: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/66.jpg)
Protein Sequence Hierarchy
SUPERFAMILY
FAMILY
DOMAIN
FOLD or MOTIF
Active SITE
RESIDUE
![Page 67: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/67.jpg)
Protein families
• Proteins can be divided into families by:– Sequence.– Structure.– Function.
• Secondary databases divide proteins into families.
![Page 68: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/68.jpg)
Protein families
• Types of secondary databases:
• “Curated” databases: Expert judgment of each family (Prosite, prints, Pfam).
• “Automated” databases: Constructed automatically (Blocks, ProDom).
![Page 69: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/69.jpg)
Prosite• Characterization of protein families by conserved
motifs observed in a multiple sequence alignments of known homologues.
• Each family is defined by a single pattern.
• Motifs:
![Page 70: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/70.jpg)
Prosite
• Each entry includes: Pattern and sometimes also a profile.
• Pattern is a method for describing a conserved sequence (consensus, profile).
• Sample entry
![Page 71: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/71.jpg)
Prosite Structure
• Entries are divided into two files
– Pattern file: the pattern and all Swiss-Prot matches.
– Documentation file: Details of the characterized family, a description of the biological role of the chosen motif, references.
![Page 72: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/72.jpg)
Prosite
• Pattern are described using regular expressions.
• Example:W-x(9,11)-[FYV]-[FYW]-x(6,7)-[GSTNE]
• Regular expressions retain only conserved or significant residue information
![Page 73: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/73.jpg)
Prosite
A A C T T G
A A G T C G
C A C T T C
1 2 3 4 5
A 0.66 1 0 0 .
T 0 0 0 1 .
C 0.33 0 0.66
0 .
G 0 0 0.33
0 .
A A C T T G
[AC-]A-]GC[-T-]TC[-]GC[
multiple alignment
consensus
pattern
profile
•Sensitivity:
consensus<pattern<profile
![Page 74: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/74.jpg)
Prosite Syntax The standard IUPAC one-letter codes.
`x' : any amino acid.
`[]' : residues allowed at the position.
`{}' : residues forbidden at the position.
`()' : repetition of a pattern element are indicated in parenthesis. X(n) or X(n,m) to indicate the number or range of repetition.
`-' : separates each pattern element.
`‹' : indicated a N-terminal restriction of the pattern.
`›' : indicated a C-terminal restriction of the pattern.
`.' : the period ends the pattern.
![Page 75: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/75.jpg)
Prosite Syntax - Examples
• [AC]-x-v-x(4)-{ED}.• [Ala or Cys]-any-val-any-any-any-any-any but
Glu or Asp
• <A-x-[ST](2)-x(0,1)-v • N-terminus-Ala-any-[Ser or Thr]-[Ser or Thr]-
(any or none)-val
![Page 76: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/76.jpg)
Searching with Regular Expressions
• Ideally the pattern should only detect true positives.
• Creating a regular expression that performs well in database searches is a compromise between sensitivity and tolerance (false positives and false negatives).
• The fuzzier the pattern, the noisier its result, but the greater the chances of finding distant relatives
![Page 77: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/77.jpg)
Prosite
Searching Prosite
Input: Protein sequence
Output: list of patterns
Input: A pattern
Output: list sequences
![Page 78: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/78.jpg)
BLOCKS
• Blocks are multiply aligned un-gapped segments corresponding to the most highly conserved regions of proteins
![Page 79: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/79.jpg)
Blocks
• Blocks of 5-200 aa long alignments.
• A family is characterized by a group of blocks.
![Page 80: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/80.jpg)
BLOCKS Construction
• Creation of BLOCKS by automatically detecting the most highly conserved regions of each protein family
• Blocks incorporates all known families from the “curated” databases.
![Page 81: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/81.jpg)
Blocks
Searching Blocks
Input: Protein sequence
Output: list of blocks
Input: A Block
Output: list sequences
![Page 82: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/82.jpg)
InterPro
• Integrated resource of Protein Families
• Unifies a set of secondary databases using same terminology.
• InterPro provides text and sequence based searches.
![Page 83: Protein Structure IST 444. Protein Chemistry Basics Proteins are polymers consisting of amino acids linked by peptide bonds Each amino acid consists of:](https://reader036.vdocuments.mx/reader036/viewer/2022062321/56649ea75503460f94baa2e2/html5/thumbnails/83.jpg)
Conclusions
• Secondary databases are useful for characterizing of protein sequences.
• Numerous databases describe protein families.
• “Curated” databases do not include all known families.
• Secondary databases are useful for testing new user-defined motifs.