great american fantasy baseball league rules · pdf file ·...
TRANSCRIPT
GREATAMERICANFANTASYBASEBALLLEAGUERULES:SEASONTHREE
1. ADMINISTRATION,SCHEDULE,IRREGULARITIES• ADMINISTRATION• YEARLYSCHEDULEAND40-MANROSTERS• WEEKLYSCHEDULEANDSCORING• GAMEPLAYINGERRORS• STATISTICS• ROSTERMOVES• UPDATEDROSTERS
2. RULESFORPLAYINGTHEGAME• HANDLINGTHEFASTACTIONCARDS(FAC)• PITCHER’SSTUFF• NORMALPLAY• PLUS/MINUSRATINGS• PITCHER’SSTAMINA• INFIELDPOSITIONING• RUNNERSADVANCINGONBASEHITS• TRIPLES• DEFENSEOPTIONPLAYCHART• ADVANCINGONFLYBALLS• STOLENBASECHART• HITANDRUNCHART• BUNTINGFORBASEHIT• FIELDERSOUTOFPOSITION
3. VISITINGMANAGERSINSTRUCTIONS• HEADTOHEADGAMES• PLAYERSONBOTHTEAMS• INGAMESTRATEGY• RELIEFPITCHING
4. ROSTERS• INNINGS/PLATEAPPEARANCES• ROSTERMOVES• PITCHER’SREST
5. ALL-STARGAME6. POSTSEASON
• PLAYOFFSTRUCTURE• PLAYOFFPLAYINGRULES
Updated January 5, 2016
ADMINISTRATION,SCHEDULE,IRREGULARITIESADMINISTRATION
1) TyWatermanistheGAFLCEO.Astheleaguefounderandchiefexecutive,heisultimatelyresponsiblefor:
a. Calculationofallplayercardsandtheproductionanddistributionofthem.b. Thepaymentofallexpenses,andthecollectionofannualduestounderwrite
thoseexpenses.c. Determiningtheteamsthatwillplayeachseasonandthestructureofeach
seasond. Recruiting,training,andsupervisingmanagerse. MakingnewcardsattheendofeachMLBseasonattherequestofmanagersf. Administratingtheleagueanditsday-to-dayoperationsincludingthe
schedule,deadlinesforplayingandreportinggames,collectingtheboxscores,compilingstatisticsandstandingsandotherreportsandcommunicationofinformation.
g. Determiningwhenareplaymightbeappropriateh. Adjudicatingdisputeswhenappropriate.
2) TheCEOcandelegateanyorallofhisresponsibilitiesforanylengthoftimeforanyreasontowhateverothergrouporindividualhetruststocarryoutthoseduties.
3) Arulescommitteewillclarifyandhelpadjudicatemattersrelatedtotherulesofplay.TheCEOhasinputintothecommittee'sdeliberations
4) Therulescommittee(5members)willhelpresolvemattersrelatedtoleaguepolicyorprocedures,includingappealsofgames(seeappeals,rule29).TheCEOhasinput,ifhechooses.
5) Theeligibilitycommittee(3members)willmakedecisionsonplayereligibilitymatterswithinputfromCEO.
6) TheCEOhasauthoritytocallforaleaguevoteonanymatter.AvotealsocanberecommendedbytherulescommitteeortheEligibilityCommittee
YEARLYSCHEDULEAND40-MANROSTERS
1) GameswillbeplayedfromlateNovemberthroughSeptember,withanoffweekorweeksfortheChristmasandThanksgivingholidays.Acomputerizedschedule,developedbyGaryMcIntosh,modifiedtoincludeinterleaguegames,willbeusedforGAFLSeasonThree.
2) PlayerswhohaveplayedallorpartoffiveMLBseasonswithanMLBclubwillbeeligibletoplayforthatteaminGAFL,aslongastheplayerhad140ormoreplate
Updated January 5, 2016
appearance,50inningspitchedasastarter,or30inningspitchedasareliever,ineachyearwiththeMLBclub.
a. 1961-62expansionteamsareallowed4fouryearplayers;b. 1969expansionteamsareallowed5fouryearplayers;c. 1977expansionteamsareallowed7fouryearplayers;d. TheRockies,Diamondbacks,RaysandMarlinsareallowedunlimitednumber
offouryearplayers,butmustreplacefouryearplayersiffiveyearplayersareavailable.Fiveyearplayerscannotbedroppedforfouryearplayers.
3) ForSeasonThree,therewillbeanOriginal(8teams)andExpansion(7teams)ineachleague.InterleaguePlaywillincludetwogamesvs.eachteaminthesamedivision.
4) ThedesignatedhitterwillbeusedintheALbutnotintheNL.ThedesignatedhitterwillbeusedinanyinterleaguegamesplayedinanALpark,includinganyAll-StarGamesandpost-seasongames.TheDHcanneverbeusedinanNLhomepark.AnyteamcanoptoutofusingaDHatanytime.
WEEKLYSCHEDULEANDSCORING1) Eachteam’ssetofstartingpitchersshouldbeemailedtoTybeforeaseriesbegins.2) ChangesinstartingassignmentsareallowedduringeachseriesaslongasTyis
notifiedby8p.m.EasterntimeTuesday.3) Eachteam’slineupandinstructions(ifitisasolitairegame)shouldbeemailedto
theopposingteamandcopiedtoTybyThursdayofgameweek.4) Gamesshouldbeplayedandscoresheetsfaxed,mailedorscannedtoTyby8p.m.
Tuesday,Easterntime.a. FollowTy'ssystemforscoringascloselyaspossible.b. Markgreatfieldingplayswithredstars.ThesewouldincludeallCDchart
playsandafewothersspecifiedoncharts.Giveoneredstarforeachgreatplay.ThiswillcreatetheGAFLGoldenGloveswinners.
c. Marknotableoccurrencesofanysortin"Comments"section.d. IncludenamesofthethreeMVPse. HometeammustsendscoresheetstoTyandvisitingteammanagerASAP
withincompletionofthegame.f. Thecurrentmajorleaguesaverulewillbeused.
5) Hometeamshouldwriteasummaryofthegamehighlightsandpostongroupe-mailwithin24hoursofcompletionofthegamebutnolaterthan8p.m.EasterntimeTuesday.
6) Ifateamcannotplayitsscheduledhomegameduetovacation,illness,orotherpersonalreasons,thevisitingteammanagerwillplaythegame,andinthatcasehavealltherightsofahomemanager.Ifneitherthehomeorvisitingmanagercanplaythegame,Tyhastheauthoritytoplayit,asalastresort,ifbothmanagersprovidelineupsandinstructions.
Updated January 5, 2016
GAMEPLAYINGERRORS1) Twotypesoferrorsaremostcommon(Bothkindsoferrorsarecommonandin
mostcasescanbecorrected.)a. Themanagerforgetstofollowarulecorrectly.b. Themanagerdoesnotcorrectlyfollowthevisitingteammanager’s
instructions.2) Ifamanagerplayingsolocatchesamistakeafterthefactbutbeforehehasturnedin
thegameresults,heshouldgobackandcorrectitandreplaythegamefromthatpoint,nomatterwhichteambenefitedfromthemistake.
3) Ifeithermanagerinahead-to-headgamecatchesamistake,thegameshouldbereplayedwiththeerrorcorrectedfromthepointatwhichtheerroroccurred.
4) Ifanerrorisdetectedafterthegameresulthasbeenannounced,andtheresultnegativelyimpactsthevisitingteam,thegamewillbereplayedfromthepointoftheerror,withtheresultcorrected.Butifthevisitingteamwinsbecauseofamistakebythehomemanager,thereisnoreplay.
5) Ifthereisadisputeabouthowthegamehasbeenplayed,itshouldbebroughtfirsttoTy’sattention.Inothercases,Tymayseeaproblemwhenexaminingtheboxscore.Ineithercase,Tywillattempttoadjudicate,withthegoalofmediatingadecisionwithoutaformalprotest.Hecanconsulttherulescommitteemembers.
6) IfBaltimoreisinvolvedinaprotest,rulescommitteechairmanSteveKreviskywillbrokertheissue,sendingitonforarulescommitteevoteonlyifthegameisofficiallyprotested.
7) Ifagamedisputecannotberesolvedby8p.m.EasterntimeonTuesday,Tycanextendthedeadlineto10p.m.Wednesday.Ifnotresolvedbythen,thegamemighthavetobesuspendedandcompletedatalaterdate.
8) Ifeitherteam’smanagerfeelsthedecisionisunfair,hecanfileanofficialappeal.Therulescommitteewillmakearuling.Anymemberoftheboardinvolvedinthegamemustexcusehimselffromthedecision.
9) Groundsforareplayincludetheuseofanineligibleplayer(aninjuredplayer,aplayernotonthecurrent25-manroster,oraplayerwhohasuseduphisavailableinnings,plateappearances,orisplayingapositionforwhichhehasuseduphisavailablegames).Butforfeitsshouldbeavoidedifatallpossible.Inmostcases,thehomemanagerwillreplaygamesfromthepointthatanineligibleplayerenteredthegame.
STATISTICSTywillreportteamandleaguestatisticsatregularintervals.
Updated January 5, 2016
ROSTERMOVESAllrostermoves(sendingaplayerdownfromthe25-manroster,callups,DL)shouldbereportedimmediatelytoTy.RosterMoves/InjuryListswillbeannouncedweeklybyBarryMednick(A.L.)andJohnFerguson(N.L.)UPDATEDROSTERSEachOctober,managerswillhavetheopportunitytochangetheir40-manrosterstoaccommodatethereleaseofnewcardsorforotherreasons.
Updated January 5, 2016
RULESFORPLAYINGTHEGAMEHANDLINGTHEFASTACTIONCARDS(FAC)
1) Beforegameplay,spreadeachdeckseparatelyonthefloorortable,flippingthemrandomly.Pickthemuprandomlyandmakeapilefromtopandbottom,turningcardsoversothattheyarenotallfacingthesamewayastheylandedonthefloor.Donotshuffle.
2) Whenyouhavemadethefirstdeck,placeacardboardcoverovertopcard,withthe"1"intheupperleftcorner.Lightlyputa"1"inpencilontheupperleftcornerofthetopcard,withoutrevealingthecardresults.Thenmakeaseconddeck,coverandmarka2inpencilintheupperlefthandcornerofthetopcard.
3) TWODECKSWILLBEUSEDFORGAMES.4) WhendeckNo.1isdepleted,pickupthediscardpile,flipitoverandtwist
ithalfway.Marka3inpencilintheupperlefthandcorner.Donotusesidethreeuntiltheseconddeckiscompleted.
5) Thenusetheseconddeck,markingatwointheupperlefthandcorner.6) Onthethirdandfourthtimesthroughthetwodecks,againflipover,markanumber
andtwistthediscardpile.PITCHER’SSTUFF
1) Beforebeginningplay:a. DrawacardandlookattheRandomNumber(RN)todeterminethevisiting
pitcher’sstuff.b. DrawanewRNtodeterminethehomepitcher’sstuff.c. DrawanewRNtodeterminestuffeachtimeapitchercomesintothegame.d. AstartingpitcherhasamaximumofPB:2-10andaminimumofPB:2-5to
startthegame.AreliefpitcheralsohasamaximumofPB:2-10andaminimumofPB:2-5whendeterminingstuff.
2) StuffDrawRangesa. RN11-14:Greatstuffforastartingpitcher.Add2tohisPBrating.Fora
reliefpitcher,addonetohisPBrating.Arelievercannothavegreatstuff...andcannotaddmorethanonetohisPBrating.Nopitchercanimprovehisstaminatobetterthan2-10.
b. RN15-18:Goodstuffforallpitchers.Add1tohisPBrating.c. RN21-78:Normalstuffforallpitchers.NochangetohisPBrating.d. RN81-84:Badstuffforallpitchers.Subtract1fromhisPBrating,butno
pitchercanfallbelowaPB-5fromdrawingbadstuff.e. RN85-88:Terriblestuffforallpitchers.Subtract2fromhisPBrating,butno
pitchercanfallbelowaPB-5tostarthisappearance.
