phylogenetic study of mdm2
DESCRIPTION
A phylogenetic study og Mdm2 using tools like ClustalW2 and unrooted trees.TRANSCRIPT
![Page 1: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/1.jpg)
Phylogenetic Study of mdm2Yosok PunY
![Page 2: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/2.jpg)
p53 and mdm2 interactions
![Page 3: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/3.jpg)
Mdm2
Negative regulator of p53 tumor suppressor gene
Discovery from transformed mouse cell line Mdm2 over expression with Ras oncogene led
to tumor formation in nude mice Human homolog is sometimes called Hdm2
![Page 4: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/4.jpg)
Mdm2
Increased levels of mdm2 found in:
Soft tissue sarcomas Osteosarcomas Breast tumors
![Page 5: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/5.jpg)
![Page 6: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/6.jpg)
![Page 7: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/7.jpg)
![Page 8: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/8.jpg)
Cn3D
![Page 9: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/9.jpg)
E3 ligase activity
Targets both itself and p53 for degradation by proteasome
Inhibitor of MDM2-p53 interactions is nutlin
MDM2 also interacts with ubiquitin protease, USP7 that reverses ubiquitylation to prevent degradation with proteasome
Fine regulatory circuit
![Page 10: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/10.jpg)
JalView
![Page 11: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/11.jpg)
![Page 12: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/12.jpg)
Mdm2 [Homo sapiens] FASTA
>gi|155183770|gb|ABT17086.1| Mdm2 [Homo sapiens]
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEK
QQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQ
ELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERS
SSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSE
![Page 13: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/13.jpg)
![Page 14: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/14.jpg)
ClustalW2
![Page 15: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/15.jpg)
![Page 16: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/16.jpg)
![Page 17: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/17.jpg)
HomoloGene
Homologs were discovered in these vertebrates:
Chimpanzee, Rhesus macaque, Dog, Cattle, House mouse, Brown rat, Red Junglefowl, Zebrafish
![Page 18: Phylogenetic Study of Mdm2](https://reader038.vdocuments.mx/reader038/viewer/2022102805/554f5354b4c905b9508b4ee1/html5/thumbnails/18.jpg)
References Harris. Curtis C. et. al. Proceedings of the National Academy of Sciences.
http://www.pnas.org/content/103/6/1659/F1.expansion.html. Accessed May 7th 2013.
Proteasome. Wikipedia. http://en.wikipedia.org/wiki/Proteasome. Accessed May 7th 2013
Mdm2. Wikipedia. http://en.wikipedia.org/wiki/Mdm2. Accessed May 7th 2013.
Knappskog et. al. MDM2 promoter SNP285 and SNP309; phylogeny and impact on cancer risk. PubMed Central. http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3260817/. Accessed May 13th 2013
Jayaraman A et. al. The interaction of p53 and MDM2 genes in cancers, in silico studies and phylogenetic analysis. Biology and Medicine Vol 3 (3): 01-12, 2011.
Databases/Tools Used: NCBI Protein. NCBI BLASTp. ClustalW2. ClustalW2 Phylogeny. Cn3D. HomoloGene.