Updated January 5, 2016
3) IfastartingpitcherhasBadorTerribleStuff,hecannotberemoveduntilhecompletesfiveinnings,unlesshisstaminafallsbelowzero.
4) IfareliefpitcherhasBadorTerribleStuff,hecannotberemoveduntilhecompletestheinningheenteredthegame,unlesshisstaminafallsbelowzero.
a. EXCEPTION:Whenareliefpitcherisbroughtintothegame,themanagermayannouncethatheisbeingbroughtintothegametofaceonlyonebatter.Anyhomemanagercanmakesuchanannouncement,ascaneithermanagerinahead-to-headgame.Avisitingmanagementcanspecifyapitcherbesousedinhiswritteninstructions.
5) Pitcherscannotenterthegamewithouttheproperamountofrest.Iftheysurpasstheirrestlimitswhileinagame,theycanstayinthegamebuttheirPBdropsby2immediatelywiththenextbatteraftertheyreachtherestlimitsduringthegame.
NORMALPLAY
1) TurntheFACandcheckPBtodetermineifplaygoesontopitcher'sorbatter'scard.2) IfthePBisanumber(2-12),determinewhetherthebatterorpitchercontrols.The
pitchercontrolsanyPBthatfallswithinhiscurrentrange.Thebattercontrolsanythingoutsidethatrange.
3) PickanewFACandreadtheRandomNumber(RN).4) IftheRandomNumberiswithintheOutrangeonpitcher'sorbatter'scard,then
lookattheOutSequenceatthebottomoftheNEXTFACforthecorrecttypeofbatter(LN,LP,RN,RP,SN,SP).Refertotheappropriateoutchartforresultsoftheplay.
5) IfaWP(wildpitch)orPB(passedball)occursonapitcher’scardandnorunnersareonbase,startoverwithanewFACasin2.3.1.Ifanyoneisonbase,drawanewFACandcheckresultsunder“Pitch.”If“yes,”allrunnersadvanceonebaseontheWPorPB.If“no,”resumenormalplaywithanewFAC.
a. IfthepitcherhastwoPBorWPnumbersandthesecond(higher)ofthosenumbersisdrawn,anycatcherwithaCD-4makesagreatstopandplayresumeswithanewFAC..Forallothercatchers,checkfortheWPorPBasabove.
6) Iftheresultisafractionalnumber,useaRANDOMNUMBERGENERATOR(1to100)todeterminetheresultoftheplay.Iftheresultingnumberisabovethedecimalrange,theplayisanout;checkthenextFACfortheOutSequenceandcontinueasusual.
7) CheckingForErrorsa. Donotcheckforerrorsonhitsoffpitcher’scards,orforhitsonBD,CD,or
othercharts.b. Therearenoerrorsoninfieldhits
Updated January 5, 2016
c. Ifthereisasingleoradoubleoffabatter’scard,getanewFACandcheckforanErrorbythefieldertheballwashitto.Ifthereisatriple,thehometeamwilldesignatethefieldertheballishittobeforethereisanerrorcheck.Anerrorismadeifthefielder’serrorratingfallswithinthenumberslisted.Ifitisanerror,lookatthenextFACandcheckforTYPEoferror.ThencheckErrorSequenceatthebottomoftheappropriateOutChartforthefinalresult.
d. IfthereisanasterisknexttotheplayontheOutSequence,drawanewFAC.IfErrorsays“none,”consulttheoutchartfortheresultoftheplay.Ifthereisanumberrange,anerrorismadeifthefielder’srangefallswithinthenumberslisted.
e. Ifthereisanerroronagroundball,getanotherFACandcheckforTYPEoferror.ThencheckErrorSequenceatthebottomoftheappropriateOutChartfortheresult.
f. Ifthereisanerroronaflyballtotheoutfield,donotpickanewFACtocheckforerrortype.Onadroppeddeepflyball(FD*toanyfield),consultERRORRULEchart:DROPPEDFLYBALLorLINEDRIVE.
g. Forerrorsoninfieldflies,linedrives,andfoulpop-upstocatcher,consultERRORRULECHART:DROPPEDFLYBALLSorLINEDRIVE.
8) IfthePBisaBDandnomenareonbase,itisafoulball.DrawanewcardandgetanewPB.IfaBDispickedwithmenonbase,getanewFAC,andcheckthenewRNnumberonthebattersBDratingsonhiscard.Ifnoactionoccurs,itisanotherfoulball.DrawanewPBandproceedfromthere.
9) IfthePBisaCDandnomenareonbase,ignoreanddrawanewPB.IfaCDisdrawnwithmenonbase,getanewFAC,andcheckthecardforwhatfielderisinvolvedintheCDplay.ThendrawanewFACandchecktheRNinClutchFieldingchart,usingthefielder’sCDrating.Ifitisafoulball,drawanewFACandproceedfromthere.
10) IfthePBisaZ,getanewFACanduseitsRNtofindtheresultontheZ-wildplaychart.FollowtheZ-chartinstructions.PickanewFACandnewRNifsenttotheZ-FieldingorZ-Injurycharts.
a. Ifplayinginadomedstadium,ignoreanyrainoutandresumeplay.Otherwisestoptheplayandreporttherained-outgame.ThedomedstadiumsincludeSeattle,Houston,TampaBay,Arizona,Milwaukee,butTorontoisplayinginExhibitionStadium.Anyteaminadomedstadiumcanannouncetheyareplayinginapriorstadiumthatisnotdomed,iftheysodesire,butmustannouncesuchbeforethegamestarts.
b. Ifaninjuryoccurs,pickanewFACandgettheRN.ConsulttheZInjuryChart.PickanewFACandnewRNtodeterminethelengthoftheinjury,usingtheinjuryratingsoftheplayer(s)involved.
Updated January 5, 2016
11) Ifapitcherwhodoesnothaveabattingcardcomestobat,drawanFACandusethepitchersgenericbattingcard.Makecertainyouknowifthebatterisalefty,rightyorswitchhitter.
SPECIALADJUSTMENTSTORESULTS:PLUS&MINUSRATINGS
1) Ifthereisaminusstrikeoutonabatter’scard,subtractfromthehighendofthepitcher’sstrikeoutrange.IftheRNfallsoutsidetheadjustedstrikeoutrangetheresultisabattedout.Thepitcheralwayscontrolsthefirstwholenumberonhisstrikeoutrange,andthatcannotbetakenawaybyabatter’sminus-Krating.However,abatter’sKratingorBBratingcanbetakenawaybytheplushomerunratingofthepitcher.
2) Ifthereisaminuswalkonabatter’scard(rareformostbatters,verycommonforpitcherswhoarebatting),subtractfromthehighendofthepitcher’swalkrange.IftheRNfallsoutsidetheadjustedwalkrangeitisnotawalk.Thepitcheralwayscontrolsthefirstwholenumberonhiswalkrange,andthatcannotbetakenawaybyabatter’sminus-walkrating.
3) IfthepitcherhasaminusPHRrating,reducethehitter’sHRchancesbysubtractingthePHRfromthehighendofthebattersHomeRunrange.However,abatter’shomerunratingcannotbereducedbymorethanhalf.AhomerunthatistakenawaybecomesaDOUBLE,allrunnersscore,noerrorcheck.IfthedrawwouldhavebeenanoutbeforetheminusPHRratingreduction,itisstillanout,notaDOUBLE.
4) IfthepitcherhasaplusHRrating,increasethehighendofthebatter’shomerunchancesbythatamount.However,abatter’shomerunratingcannotbemorethandoubled.
5) Someveryweakhittingpitchershaveminussingles.IfapitcherwhoisbattinghasaMinus-1Bonhishittingcard,hecannotgetthathitonhisowncardandtheamountisdeductedfromthehighendoftheopposingpitcher’ssinglesnumbers.Thiswillresultinthepitchergivingupfewersinglesandturningthemintoouts.Asingletakenawaybyaminussingleturnsitintoanout;consulttheOutSequenceonthenextcard.
Updated January 5, 2016
PITCHER’SSTAMINA1) Useaseparatesheettokeeptrackofpitcher'sstamina.2) Subtractonepointfromthepitcher'sstaminaratingforeach:
a. Singleb. Earnedrun
i. DoNOTsubtractforanyunearnedruns.Ifit'snotclearwhetherarunwillendupbeingunearnedornotbecauseofanerrorearlyinaninning,assumeitisunearnedforpurposesofcalculatingstaminauntiltheinningisover.
ii. InheritedrunnersdoNOTtakeoffapoint.c. Walk
i. IntentionalwalksdoNOTtakeoffapoint.d. Stolenbase
i. Multiplestolenbasesonthesameplayonlytakeawayonepointofstamina,whileastolenbaseandanerroronthesameplaytakeawaytwopointsofstamina.
e. Errorf. Wildpitchg. Hitbatsmanh. Passedball.
3) Subtracttwopointsforadouble.4) Subtractthreepointsforatriple.5) Subtractfivepointsforahomerun(4pointsforthehomerun;onepointforan
earnedrun).Exception:Iftherunisunearned,thehomerunis4points(nopointfortherun).
6) Unlessthevisitingmanagerinasolitaregameinstructsotherwise,visitingpitchersmustleavethegamewhenstaminafallsbelowzero.
7) Whenthepitcher’sstaminafallsbelowzero,eachpointbelowzeroisdeductedfromthepitcher’sPBrating.So,ifa2-8pitcher’sstaminadropstoMinus2,thepitcherwouldbepitchingasa2-6.
8) Staminacannotcausethepitcher’sratingtofallbelow2-2;inotherwords,eventhemosttiredpitcherstillcontrolsanyPBdrawsof2.
INFIELDPOSITIONINGIfthevisitingmanagerfailstospecifyotherwise,thevisitingteamplaysitsinfieldbackinallsituationsexceptthoseinwhichthescoreistiedandthego-aheadrunisonthirdintheseventhinningorlater.Playingtheinfieldinmeansallfourinfielderareplayingin.However,amanagermayplayhiscornerinfieldersinwhileleavingtheshortstopandsecondbasemanback.
Updated January 5, 2016
RUNNERSADVANCINGONBASEHITS
1) DeterminethetypeofhitbycheckingtherandomnumberofthesameFACthatproducedthehit.Ifthenumberisdivisibleby12,it'saTexasLeaguer(Type#1).Ifdivisibleby4butnotby12,it'saBloop(Type#2).Ifit'sanoddnumber,it'sNormal(#3).Otherwiseit'saSmash(#4).
2) Runnersmaynevertakeanextrabaseoninfieldsingles.3) UseRunnersAdvancingonBaseHitschart.Crossreferencetherunnersspeed
(OBR)withtheoutfielder'sarmandcheckthetypeofhit.Ifattemptingtoadvance,drawanewFACandgetarandomnumbertoseeifrunnerisoutorsafe.Anynumberhigherthanthebaserunner’sadjustedsaferangeisout.
4) Withtwoouts,therunners’chancesareadjustedbyaddingtheamountsinTableVIaccordingtotypeofhit.
5) PitcherswithouttheirownoffensivecardsareOBRE.6) Unlessthevisitingmanagerspecifiesotherwise,runnerswillattemptstoadvance
anysafechanceof60orhigher.7) OBRA,B,orCrunnersonfirstautomaticallyadvancetothirdbaseonanythrow
home.However,amanagerofthedefensiveteamcanelecttolettherunscoreandtrytothrowtherunneroutatthird,usingtheruleabove,tocalculatethechances.Ifarunneristhrownoutatthird,therunstillscores.(Inagamethatisnotplayedhead-to-head,onlythehomemanagerhasthisoption.)
TRIPLESHomemanagerpickstheOFpositionthetripleishitto.Inhead-to-headgames,thedefensivemanagerpickstheoutfielder.DEFENSIVEOPTIONPLAYCHART
1) ThischartisusedwitharunneronthirdandtheinfieldinwhencalledforonanOutChart.Themanageroftheteamatbatdecideswhethertosendtherunnerhome.
2) Unlessthevisitingmanagerspecifiesotherwise,allOBRArunners,butnootherrunners,willattempttoadvanceontheDefenseOptionPlayChart.
ADVANCINGONFLYBALLS
1) ReferecetheproperTaggingUpOnFlyOutsChartandfigureaccordingtoinstructionsonchart.
Updated January 5, 2016
STOLENBASECHART
1) Ifthemanagerattemptstosteal,pickanFACandusetheRNandtheStolenBaseJumpCharttodeterminewhethertherunnergetshisjump.Iftherunnercan’tattemptasteal,hemustwaitonebatterbeforetryingagain.Leftiesreducetherunnersjumpratingonelevel.
2) DrawasecondRNtodeterminewhetherthestealissuccessful,consultingtheStolenBaseChart,usingtherunner’sstealsuccessrating.
3) PitcherswithoutabattingcardareE/Ebasestealers.4) Foradoublesteal:
a. First,determinewhethertheleadrunnercangethislead.i. Ifhecannot,noonecansteal.
b. Iftheleadrunnercangethislead,nextdrawanewRNtoseeifthetrailrunnercangethislead.
i. Ifthetrailrunnerdoesnotgetalead,heisheldandonlytheleadrunnermayattempttosteal.
c. Ifbothrunnersgettheirleads,theopposingmanagercandeterminewhichbasetothrowto.
d. PickanewFACandRNanddeterminetheresult.Iftherearenoinstructionsbytheopposingmanager,theplayisontheleadrunner.
e. Ifaplayismadeontheleadrunner,thetrailrunnerautomaticallyadvances;iftheleadrunnerwasout,thetrailrunnerdoesnotgetcreditforastolenbase(andnostaminapointsaredeductedfromthepitcher).Iftheplayismadeonthetrailrunner,theleadrunnerautomaticallyadvancesandgetscreditforastolenbase.
HITANDRUNCHART
1) ThehitandruncanonlybeusedwitharunneronfirstorrunnersonFIRSTANDSECOND.
2) Whenahitandrunisdeclared,drawaPBtoseewhocontrolstheplay.a. Usethepitcher'sPBratingatthetimeofthehitandrun,MINUSTWO.(A
PB:9pitcherbecomesaPB:7;aPB:8pitcherbecomesaPB:6,etc,vs.thehitandrun.)
3) IfthePBisaZ,CD,orBD,theplayishandlednormally.4) IfthePBfallsintothepitcher'sPBrange,MINUSTWO,aRNisdrawnandtheresult
readoffthepitcher'scard,withthesemodifications:a. SINGLES:Allrunnersadvancetwobases;onebaseoninfieldsingles.Don’t
usebaserunningchart.Noerrorcheck.
Updated January 5, 2016
b. STRIKEOUTS:Batterstrikesout.Baserunner(s)getanautomaticjumpandmustattempttosteal.Userunnersstealratingtodetermineastealattempt.Withrunnersonfirstandsecondthereisthepotentialforadoublesteal.
i. IFTHEBATTERTAKESAWAYTHESTRIKEOUT.Theresultisanout,asinnormalplay,anddrawanewFACandlookatOutSequence.
c. WALKS:Handlednormally.d. GROUNDOUTS:Remaingroundouts,butrunner(s)advanceonebase.Check
asterisksforerrors.Nodoubleplays.e. FLYOUTS:Batterout,runnercannotadvance.Checkasteriskforerrors.(Use
RunnerAdvanceonFlyBallOptionChartifyouwanttotrytoadvance.)f. LINEDRIVES:DoublePlaywiththeleadrunnercaughtoffbaseonlinersto
allinfieldpositions,includingthepitcher.Checkasteriskforerror.g. HBP:Handlenormally.Batterhitbypitch.h. WPandPB:Handlenormally.Ifitisa“pitch:No,”startoverwithanewFAC
(thehit-and-runcanbetriedagain,ornot.)Ifitisa“pitch:YES,runnersarecreditedwithastolenbase.
5) IfthePBisABOVEthepitcher'smodified(MinusTwo)range,THEBATTERCONTROLSTHEACTION.AnewRNisdrawn.TheBATTER’SHITANDRUNCHARTisusedinthiscase.
BUNTINGFORBASEHIT
1) AbatterwithanOBR-AorBratingcanbuntforabasehitonceagame.Nobuntingforabasehitisallowedwitharunneronthird.Asqueezeplaymustbeusedwitharunneronthird.
2) Thereisnorestrictiononsacrificeorsqueezeplays.FIELDERSFORCEDTOPLAYOUTOFPOSITION
1) Noplayercanplayapositionthatheisnotratedforexceptincaseofejectionorinjury.Aplayerplayingapositionheisnotratedfor,orapositionforwhichhehasexhaustedhiseligibilityisaCD-1withanerrorratingof10andtheworstpossiblethrowingarm.
2) Ifapitcherisusedinanotherdefensivepositionduetoaninjuryorejectiontothelastremainingpositionplayer,heisalsoaCD-1,E-10,T-2.
PLAYERUSAGE
1) Noreliefpitchermaypinchhit.Hemustalreadybeinthegametobatinthepitcher'sspotinthelineuptogarneraplateappearance.Reliefpitchersarelistedoneachteam'srosterandhavebeendesignatedassuchbyTy.
Updated January 5, 2016
2) Startingpitchersmaypinchhit.NationalLeaguemanagershavebattingcardsavailableforallstartingpitchers.AmericanLeaguemanagerswhofeelthattheywouldlikeahittingcardforaplayer,askPaulandTytocreatethatplayercardforuse.Playercardsmustbecreatedbeforethegameinorderforthatplayertobeeligibleforuse.
3) Bothstartingandreliefpitchersmaypinchrun.
Updated January 5, 2016
VISITINGMANAGERSINSTRUCTIONSHEADTOHEADGAMESHometeammanagersareencouragedhead-to-headgamesbyphone,instantmessaging,e-mail,orinpersonwhenevermutuallyagreeable.Thereisnolimittothenumberofgamesteammayplayhead-to-head.PLAYERSONBOTHTEAMSWhentwoteamsmeetwhohavethesameplayerontheirroster,thevisitingteamcannotusethatplayer.Thevisitorscanbringupaplayerforoneseriestoreplacehim.Attheendoftheseries,thetwo-teamplayerorthereplacementmustbereturnedtotheminorleagueroster,withoutusingthe10-daydemotionrule.RELIEFPITCHINGThevisitingmanagershouldsubmitalistofatleastthreerelieverstobeusedandinwhatorderinasolitairegame.
1) Thehomemanager,orthevisitingmanagerinahead-to-headgame,canchoosetoletapitcherfinishthegamewitharatingof2-2evenifotherpitchersareavailabletorelieve.
2) Undernocircumstancescanareliefpitcherstartagameunlessheisratedasastarter.
3) UndernocircumstancescanastartingpitcherwhohasaRR:0beusedinrelief.
Updated January 5, 2016
ROSTERSELIGIBILITYRULES.
1) PlateappearancesincludeABs,walks,HBPsandsacrifices(fliesandbunts).2) Anytimeaplayerplaysasecondarypositioninagame,evenforaninning,itcounts
againsthisallowablegamesatthatposition.3) Whenplayerscompletetheirallowableinningsorplateappearancestheirregular
seasonisover.Theycannotbeusedinatie-breakergameforaplayoffspot,buttheycanbeusedintheplayoffs.
4) Ifapitcherexceedshisavailableinningsfortheseasonasaresultofadoubleortripleplay,thereisnopenalty.
5) Ifahometeammanageroravisitingmanagerinahead-to-headgameusesaplayerwhoisineligible,hemustreplaythegamefromthepointtheineligibleplayerenteredthegameifhewonthegame.Ineligibleplayersincludeinjuredplayers,thosenotonthemajorleagueroster,thoseonthedisabledlist,andthosewhohaveexhaustedtheiravailability.
6) Ifahometeammanagerusesanineligibleplayeronthevisitingteam,thereisnopenalty.
7) Inaforfeit,allstatisticsforthegameshallbeconsideredofficialuptothepointofdiscoveryoftheforfeit,exceptthefinalscoreshallbe9-0andthestartingpitcherswillbegiventhewinandloss,withnosavespossible.Replaysarepreferredoverforfeits.
ROSTERMOVES
1) Playerssenttotheminorsmustremaintheretendays(accordingtotheleagueschedule,includinganyoff-days),unlessnootherplayerisavailabletoplayapositiononthe25-manroster(becauseofinjuriesorexpirationofavailability)ortheplayerisineligiblebyappearingforbothteams.
2) Therearenorestrictionsonthenumberofrostermovesduringaseason.3) Playerswhoareinjuredcannotbesenttotheminors.Hecanbeleftontheactive
rosterorplacedonthedisabledlist.4) PlayerswhoareputontheDisabledListmustremainonthatlistforatleast15days
intheschedule,andcannotbebroughtbacktotheactivelistbeforethenumberofgamesinjured.
5) Rostersexpandto40playersonSept.1oftheschedule,andafterthatnorostermovesarenecessary.
6) Playersonthedisabledlistarenoteligibletobebroughtuptoreplaceaplayerontheactiverosterforbothteamsinagame/seriesunlesstheyhaveexceededthenumberofgamesinjured,andthusareeligibletoreturntotheactivelist.
Updated January 5, 2016
PITCHER’SREST
1) Usepitchers'restcharttodetermineifastarterorrelieverissufficientlyrested.2) Astartermusthavethenecessaryrest(asonPitcher'sRestchart)beforeentering
anygameasareliever.3) Afterrelieving,apitcherhaveoneextradayofrestbeforebeingallowedtostart
again.4) Areliefpitcherpitchingonconsecutivedayswillhavealimitontheinningshecan
pitchbeforetiring.Ifheremainsinthegameafterthatlimit,heisimmediatelyreducedtwopointsregardlessofstamina.
5) Apitchercannotbeusedwithoutproperrest.Thepitcherrestrulesareprintedweekly.
a. Ifthereisnorestedpitcheravailableatthetimewhenapitcherisinjuredorejected,theunrestedreplacementpitcherwillhavehisPBreducedbytwoafterthedrawthatdetermineshisstuff,andisnotlimitedbythe2-5lowerlimit.
Updated January 5, 2016
ALL-STARGAME
1) ThemanageroftheteamwiththebestrecordintheleagueattheAll-StarbreakwillmanagetheleagueAll-StarTeam.
2) Allmanagerswillvoteforplayersinthestartinglineups.3) Thegamemanagerswillpickallpitchersandreserves.4) Pitcherswillfollownormalrestrulesduring,andaftertheAll-StarGame.Any
inningspitchedintheAll-StarGamewillcountforpurposesofrestrules.5) ManagerscannotlettheirplayersrefusetoparticipateintheAll-StarGame.6) All-Starpitcherscannotpitchformorethantwoinnings.7) InjuriesoccurringintheAll-Stargamewillcarryoverintotheregularseason.8) Allstarinnings,plateappearancesandpositionplayedintheAll-Stargamedonot
countagainsttheirseasonallowablelimits.9) ThereisanoffdayforallteamsthedaybeforetheAll-Stargameandonlymake-up
gamesarescheduledthedayafterthegame...perMLBrules.10) TheSeasonThreeAll-StargamewillbeplayedinaNationalLeaguepark.
Updated January 5, 2016
POST-SEASONPLAYOFFSTRUCTURE
1) Fiveteamsmaketheplayoffsineachleague.TheOriginalandExpansiondivisionchampsareratedthenumberoneandtwoseeds.Thenextthreeteamsmaketheplayoffsbasedonwinningpct.
a. Ifthereisatieforthe5thspotintheplayoffs...aonegameplayoffwilloccurthedayaftertheregularseasonends.Thestatscountintheleague...asdoaonegameplayoffforthechampionshipofadivision.
b. Ifthereisatieforeitherthe3rdor4thspotsintheplayoffs,itwillbedecidedbytheheadtoheadrecords.
2) The4thand5thteamsplayaWildcardPlaydown(best2of3).3) FirstRound:1vs.4or5(bestoffive)4) FirstRound:2vs.3(bestoffive)5) ALCSandNLCS:bestofseven.6) GAFLWorldSeries(bestofseven).7) Therewillbeonedayofrestintheplayoffworldseriesschedulebetweentheendof
theDivisionSeriesandthebeginningoftheChampionshipSeries,andonedayoffbetweentheendoftheChampionshipSeriesandthestartoftheWorldSeries....perMLBprocedure.
PLAYOFFPLAYINGRULES
1) Teamscansettheir25-manrosteranewatthebeginningofeachplayoffseries.2) Pitcherrestrulesremainthesameasintheregularseason,includingruleson
starter-relievers.3) Pitcherswhoarestartersonlycannotrelieve,andrelievers-onlycannotstart.
Starterrelieversarelimitedtostartingorrelievinginthepost-seasonforatotalofthesamenumberofgamestheyareallowedduringtheregularseason.
4) Rulesontwo-teamplayersarethesameasintheregularseason.Thevisitingteamforcedtositaplayercanreplacehimforawaygames.
5) Playerswhoareratedfor15ormoregamesatapositionduringtheseasoncanplaytherewithoutlimitsinthepost-season.Otherwise,playerscannotplaymoregamesatapositionduringtheentirepost-seasonthantheywereeligibletoplayduringtheseason.
IFANYTHINGISMISSEDINTHESERULES,TYWILLMAKEADECISIONWITHTHE
ADVICEOFTHERULESCOMMITTEEANDCOMMISSIONERS.
Updated January 5, 2016
BASE RUNNING TABLES Determine the hit type by checking the random number of the hit. Locate the correct running table and cross-‐reference the runner’s OBR with the fielders arm. Look under the hit type to determine “safe” number. Draw another card and check random number. It must be equal to or less than “safe” number for runner to be safe. Note: In a solitaire game, with no previous instructions, the base runner will try to advance on a safe chance of 60 or higher. All runners are out on a draw of 88, regardless of modifiers. HIT TYPES: 1 – Texas Leaguer: Random numbers divisible by 12. 2 – Bloop: Random numbers divisible by 4, but not 12. 3 – Normal: All odd numbers 4 – Smash Hits: All even numbers not divisible by 4 TWO OUT MODIFICATIONS: 1 – Texas Leaguer: Add 60 to all RN draws
2 – Bloop: Add 40 to all RN draws 3 – Normal: Add 20 to all RN draws 4 – Smash Hits: Add 10 to all RN draws
Updated January 5, 2016
TABLE I – First to Third on Single to Left T-‐2 T-‐3 T-‐4 T-‐5
Hit Type Hit Type Hit Type Hit Type OBR 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 A 32 / 64 / 52 26 / 58 / 46 22 / 54 / 42 21 / 48 / 36 B 26 / 58 / 46 22 / 54 / 42 21 / 48 / 36 21 / 44 / 32 C 22 / 54 / 42 21 / 48 / 36 21 / 44 / 32 21 / 38 / 26 D 21 / 48 / 36 21 / 44 / 32 21 / 38 / 26 21 / 34 / 22 E 21 / 44 / 32 21 / 38 / 32 21 / 34 / 22 21 / 28 / 21
TABLE II– First to Third on Single to Center T-‐2 T-‐3 T-‐4 T-‐5
Hit Type Hit Type Hit Type Hit Type OBR 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 A 52 / 72 / 42 46 / 66 / 36 42 / 62 / 32 36 / 56 / 26 B 46 / 66 / 36 42 / 62 / 32 36 / 56 / 26 32 / 52 / 22 C 42 / 62 / 32 36 / 56 / 26 32 / 52 / 22 26 / 46 / 21 D 36 / 56 / 26 32 / 52 / 22 26 / 46 / 21 22 / 42 / 21 E 32 / 52 / 22 26 / 46 / 21 22 / 42 / 21 21 / 36 / 21
TABLE III – First to Third on Single to Right T-‐2 T-‐3 T-‐4 T-‐5
Hit Type Hit Type Hit Type Hit Type OBR 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 A 62 / 82 / 52 56 / 76 / 46 52 / 72 / 42 46 / 66 / 36 B 56 / 76 / 46 52 / 72 / 42 46 / 66 / 36 42 / 62 / 32 C 52 / 72 / 42 46 / 66 / 36 42 / 62 / 32 36 / 56 / 26 D 46 / 66 / 36 42 / 62 / 32 36 / 56 / 26 32 / 52 / 22 E 42 / 62 / 32 36 / 56 / 26 32 / 52 / 22 26 / 46 / 21
TABLE IV – Second to Home on Single to Outfield (note: runner on 1st goes to 3rd if OBR-‐A, B, or C. Otherwise stops at 2nd.)
T-‐2 T-‐3 T-‐4 T-‐5 Hit Type Hit Type Hit Type Hit Type
OBR 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 A 56 / 76 / 46 52 / 72 / 42 46 / 66 / 36 42 / 62 / 32 B 52 / 72 / 42 46 / 66 / 36 42 / 62 / 32 36 / 56 / 26 C 46 / 66 / 36 42 / 62 / 32 36 / 56 / 26 32 / 52 / 22 D 42 / 62 / 32 36 / 56 / 26 32 / 52 / 22 26 / 46 / 21 E 36 / 56 / 26 32 / 52 / 22 26 / 46 / 21 22 / 42 / 21
TABLE V – First to Home on Double to Outfield T-‐2 T-‐3 T-‐4 T-‐5
Hit Type Hit Type Hit Type Hit Type OBR 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 1&2 / 3 / 4 A 32 / 64 / 52 26 / 58 / 46 22 / 54 / 42 21 / 48 / 36 B 26 / 58 / 46 22 / 54 / 42 21 / 48 / 36 21 / 44 / 32 C 22 / 54 / 42 21 / 48 / 36 21 / 44 / 32 21 / 38 / 28 D 21 / 48 / 36 21 / 44 / 32 21 / 38 / 26 21 / 34 / 24 E 21 / 44 / 32 21 / 38 / 32 21 / 34 / 22 21 / 28 / 21
Updated January 5, 2016
HIT&RUN(PITCHERCONTROL)
ThehitandruncanonlybeusedwitharunneronfirstorrunnersonfirstANDsecond.Whenahitandrunisdeclared,drawaPBtoseewhocontrolstheplay.Usethepitcher’sPBratingforthatgame,MINUSTWO.
A) IfthePBisaZ,CD,orBD,theplayishandlednormally.B) IfthePBfallsintotherevisedpitchersrange,anewcardisdrawnandthe
resultisreadoffthepitcherscard,withthefollowingmodifications:a. SINGLES:Allrunnersadvancetwobases(oneoninfieldhits).Do
notusebaserunningchart.Donotcheckforerrors.b. STRIKEOUTS:Batterstrikesoutandbaserunner(s)mustattempt
stolenbase.Thejumpisautomatic,butthestealattemptmustbemadebyallbaserunnerswiththeirnormalstealrating.Thecatchermaytrytothrowouteitherrunner.NOTE:AbalkresulttakesprecedenceintheeventtheBalkresultisYES.
i. Ifthebattertakesawaythestrikeoutchance,theresultisanout.GototheOutSequenceontheFACtodeterminethetypeofout.
c. WALKS:Batterwalks.Allrunnersadvanceonebase.d. GROUNDOUTS:Batterisout,butallrunnersadvanceonebase.
Checkasteriskforerror.Nodoubleplays.e. FLYOUTS:Batterisout,butallrunnershavetoretreatbackto
originalbase.Checkasteriskforerror.(UseRunnerAdvanceonFlyBallOptionChartifyouwanttotrytoadvance.)
f. LINEDRIVES:Doubleplaywithleadrunnercaughtoffbaseonlinedrivestoallinfielders.Checkasteriskforerror.
g. HBP:Batterishitbypitch.Allrunnersadvanceonebase.h. WPandPB:Handleasnormal.Runnersarecreditedwithastolen
base,regardlessofstealrating,ifaWPorPBoccurs.(DonotcallitaWPorPB.Itisastolenbase.)
IfthePBisAOBVEthepitcher’smodified(MinusTwo)range,thebattercontrolstheaction.AnewRNisdrawn.TheHitandRun(BatterControl)chartisused.Note:Afterthehitandrunisresolved,thepitcherrevertsbacktopreviousPBrating
Updated January 5, 2016
HITANDRUN(BATTERCONTROL)
CanonlybeusedwhenamanisonfirstorfirstANDsecond.Whenthebattercontrolsaction,drawanewrandomnumber.Readresultdirectlyfromchart.Usebatter’sH&Rrating.Noerrors.H&R:0 H&R:1 H&R:2 Result11-21 11-28 11-34 SingletoCF.Runnersadvancetwobases.22-25 31-35 35-42 Groundoutto2B.Allrunnersadvanceonebase.26-34 36 43-46 Runnerson1stor2ndmustattempttosteal.Runners
withjumpratingofBorhigherhasstealratingdroppedonelevel.RunnerswithjumpratingofCorlowerhasstealratingreducedtwolevels.Battertakespitchandisstillatbat.BalktakesprecedenceifgeneratedandresultisYES
35-42 37-42 47-52 Groundout,4-3.Runnersadvanceonebase.43-51 43-48 53-61 Groundout,3-unassisted.Runnersadvanceonebase.52-61 51-56 62-64 Batterstrikesout.Leadrunnergetsjumpfornext
base,butstealratingreducedtwolevels.BalktakesprecedenceifgeneratedandresultisYES
62 57-61 65-67 Runnerson1stor2ndwithjumpratingofCorhigherattemptstosteal.RunnerswithjumpratingofDorEhold.BalktakesprecedenceifgeneratedandresultisYES
63-67 62 68-71 LineouttoP.Leadrunnerdoubledoff.68-74 63-64 72-75 FlyouttoLF.Runnershold.75-81 65-74 76-83 FlyouttoCF.Runnershold.82-88 75-88 84-88 FlyouttoRF.Runnershold.Note:Afterthehitandrunisresolved,thepitcherrevertsbacktopreviousPBrating.
Updated January 5, 2016
BUNTING FOR BASE HIT
This can only be used ONCE per batter, per game and NEVER when a runner is on 3rd base. The batter must have an OBR rating of A or B. When this play is called, ignore PB draw. Draw a new card to obtain new RN and use this chart. Note: “X” is the number after the last number of the hit range. -‐ Also, lead runner is put out by 3B if runner on 2nd base, by SS if runner on 1st base, or by 1B if no runners on base. Draw Result
Hit Range
Batter beats out bunt for hit. Runners advance one base. (see below for range)
X-‐35 Batter out, 3B – 1B. Runners advance. No sacrifice.
36-‐42 Batter out, 1B – P (covering 1st). Runners advance one base. No sacrifice.
43-‐48 Lead runner thrown out by pitcher. Batter safe at first on fielder’s choice. Any other runners advance one base.
51-‐52 Lead runner thrown out by catcher. Batter safe at first on fielder’s choice. Any other runners advance one base.
53 Batter misses bunt. A runner on 1st is picked off by catcher with TA or TA+ arm. All other runners hold. Batter cannot attempt to bunt again.
54 Batter misses bunt and all runners must attempt to steal. Batter cannot attempt to bunt again
55-‐58 Batter out C – 1B. Runners advance one base. No sacrifice.
61-‐64 Batter out 1B-‐unassisted. Runners advance one base. No sacrifice.
65 Error – P. Batter safe at first. Runners advance one base.
66 Error – 1B. Batter to second. Runners advance two bases.
67 Error – 2B. Batter safe at first. Runners advance one base.
68 Error – 3B. Batter safe at first. Runners advance one base.
71 Catcher makes wild throw to 1B. Batter to third. All runners score.
72-‐74 Foul out to C.
75-‐76 Foul out to 3B.
77-‐78 Foul out to 1B.
81-‐88 Bunt try goes foul. Batter still at bat, but cannot attempt to bunt again.
BUNTER RATINGS
To obtain the hit range for a bunter, use the following chart. Any range that is not listed on this chart cannot attempt to bunt for base hit.
OBR SAC HIT OBR SAC HIT A A 11-‐34 B A 11-‐32 A B 11-‐32 B B 11-‐28 A C 11-‐28 B C 11-‐26 A D 11-‐24
Updated January 5, 2016
SACRIFICE CHART
When a sacrifice is called, ignore PB draw. Draw a new card to obtain new RN and use this chart, using the SAC rating of the batter. SAC: A SAC: B SAC: C SAC: D Result
11-‐18 11-‐18 11-‐15 11-‐13 Batter out, P – 2B (covering 1st). Runners
advance. Sacrifice.
21-‐27 18-‐25 16-‐23 14-‐18 Batter out, C – 1B. Runner advance.
Sacrifice.
28-‐37 26-‐34 24-‐31 21-‐24 Batter out, 1B – P (covering 1st). Runners
advance. Sacrifice.
38-‐65 35-‐55 32-‐48 25-‐41 Batter out, 3B – 1B. Runners advance.
Sacrifice.
66-‐67 56 Batter safe on bunt base hit. Runners
advance one base.
68 57-‐68 51-‐68 42-‐68 Lead runner tagged out, Catcher to lead
base. Batter safe.
71 71 71 71 Error – 1B. All safe. Sacrifice.
72 72 72 72 Error – P. All safe. Sacrifice.
73 73 73 73 Error – 3B. All safe. Sacrifice.
74 74 74 74 Error – C. All safe. Sacrifice.
75 75-‐77 75-‐82 75-‐82 Batter fouls out to C. Runners hold.
76-‐77 78-‐83 83-‐85 83-‐86 Double Play. Pop out to C who throws to
lead base.
78-‐88 84-‐88 86-‐88 87-‐88 Batter fouls off third strike. Strikeout.
Updated January 5, 2016
CD CHART **only use with runners on base** PITCHER CD-‐1 CD-‐2 CD-‐3 CD-‐4 Play Description 11 11-‐13 11-‐16 11-‐18 Great catch of foul fly. Runners hold. 12 14-‐15 17-‐23 21-‐26 Double Play, if runner on first (1-‐4-‐3). If no runner on first, lead runner thrown out
trying to advance, batter safe. 13-‐18 16-‐21 24-‐25 27 Hard shot ricochets off pitcher for hit, runners advance one base. OBR A advances
two. 21-‐25 22-‐24 26-‐27 28 Error on ground ball (E1). Runners advance one base. 26-‐27 25-‐26 28 31 Fields grounder but throws wildly to first (E1). Batter to first, runners advance two
bases. 28 27-‐31 31-‐36 32-‐41 Great catch of a line drive. Lead runner is doubled out. 31-‐38 32-‐36 37-‐38 42 Unable to field slow roller. Single, runners advance one base. 41-‐88 37-‐88 41-‐88 43-‐88 Foul ball. Resume normal PB play. CATCHER CD-‐1 CD-‐2 CD-‐3 CD-‐4 Play Description 11 11-‐13 11-‐16 11-‐18 Great catch of a foul fly. Runners hold. 12 14-‐15 17-‐23 21-‐26 Lead runner thrown out-‐batter safe. (If man on third, he holds, batter out 2-‐3.) 13-‐18 16-‐21 24-‐25 27 Slow roller for base hit. Runners advance one base. 21-‐25 22-‐24 26-‐27 28 Passed ball. Runners advance one base. 26-‐27 25-‐26 28 Interference (E2). Batter to first, runners advance if forced. 28 27-‐31 31-‐36 31-‐38 Lead runner picked off by catcher. 31-‐33 32-‐33 37 41 Fumbled dribbler. Batter safe, runners advance one base (E2). 34-‐38 34-‐36 38 42 Wild throw on pick off try (E2). Runners advance one base. OBR A and B advance
two. 41-‐42 43-‐46 Handles two-‐strike foul tip for strikeout. 43-‐44 47-‐52 Frames two-‐strike pitch for strikeout. 45-‐46 53-‐56 With man on first, second, or first and second, catcher calls for pitchout and nails
lead runner trying to steal. 47-‐48 57-‐62 Goes to mound to confer with pitcher and dispenses pearls of wisdom. Add two to
pitcher’s PB rating ONLY for that batter. (max of PB: 2-‐10) 51-‐55 63-‐78 Foul by stands. Home team catcher makes play, Visiting team catcher must survive
random number; 11-‐78 makes catch, 81-‐88 goes foul. 41-‐88 37-‐88 56-‐88 81-‐88 Foul ball. Resume normal PB play. FIRST BASEMAN CD-‐1 CD-‐2 CD-‐3 CD-‐4 Play Description 11 11-‐13 11-‐16 11-‐18 Great catch of foul fly. 12 14-‐15 17-‐23 21-‐26 Double play if runner on first (3-‐6-‐3). If no runner on first, lead runner thrown out
trying to advance, batter safe. 13-‐18 16-‐21 24-‐25 27 Hard shot down line for double. Runners score. 21-‐25 22-‐24 26-‐27 28 Error on ground ball (E3). Batter safe at first, runners advance one base. 26-‐27 25-‐26 Drops throw from shortstop (E3, a-‐6). Batter safe, runners advance one base. 28 31 Great stretch on throw from shortstop, batter out, runners advance one base. 28 27-‐31 31-‐36 32-‐41 Great catch of a line drive. Any runner on first is doubled off. 31-‐38 32-‐36 37-‐38 42 Unable to field grounder. Single, runners advance one base. 41-‐44 37-‐41 41-‐42 43 Bouncer through the hole. Single, runners advance two bases. 43-‐45 44-‐48 Foul out down right field line. Any runner may attempt to advance using ADVANCE
ON FLY OPTION. Consider arm to be T2. 46-‐48 51-‐54 Line out. Runners hold. 55-‐56 Line out. Any lead runner doubled off. 45-‐88 42-‐88 51-‐88 57-‐88 Foul ball. Resume normal PB play.
Updated January 5, 2016
SECOND BASEMAN OR SHORTSTOP
CD-‐1 CD-‐2 CD-‐3 CD-‐4 Play Description 11 11-‐13 11-‐16 11-‐18 Great catch of shallow, looping fly to outfield. Runners hold 12 14-‐15 17-‐23 21-‐26 If first base occupied, double play (4-‐3 or 6-‐3). If no runner on first, great stop on
grounder. Lead runner thrown out. Batter safe at first. 13-‐18 16-‐21 24-‐25 27 Hard shot over bag goes through for single. Runners advance two bases. 21-‐25 22-‐24 26-‐27 28 Error on ground ball (E4 or E6). Batter safe at first, runners advance one base. 26-‐27 25-‐26 28 31 Fields ground ball, but throws wildly to first. Batter to first, runners advance two
bases. 28 27-‐31 31-‐36 32-‐41 Great catch of a line drive. Any runner on second doubled off. 31-‐38 32-‐36 37-‐38 42 Unable to field slow roller. Single, runners advance one base. 41-‐44 37-‐41 41-‐42 43 Bouncer through the hole. Single, runners advance two bases.
43-‐45 44-‐48 Foul out to short left if shortstop, short right if second baseman. Any runner may attempt to advance using ADVANCE ON FLY OPTION. Consider arm to be T2 if second baseman, T3 if shortstop.
46-‐48 51-‐55 Lineout. Runners hold. 51-‐55 56-‐64 Force out at 2nd if runner on 1st. With no runner on first, ground out, (4-‐3 or 6-‐3).
Runner on 2nd advances to 3rd. If runner on 3rd with less than two outs, out at home (4-‐2 or 6-‐2).
65-‐78 Lineout, lead runner doubled off. 45-‐88 42-‐88 56-‐88 81-‐88 Foul ball. Resume normal PB play.
THIRD BASEMAN
CD-‐1 CD-‐2 CD-‐3 CD-‐4 Play Description 11 11-‐13 11-‐16 11-‐18 Great catch of foul fly. Runners hold. 12 14-‐15 17-‐23 21-‐26 If first occupied (5-‐4-‐3) double play. (If first base is not occupied, great stop on
grounder, lead runner out either 5-‐unassisted or 5-‐2. Batter safe if less than two outs.)
13-‐18 16-‐21 24-‐25 27 Hard shot down the line for double. Runners score. 21-‐25 22-‐24 26-‐27 28 Error on ground ball (E5). Batter safe, runners advance one base. 26-‐27 25-‐26 28 31 Fields ground ball but throws wildly to first. Batter to first, runners advance two
bases. 28 27-‐31 31-‐36 32-‐41 Great catch of a line drive. Any runner on third doubled off. 31-‐38 32-‐36 37-‐38 42 Unable to field slow roller. Single, runners advance one base. 41-‐44 37-‐41 41-‐42 43 Bouncer through the hole. Single. Runners on 2nd or 3rd score. Runner on first
stops at second base. 43-‐45 44-‐48 Foul out down left field line. Any runner may attempt to advance using ADVANCE
ON FLY OPTION. Consider arm to be T3. 46-‐53 51-‐61 Line out. Runners hold. 54-‐55 62-‐76 Line out. Lead runner doubled off.
77-‐78 Runner on 1st: 5-‐4-‐3 DP (or 5-‐3 if two outs) Runner on 2nd: Runner out in rundown 5-‐4-‐6. Batter safe at first (FC) Runner on 3rd: Runner out in rundown 5-‐2-‐6. Batter safe at first (FC) Runners on 1st and 2nd: 5-‐4-‐3 TRIPLE PLAY (or 5-‐4-‐3 double play if one out, or 5-‐3 if two outs) Runners on 1st and 3rd: 5-‐2, runner out at home, runner to second, batter to first (FC) Bases loaded: 5-‐4-‐3 TRIPLE PLAY (or 5-‐2-‐3 double play if one out, or 5-‐3 if two outs)
45-‐88 42-‐88 56-‐88 81-‐88 Foul ball. Resume normal PB play.
OUTFIELDER
CD-‐1 CD-‐2 CD-‐3 CD-‐4 Play Description 11 11-‐13 11-‐16 11-‐18 Great catch of a shallow fly. Runners hold. 12 14-‐15 17-‐23 21-‐26 Super catch of a sinking liner. Batter and lead runner on base are out. 13-‐18 16-‐21 24-‐25 27 Shallow fly falls for double. Runners advance two bases. 21-‐25 22-‐24 26-‐27 28 Drops fly for error (E7, E8, or E9). Batter to second, runners advance two, all score if
two are out. 26-‐27 25-‐26 28 31 Misplays drive into triple. Runners score. 28 27-‐31 31-‐36 32-‐41 Routine fly. Any runner on third gunned at the plate, double play (7-‐2, 8-‐2, or 9-‐2). 31-‐38 32-‐36 37-‐38 42 Unable to field routine fly. Three base error (E7, E8, or E9), all runners score.
41 43-‐44 Batter singles to alley, but is thrown out trying to stretch it if OBR B or less. Runners advance two bases. OBR A gets hustle double.
42-‐55 45-‐78 Tremendous snag in the gap. Runners may tag from second using ADVANCE ON FLY OPTION, and treating as deep fly. Runner on third scores.
41-‐88 37-‐88 56-‐88 81-‐88 Foul ball. Resume normal PB play.
Updated January 5, 2016
STOLENBASERATING/JUMPCHARTFirst,drawarandomnumbertodetermineifyoucanattemptasteal.ConsultjumpratingfromtheletterontheLEFTsideoftherunnersSBrating.Jumpsdroponeratingwhenfacingalefthandedpitcher.
STEALATTEMPTSRATINGS(onleftside)40+attemptsperseason......(AA)30+attempts..............................(A)20-29attempts.........................(B)10-19attempts.........................(C)5-9attempts...............................(D)Below5attempts.....................(E)
Ifthebaserunnercan'tattemptastealhemustwaitONEBATTERbeforetryingagain.Whenthejumpisunsuccessful,thecurrentatbatmustbecompletedbeforeanybaserunnercantrytogetajumpagainforastealattempt.
UsetheletterontheRIGHTsideforstealresults.
STOLENBASERATINGS(onrightside)A+=80%orgreaterstealpct.A=75-79%stealpct.B+=70-74%stealpct.B=65-69%stealpct.C+=60-64%stealpct.C=55-59%stealpct.D=45-54%stealpct.E=Below45%stealpct.
Updated January 5, 2016
JUMPCHARTS
Beforeabaserunnercanattemptastolenbase,hemustgetajump.DrawnextFACandconsultJUMPratingoftherunnerandthenewRNtodetermineifthejumpissuccessful.
(a) –Againstaleft-handedpitcher,allrunnersJUMPratingisreducedbyonelevel(AA
becomesA,BbecomesC,etc.).(b) –Againstaright-handedpitcher,allrunnersJUMPratingisreducedbyonelevel(AA
becomesA,BbecomesC,etc.).**Ateamcannotattempttostealmorethanonebaseinanyoneat-batexceptin
attemptingadoublestealundertheserules.**
DOUBLESTEALRULE
Adoublestealmaybeattemptedwithrunnerson1stand2nd,1stand3rdor2ndand3rd.Atriplestealmaybeattemptedwhenthebasesareloaded.
Bothrunnersmustgetajumpforadoublesteal.DrawanewRNforthejump
withtheleadrunner.Ifhegetsthejump,thendrawanotherRNforthetrailingrunner’sjump.Ifbothrunnersgetajump,thedoublestealison.
Theplayismadeontheleadrunnerinasolitairegame.Thedefensemay
choosewheretomaketheplayinahead-to-headgame.Usethecorrectstealchartoftheintendedrunner.
Ifarunneristhrownoutattemptingtosteal,allotherrunnersadvance,
assuminghe(they)hadajump.Nostealcreditwillbegiventotheadvancingrunnerinthissituation.
Asuccessfuldoubleortriplestealreducesapitcher’sstaminabyonepoint
evenifmultiplerunnerssteal.Ifarunscoresontheplay,itreducesapitcher’sstaminabyanadditionalpoint.
JUMPFORHOME(b)AA 11-24A 11-18B 11-14C 11D cannotstealE cannotsteal
JUMPFORSECONDBASE(a)AA 11-61A 11-51B 11-41C 11-31D 11-21E 11-17(vsRHP)E 11-14(vsLHP)
JUMPFORTHIRDBASEAA 11-41A 11-32B 11-23C 11-14D cannotstealE cannotsteal
Updated January 5, 2016
STEALINGSECONDBASE
Oncethebaserunneronfirstgetsajump,drawnextFACandconsulttheSBratingofthebasestealerandthenewRNtodeterminetheoutcome.
11-14 Ifleft-handedpitcherisonthemound,basestealeriscaughtstealing
Ifright-handedpitcherisonthemound,allbasestealerssteal2ndbase.15-35 Allbasestealerssteal2ndbase.36-41 BasestealersratedA+thruDsteal2ndbase.Allothersarecaughtstealing.42-44 BasestealersratedA+thruCsteal2ndbase.Allothersarecaughtstealing.45-46 BasestealersratedA+thruC+steal2ndbase.Allothersarecaughtstealing.47-51 BasestealersratedA+thruBsteal2ndbase.Allothersarecaughtstealing.52-54 BasestealersratedA+thruB+steal2ndbase.Allothersarecaughtstealing.55-57 BasestealersratedA+andAsteal2ndbase.Allothersarecaughtstealing.58-61 OnlybasestealersratedA+steal2ndbase.Allothersarecaughtstealing.62-63 Allbasestealersarecaughtstealing.64 Wildthrowbycatcher.Stolenbaseanderror.Basestealertothird.Runner
onthirdscores.65 Wildthrowbycatcher.Stolenbaseanderror.OBR-Abasestealerscores.All
othersadvancetothird.Runneronthirdscores.66-67 Infielderdropsthrowfromcatcher.Error.Basestealerissafeat2nd.(Actual
definitioniscaughtstealing.Scorehowyouwish.)68 BALK–checknextFACforyes/noonbalk.Ifyes,allrunnersadvanceone
base.Ifno,continuenormalplayandrunnermustwaitonebatterbeforeattemptingtostealagain.
71 Pitcher*throwswildlytofirstbase..Chargeerrortopitcher.OBR-Abasestealerscores.OBR-BandOBR-Cbasestealeradvancestothird.OBR-DandOBR-Ebasestealerstopsat2nd.Nostolenbasecredit.Runneronthirdscores.
72 Pitcher*throwswildlytofirstbasewithrightfielderbackingupplay.Chargeerrortopitcher.OBR-Abasestealeradvancestothird.Allotherrunnersadvanceto2nd.Nostolenbasecredit.Runneronthirdscores.
73-74 BasestealeroutifcatcherhasTA+arm.Otherwise,allattemptsaresafe.75-77 BasestealeroutifcatcherhasTA+orTAarm.Otherwise,allattemptsare
safe.78-82 BasestealeroutifcatcherhadTA+,TAorTBarm.Otherwise,allattempts
aresafe.83-84 Runnerpickedofffirstbasebypitcher.85 Runnerpickedofffirstbasebycatcher.
86-88 Allrunnerscaughtstealing.Note–Theoutorerrorisgiventosecondbasemanwithright-handedhitterattheplate.Theoutorerrorisgiventoshortstopwithleft-handedhitterattheplate.*ifthisresultisreachedfromthehitandrunbatterorpitchercontrolcharts,thencatcherthrowswildlytoleadbaseandresultsareasotherwisestated.
Updated January 5, 2016
STEALINGTHIRDBASE
Oncethebaserunneronsecondgetsajump,drawnextFACandconsulttheSBratingofthebasestealerandthenewRNtodeterminetheoutcome.
11-12 Ifleft-handedhitterisatbat,thenbasestealeriscaughtstealing.Ifbatteris
right-handed,basestealersteals3rdbase.13-33 Allbasestealerssteal3rdbase.34-37 BasestealersratedA+thruDsteal3rdbase.Allothersarecaughtstealing.38-44 BasestealersratedA+thruCsteal3rdbase.Allothersarecaughtstealing.45-46 BasestealersratedA+thruC+steal3rdbase.Allothersarecaughtstealing.47-51 BasestealersratedA+thruBsteal3rdbase.Allothersarecaughtstealing.52-54 BasestealersratedA+thruB+steal3rdbase.Allothersarecaughtstealing.55-57 BasestealersratedA+andAsteal3rdbase.Allothersarecaughtstealing.58-61 OnlybasestealersratedA+steal3rdbase.Allothersarecaughtstealing.62-63 Basestealercaughtstealing.64 Wildthrowbycatcher.Stolenbaseanderror.Basestealerscores.Anyother
runnersadvanceonebase.65 Catchercan’tgetballoutofmitt.Basestealersteals3rdbase.Allother
runnershold.66 Thirdbasemandropstheball.Error.Nostealcreditgiven.Allotherrunners
hold.67 Throwfromcatchersailshigh.Erroroncatcher.Basestealerscores,all
otherrunneradvanceonebase.68 BALK–checknextFACforyes/noonbalk.Ifyes,allrunnersadvanceone
base.Ifno,continuenormalplayandrunnermustwaitonebatterbeforeattemptingtostealagain.
71 Pitcher*throwswildlyonpickofftosecondbase.Erroronpitcher.Basestealertothird,allotherrunnersadvanceonebase.
72 Pitcher*throwswildlyonpickofftosecondbase.Erroronpitcher.OBR-AandOBR-Bbasestealersscore.Allotherbasestealersstopatthird.Anyotherrunnersadvanceonebase.
73-75 Basestealercaughtstealing.76-77 BasestealeroutifcatcherhasTA+arm.Otherwise,allattemptsaresafe.78-82 BasestealeroutifcatcherhadTA+orTAarm.Otherwise,allattemptsare
safe.83-85 BasestealeroutifcatcherhadTA+,TAorTBarm.Otherwise,allattempts
aresafe.86-88 Basestealercaughtstealing.Note–Allcaughtstealingarescoredcatchertothirdbaseman.*ifthisresultisreachedfromthehitandrunbatterorpitchercontrolcharts,thencatcherthrowswildlytoleadbaseandresultsareasotherwisestated.
Updated January 5, 2016
STEALINGHOME
Oncethebaserunneronthirdgetsajump,drawnextFACandconsulttheSBratingofthebasestealerandthenewRNtodeterminetheoutcome.
11-12 Ifleft-handedhitterisatbat,thenbasestealeriscaughtstealing.Ifbatteris
right-handed,basestealerstealshome.13 Allbasestealersstealhome.
14-16 BasestealersratedA+thruBstealhome.Allothersarecaughtstealing.17-21 BasestealersratedA+thruB+stealhome.Allothersarecaughtstealing.22-24 BasestealersratedA+thruAstealhome.Allothersarecaughtstealing.25-27 OnlybasestealersratedA+stealhome.Allotherarecaughtstealing.28-37 Batterhitsfoulball.Runnerholds.DrawanotherPBandcontinuenormal
play.38-41 CD-3andCD-4ratedcatcherstagbasestealerout.CD-2andCD-1rated
catcherdropstheball.Error.Basestealersafeandallotherrunnershold.42 TA+andTAratedcatcherspickrunneroffthirdbase.Allotherrated
catchersforcerunnerbacktobag.Continuenormalplay.43-44 Basestealerpickedoffthirdbasebycatcher.45-46 Wildthrowbycatcher.Stolenbaseanderror.Basestealerscores.Anyother
runnersadvanceonebase.47 BALK–checknextFACforyes/noonbalk.Ifyes,allrunnersadvanceone
base.Ifno,continuenormalplayandrunnermustwaitonebatterbeforeattemptingtostealagain.
48 Pitcherrattledandthrowshomelate.Allratedstealersaresafe.51-88 Basestealercaughtstealing.Note–Allcaughtstealingarescoredpitchertocatcher.
Updated January 5, 2016
SQUEEZE PLAY
This play is used when third base is occupied. Ignore PB draw. Draw a new card to obtain new RN and use this chart, using the SAC rating of the batter. SAC: A SAC: B SAC: C SAC: D Result
11-‐28 11-‐26 11-‐21 11-‐16 Batter out, P – 1B. All runners advance one
base. Sacrifice.
31-‐32 27-‐28 22-‐25 17-‐22 All safe on FC. Sacrifice.
33-‐38 31-‐38 26-‐38 23-‐38 Runner out at home, P – C. All other
runners advance one base.
41-‐43 41-‐43 41-‐43 41-‐43 Runner out at home, 1B – C. All other
runners advance one base.
44-‐46 44-‐46 44-‐46 44-‐46 Runner out at home, 3B – C. All other
runners advance one base.
47-‐52 47-‐52 47-‐52 47-‐52 Error on pitcher. All safe. Sacrifice.
53-‐54 53-‐57 53-‐63 53-‐71 Batter misses pitch. Runner out caught
stealing P – C.
55-‐71 58-‐71 64-‐71 72-‐78 Batter fouls out to catcher. Runners hold.
72-‐88 72-‐88 72-‐88 81-‐88 Batter pops out to pitcher. Runners hold.
Updated January 5, 2016
TAGGING UP FROM THIRD ON OUTFIELD FLY This chart is used in any situation when there a runner is on third base with fewer than two outs and the result is an F or an FD. Follow the steps below and then consult the chart (if necessary). Step One (type of fly ball): If the fly ball is an FD, a runner on third tags up and scores without a throw, regardless of speed. Check other charts for possible advance by runners tagging up from second and/or first. If the fly ball is an F, check the RN of the current FAC card (i.e., don’t draw a new FAC card). If the RN is an odd number, the F is a routine fly ball. If the RN is an even number, the F is a fly ball that is more difficult for the outfielder to line up and make his best throw – in this case, the runner’s OBR is considered one faster than normal for purposes of this play (e.g., an OBR C becomes an OBR B, and an OBR A becomes an OBR A+). Step Two (arm of outfielder): To determine the correct column to use in the following table, start with the (modified) OBR of the runner on third. Then adjust based on the arm of the outfielder who caught the fly, as follows: T5= make runner’s OBR two columns slower T4= make runner’s OBR one column slower T3= no adjustment T2= make runner’s OBR one column faster T1= make runner’s OBR two columns faster Note: If result is faster than Column A, use Column A. Step Three (manager decisions): Once the correct column has been determined, the offense must decide whether to send the runner home. If the offense decides to send the runner, draw a new FAC and consult the chart below (but see Defensive Option below). If the defense throws home, the result for any other runner(s) is dictated by the chart (do not consult charts for runners tagging up from second or first). If the offense decides to hold the runner at third, see chart for runner tagging up from first, if applicable. Defensive Option: If the offense sends the runner to home, the defensive manager may choose not to make the throw home, conceding the run. In that case, other runner(s) may attempt to tag and advance (see charts for runners tagging up from second or first). Step Four: Draw a new FAC and use RN on chart below (unless runner held or run conceded). Solitaire Game: In a solitaire game without instructions otherwise: (1) on an FD, runner on third tags and scores, and (2) on an F, runner on third tags up and tries to score if Column A, B, or C, unless the runner’s team is more than two runs behind or unless sending the runner would be a clearly unwise baseball decision, in the judgment of the solitaire manager (e.g., runner on third only, 9th inning, team behind by two runs).
Updated January 5, 2016
A+2 A+1 A B C D Result
11-12 11-12 11-12 11 11 11
Runner safe at third. If outfielder is E2-10, his throw to third sails into the dugout – runner awarded home, and runner on first advances one base (charge error to outfielder).
13-14 13-14 13-14 12 12 12 Same as above, but E3-10 outfielder makes wild throw. 15-16 15-16 15-16 13 13 -- Same as above, but E4-10 outfielder makes wild throw.
17-34 17-31 17-26 14-18 14 -- Runner safe at third. OBR A-B runner on first takes second on the play.
35 32 27 21 15 13
Runner safe at third. If outfielder is CD 1, his throw misses the cutoff man – runner on first takes second (no error charged). Otherwise, runner on first tries for second and is thrown out by cutoff man.
36 33 28 22 16 14 Same as above, but CD 1-2 outfielder misses cutoff man. 37 34 31 23 17 -- Same as above, but CD 1-3 outfielder misses cutoff man.
38 35 32-34 24-33 18-34 15-32 Runner out at third. OBR A runner on first takes second on the play.
41-65 36-61 35-52 34-45 35-36 33 Runner safe at third. Runner on first holds.
66 62 53 46 37 34 If third baseman is E0-3, runner out at third; otherwise, safe (error on third baseman, dropped the tag). OBR A-B runner on first takes second on the play.
-- 63 54 47 38 35 Same as above, but E0-4 third baseman makes the play. -- 64-65 55-63 48-63 41-62 36-61 Runner out at third. Runner on first holds.
67 66 64 64 63 62 Runner safe at third. Runner on first holds. Third baseman is shaken up on the play and must leave the game. Third baseman may return the next day.
-- 67 65 65-66 64-65 63-64 Runner safe at third. OBR A-B runner on first takes second; OBR C-D runner on first thrown out trying to advance to second. OBR E runner on first holds.
68 68 66 67 66 65 If third baseman is CD 4, he makes great play to tag runner out at third; otherwise, runner safe at third. Runner on first holds.
71 71 67 68 67 66 Same as above, but CD 3-4 third baseman makes great play.
-- 72 68 71 68 67 Same as above, but CD 2-4 third baseman makes great play.
72-87 73-85 71-82 72-76 71 -- Runner safe at third. OBR A runner on first takes second on the play.
88 86 83 77 72 68 Runner out at third. Runner on first holds. Runner is shaken up on the play at third and must leave the game. Injured runner may return the next day.
-- 87 84-87 78-86 73-86 71-86 Runner out at third. OBR A-B runner on first takes second on the play.
-- 88 88 87-88 87-88 87-88
Runner called safe at third. Runner on first holds. Defense appeals that runner left second early. Umpire upholds appeal and calls runner out at third. (Note: If runner scored from third on this play, the run counts).
95% 88% 70% 50% 25% 15% Approximate % chance that runner will be safe.
Updated January 5, 2016
TAGGING UP FROM SECOND ON OUTFIELD FLY This chart is used in when there a runner is on second base (and no runner on third base) with fewer than two outs and the result is an FD or an F. It also is used in FD and F situations when the bases are loaded or runners are on second and third and the defensive manager chose not to throw to the plate (see Defensive Option on the Tagging Up from Third on Outfield Fly chart). Follow the steps below and then consult the chart (if necessary). Step One (type of fly ball): If the fly ball is an FD8 or FD9, the runner’s OBR is considered two faster than normal for purposes of this play (e.g., an OBR C becomes an OBR A, and an OBR B becomes an OBR A+). If the fly ball is an FD7, there is no change to the runner’s OBR. If the fly ball is an F7, the runner’s OBR is considered two slower than normal for purposes of this play (e.g., an OBR D becomes an OBR E-1). If the fly ball is an F8, there is no change to the runner’s OBR. If the fly ball is an F9, the runner’s OBR is considered one faster than normal for purposes of this play (e.g., an OBR A becomes an OBR A+). Step Two (arm of outfielder): To determine the correct column to use in the following table, start with the (modified) OBR of the runner on second. Then adjust based on the arm of the outfielder who caught the fly, as follows: T5= make runner’s OBR two columns slower T4= make runner’s OBR one column slower T3= no adjustment T2= make runner’s OBR one column faster T1= make runner’s OBR two columns faster
Note: If result is faster than Column A+2, use Column A+2. If result is Column E or worse, then runner must hold (too slow to attempt to tag up and advance).
Step Three (manager decisions): Once the correct column has been determined, the offense must decide whether to send the runner to third. If the offense decides to send the runner, draw a new FAC and consult the chart below (but see Defensive Option below). The result for a runner on first is dictated by the chart (do not consult charts for runner tagging up from first). Defensive Option: If the offense decides to send the runner to third, the defensive manager may choose not to make the throw to third, conceding the base. In that case, runner on first may attempt to tag and advance (see chart for runner tagging up from first). Step Four: Draw a new FAC and use RN on chart below (unless runner held or base conceded). Solitaire Game: In a solitaire game without instructions otherwise, runner on second tags up and tries for third if Column A, A+1, or A+2, unless the runner’s team is more than two runs behind or unless sending the runner would be a clearly unwise baseball decision, in the judgment of the solitaire manager (e.g., runner on second only, 9th inning, team behind by two runs).
Updated January 5, 2016
A B C D E E -1 E-2 Result1 -- 11-12 11-15 11-22 11-27 11-32 11-34 Runner out at home. OBR A-B runner on second takes
third on the play. All other runners hold.
-- 13 16 23-35 28 33 -- If catcher is E0-1, runner out at home; otherwise, runner safe (error on catcher). Runner on second takes third; runner on first holds.
-- 134 17 36 31 34 35 Same as above, but E0-2 catcher makes the play. -- 145 18-25 37 32-51 35-56 36-61 Runner out at home. All other runners hold.
-- 16-17 26-31 38-45 52-61 57-67 62-75 Runner out at home. OBR A-B runner on second takes third; OBR C-D runner on second thrown out at third; OBR E runner on second holds. Runner on first holds.
11-12 18 32 46 62 68 76 Runner safe at home. If outfielder is CD 1, his throw goes over the cutoff man’s head -- all runners advance one base (no error charged). Otherwise, hold.
13-14 21 33 47 63 71 77 Same as above, but CD 1-2 outfielder misses cutoff man. 15-16 22 34 48 64 72 78 Same as above, but CD 1-3 outfielder misses cutoff man.
17 23 35 51 65 73 81 Runner safe at home. OBR A-D runner on first takes second. Catcher is shaken up on the play and must leave the game. Catcher may return the next day.
-- 24 36 52 66 74 -- If catcher is CD 4, he makes great play to tag runner out at home; otherwise, runner safe. All runners hold.
-- 25 37 53 67 75 82 Same as above, but CD 3-4 catcher makes great play. -- 26 38 54 68 76 83 Same as above, but CD 2-4 catcher makes great play.
18-21 27 41 55 71 77 84 Runner safe at home. If outfielder is E4-10, his throw is wild – all runners advance one base (charge error to outfielder if any trailing runner advances).
22-23 28 42 56 72 78 85 Same as above, but E3-10 outfielder makes wild throw. 24-25 31 43 57 73 81 -- Same as above, but E2-10 outfielder makes wild throw.
26 32 44 58-61 74-75 82-83 86-87 Runner called safe at home. All runners hold. Defense appeals that runner left third base early. Umpire upholds appeal and calls runner out (run does not count).
27 33 45 62 76 84 --
Runner safe at home. Throw to home is off line. If pitcher backing up the play is CD 1-2, all runners advance one base (error on outfielder). Otherwise, all runners hold.
28 34 46 63 77 85 88 Runner out at home. All runners hold. Runner is shaken up on the play and must leave the game. Injured runner may return the next day.
31-37 35-41 47-52 64-71 78-82 86 -- Runner safe at home. OBR A runner on second takes third; OBR B-C runner on second thrown out at third; OBR D-E runner on second holds. Runner on first holds.
38-74 42-78 53-78 72-82 83-85 87 -- Runner safe at home. OBR A-B runner on second takes third on the play. All other runners hold.
75-88 81-88 81-88 83-88 86-88 88 -- Runner safe at home. OBR A-C runner on second takes third on the play. OBR A runner on first takes second (if base is open). All other runners hold.
97% 85% 70% 50% 30% 21% 11% Approximate % chance that runner will be safe.
1 Example #1: OBR B runner on third – F8 to outfielder with T4 arm – FAC card shows RN 68. OBR B becomes OBR A for purposes of this play (because RN on current FAC card is an even number). Adjusting for outfielder’s arm, OBR A becomes one column slower. Use Column B on the chart below. Example #2: OBR D runner on third – F9 to outfielder with T5 arm – FAC card shows RN 57. No change to OBR based on type of fly ball (because RN on current FAC card is an odd number). Adjusting for outfielder’s arm, OBR D becomes two columns slower. Use Column E-1 on the chart below.
Updated January 5, 2016
TAGGING FROM FIRST ON OUTFIELD FLY This chart is used in when there a runner is on first base (and no other runners) with fewer than two outs and the result is an FD. It also is used in FD situations with multiple runners, including a runner on first, and the defensive manager chose the Defensive Option, conceding the next base to the lead runner(s) (see preceding charts). Follow the steps below and then consult the chart. Note: An F is not deep enough for a runner on first to tag and try for second. Step One (difficulty of fly ball): Check the RN of the current FAC card (i.e., don’t draw a new FAC card). If the RN is an odd number, the FD is a routine deep fly ball. If the RN is an even number, the FD is a deep fly ball that is more difficult for the outfielder to line up and make his best throw – in this case, the runner’s OBR is considered one faster than normal for purposes of this play (e.g., an OBR C becomes an OBR B, and an OBR A becomes an OBR A+). Step Two (arm of outfielder): To determine the correct column to use in the following table, start with the (modified) OBR of the runner on third. Then adjust based on the arm of the outfielder who caught the fly, as follows: T5= make runner’s OBR two columns slower T4= make runner’s OBR one column slower T3= no adjustment T2= make runner’s OBR one column faster T1= make runner’s OBR two columns faster Note: If result is slower than Column A, runner must hold at first. Step Three (manager decision): Once the correct column has been determined, the offense must decide whether to send the runner to second. If the offense sends the runner, draw a new FAC and use RN on chart below. (If FD8 or FD 9, SS receives throw; if FD7, 2B receives throw). Solitaire Game: In a solitaire game without instructions otherwise, runner on first holds. A+3 A+2 A+1 A Result
-- 11-16 11-24 11-33 Runner out at second.
11 17 25 34 Runner safe at second. Fielder covering second is shaken up on the play and must leave the game. Fielder covering second may return the next day.
12-13 18-21 26-27 35-36 If fielder receiving the throw is CD 4, he makes a great play to tag runner out at second; otherwise, runner safe at second.
14-15 22-23 28-31 37-38 Same as above, but CD 3-4 fielder covering second makes great play. 16 24-25 32-33 41-42 Same as above, but CD-2-4 fielder covering second makes great play.
17 26 34 43 Runner out at second. Runner is shaken up on the play and must leave the game. Injured runner may return the next day.
18 27 35-36 44-45
Runner called safe at second. Defense appeals that runner left first early. Umpire upholds appeal and calls runner out at first. (Note: If runner scored from third on this play, the run counts. If runner advanced from second to third on this play, he stays at third.)
21-88 28-88 37-88 46-88 Runner safe at second. 92% 83% 72% 61% Approximate % chance that runner will be safe.
Updated January 5, 2016
DEFENSE OPTION PLAY CHART
The offense decides whether to send a runner on third home. If this a potential tie-‐breaking run, in the 7th inning or later, the defense (visitors / solitaire game) plays the infield in to try to get the runner at home, with a runner on third and less than two outs. Otherwise, the defense (visitors/solitaire game) plays the infield back and makes the play at first. To resolve a play at home, draw a new FAC and check the RN.
Runner Rating
Runner SAFE at home
Runner OUT at home
OBR-‐A 11-‐48 51-‐88
OBR-‐B 11-‐42 43-‐88
OBR-‐C 11-‐35 36-‐88
OBR-‐D 11-‐32 33-‐88
OBR-‐E 11-‐28 31-‐88
Note: The visiting team (in a solitaire game) will attempt to score ONLY if the runner on third is rated OBR-‐A. Otherwise, visitors must hold at third. The Defense Option Play is only used when called for on the Out Chart. The home team (in a solitaire game) must decide where to play the infield prior to the play whenever a man is on third base and less than two outs.
Updated January 5, 2016
Z PLAY INJURY CHART
Use this table when referred from Basic Z chart. Obtain a new random number and find out, first, the description of the injury and second, the number of games to be missed. All pitchers are considered to have an Injury Rating of 5, unless noted otherwise.
Inj Rating Games to be Missed
0 Remainder of this game only. 1 Remainder of this game and following game. 2 Use first digit of next random number. Limit of 5 games. 3 Use first digit of next random number. 4 Add both digits of next random number. Limit of 10 games. 5 Add both digits of next random number. 6 Multiply digits of next random number. Limit is 20 games. 7 Multiply digits of next random number. Limit is 30 games. 8 Use next random number.
Note: In instances of a collision, the one that has the higher injury rating is the one that is hurt. If they have the same rating, check both fielders. The one that misses more games is the one that is hurt. The other is shaken up and removed for this game only. For example, if collision between LF and CF. If the LF would miss 10 games and CF would miss 15 games, the LF is out for this game and the CF is hurt for 15 games. DESCRIPTION OF INJURIES RN Description
11 Batter hits a slow groundout to SS and pulls muscle. Check injury on batter. Batter may still play during injury, but only as DH or pinch hitter. His OBR and SB ratings are reduced two categories for the duration of the injury. Runners advance one base.
12 During the at-‐bat, pitcher starts rubbing his shoulder. Trainer comes out and the pitcher is removed from the game. Check injury of pitcher. Injury rating of pitcher is 5.
13 Batter brushed back with pitch. Dugouts empty in all out brawl. Both batter and pitcher are ejected. Check batter and pitcher for injury. Player with more games injured is hurt, the other is shaken up, but is ok. Give pitcher an injury rating of 6.
14 Batter hits a sizzling liner off the third baseman’s chest for a single. Runners advance one base. Check 3B for injury.
Updated January 5, 2016
15 Pitcher lands wrong on follow through and talks to pitching coach at half inning and cannot continue in this game.
16 Groundball in the hole to second baseman. He leaps, spins and throws out batter but twists his back. Runners advance one base. Check for injury on 2B.
17 Groundball to 1B. Ball takes bad hop and hits fielder in the face. Batter safe at first on single. All runners advance one base. Check injury on 1B.
18 Sailing fastball hits batter in the head. Change injury rating of batter. 21 High fly into short left. Crowd noise prevents SS and LF from hearing each other
and they collide. Give batter credit for double and all runners score, except OBR-‐D and OBR-‐E from first stop at third. Check injuries to SS and LF.
22 High fly into right-‐center field. CF and RF collide. Give batter credit for double and all runners score, except OBR-‐D and E from first stop at third. Check collision injuries to CF and RF.
23-‐25 Pitcher develops arm trouble. Check for injury, giving pitcher injury rating of 6. 26-‐28 Foul tip hits catcher. Check injury on C. 31 Third baseman falls into dugout chasing foul pop up. CD-‐3 or 4 makes catch,
otherwise, foul ball. Check injury on 3B. 32 First baseman falls into stands chasing foul pop up. CD-‐3 or 4 makes catch,
otherwise, foul ball. Check injury on 1B. 33 Pitcher hit by line drive. Single. All runners advance one base. Check for injury,
giving pitcher injury rating of 5. 34 Line drive to left field. LF takes one step, grabs his hamstring. Batter safe at first.
Runners advance one base. Check injury on LF. 35-‐36 Batter fouls pitch off his foot. Check injury on batter. 37 CF runs after long fly and crashes into fence. OBR-‐A, inside the park home run,
OBR-‐B & C, triple. OBR-‐D & E, double. Check injury to CF. Runners advance three bases except OBR-‐D & E who advance two bases.
38 Catcher chases high pop foul and falls into dugout. CD-‐3 or 4 makes catch, otherwise, foul ball. Check injury on C.
41 Pitcher develops blister. Must be removed from game. Check for injury. Injury rating of pitcher 4.
42 Line drive down right field line. RF catches cleat and stumbles. Ball rolls into RF corner for a triple for OBR-‐A & B. Double for others. All runners score. Check injury on RF.
43 LF wrenches knee diving for low liner. Double, two base advance. Check injury on LF.
44 CF twists ankle cutting off single. Runners advance two bases. Check injury on CF. 45 RF jars shoulder attempting a diving catch. Double. Runners advance two bases.
OBR-‐A runner scores from first. Check injury on RF. 46 Batter pulls muscle striking out. Check injury on batter. 47 Batter hits slow roller to 1B who flips to P covering. Batter and pitcher collide and
ball knocked loose. Single. Runners advance one base. Both pitcher and batter are injured. Check injury on pitcher and hitter.
48 Routine grounder to SS who throws for lead runner, who is hurt sliding. Check injury on runner. If no one base, batter out at first.
51 Routine grounder to SS. If less than 2 outs, runner on 1st takes out 2B. Runner out, batter safe. Check for injuries on fielder and runner. One with greater injuries is the one hurt. Other is shaken up and leaves the game. Runners advance one base. If no one on base, batter out at first.
Updated January 5, 2016
52 LF and CF collide. Check collision injuries to LF and CF. Batter and runner(s) rated OBR-‐A or B speed advance two bases, all others advance one.
53 If game is in 8th inning or later, RF loses liner in the sun and is hit in the face. Scored a double. OBR-‐A & B runners advance two bases. All others advance one base. Check injury on RF.
54 Groundball in the hole to shortstop. He leaps, spins and throws out batter but twists his back. Runners advance one base. Check for injury on SS.
55 With runner on 2nd, batter hits single to CF. Play at the plate. Runner and catch collide. Check collision injury on both runner and catcher.
56 Batter hits long foul drive into the stands. While running to first, batter comes up lame grabbing his hamstring. Check injury on batter.
57 C hurt diving for foul pop up. CD-‐3 and CD-‐4 catcher makes catch. Check for injury on C.
58 Slow grounder to SS. Batter tries to beat out the hit, spikes the 1B, trips and falls. Credit batter with single. Check batter AND 1B for injury. One with longer injury time is hurt, the other leaves for the remainder of the game. OBR-‐A base runner advance two bases, all others advance one.
61 Ground ball to first baseman. He steps on the bag wrong and rolls his ankle. Batter is out. First baseman is out for the remainder of this game only.
62 Ground ball to second baseman. Tries to barehand the ball and jams his finger but still completes the play at first. Second baseman is out of the remainder of this game only.
63 Ground ball to shortstop. Ball takes a bad hop and hits fielder in the throat. Batter safe at first on single. All runners advance one base. Shortstop is out of the remainder of this game only.
64 Ground ball to third baseman. He takes the ball off this chest but still completes the play at first. Third baseman is out of the remainder of this game only.
65 Batter hits slow roller in front of home plate. Catcher grabs the ball and throws out runner, but steps in his mask and falls awkwardly. He is out for the remainder of this game only.
66 Fly ball to left fielder. He back pedals into a divot and steps awkwardly. Catches the ball, but is removed from this game at the half inning. He misses the remainder of this game only.
67 Fly ball to center fielder. While drifting to his right, he steps on cup thrown on field. He catches the ball, but is removed from this game at the half inning. He misses the remainder of this game only.
68 Fly ball to right fielder. While chasing ball, fielder steps into drainage ditch, twisting his ankle, but still makes catch. He misses the remainder of this game only.
71-‐88 No action. Play resumes as normal.
Updated January 5, 2016
BASES EMPTY OUT CHART
G1: Ground out P - 1B G2: Ground out C - 1B G3: Ground out 1B - u G4: Ground out 2B - 1B G5: Ground out 3B - 1B
G6: Ground out SS - 1B
GX1: Ground out P - 18 GX2: Ground out C - 1B
GX3: Ground out 18 - u GX4: Ground out 2B - 1B GX5: Ground out 3B - 18 GX6: Ground out SS -18 G1A: Ground out P - 18 G2A: Ground out C - 1B G3A: Ground out 18- u G4A: Ground out 213 - 18 G5A: Ground out 3B - 1B
G6A: Ground out SS - 1B G3-1A: Ground out 1B - P F7: Fly out LF
F8: Fly out CF F9: Fly out RF FD7: Fly out Deep LF FD8: Fly out Deep CF FD9: Fly out Deep RF L1:
Line out P L3: Line out 18.
L4: Line out 213
L5: Line out 38
L6: Line out SS Fl:
Pop out P F2: Foul out C F3: Foul out 18
F4: Pop out 28 F5: Foul out 38 F6: Pop out SS
ERROR SEQUENCE Error 1: Fielder bobbles ball. Batter safe. Error 2: Wild throw to 1st. Batter to 2nd if OBR-A or B
Error 3: Booted groundball. Batter safe.
Error 4: Hit gets past outfielder. SINGLE: Batter to 2nd
DOUBLE: Batter to 3rd. OBR-A scores
TRIPLE: Batter scores
Error 5: OF cannot pick up ball. Batter takes extra base.
No error if OBR-D or E as he doesn't advance.
MAN ON FIRST OUT CHART
G1: Double play groundout, P-2B-1B. OBR-A safe at 1st. G2: Double play groundout, C-SS-1B. OBR-A safe at 1st. G3: Double play groundout, 1B-SS-1B. OBR-A or B safe at 1st. G4: Double play groundout, 28-55-1B. G5: Double play groundout, 38-28-1B. OBR-A safe at 1st G6: Double play groundout, 55-28-1B GX1: Force out at 2nd, P-2B. Batter safe. GX2: Force out at 2nd, C-SS. Batter safe. GX3: Force out at 2nd, 18-SS. Batter safe. GX4: Force out at 2nd, 2B-SS. Batter safe. GX5: Force out at 2nd, 38-28. Batter safe. GX6: Force out at 2nd, SS-2B. Batter safe. G1A: Ground out P -1B. Runner to 2nd.
G2A: Ground out C - 18. Runner to 2nd. G3A: Ground out 1B - u. Runner to 2nd. G4A: Ground out 213 - 113. Runner to 2nd. G5A: Ground out 38- 1B. Runner to 2nd.
G6A: Ground out SS - 1B. Runner to 2nd. G3-1A: Ground out 18- P. Runner to 2nd. F7: Fly out to LF. See Tagging Up From First on OF Fly F8: Fly out to CF. See Tagging Up From First on OF Fly F9: Fly out to RF. See Tagging Up From First on OF Fly FD7: Flyout deep LF. See Tagging Up From First on OF Fly FD8: Flyout deep CF.. See Tagging Up From First on OF Fly FD9: Flyout deep RF. See Tagging Up From First on OF Fly L1: Line out P. Runner holds. L3: Line out 18. Runner holds. CD-4 doubles off runner L4: Line out 28.
L5: Line out 3B
L6: Line out SS Fl: Pop out P. Runner holds
F2: Pop out C. Runner holds. F3: Pop out 1B. Runner holds. F4: Pop out 28. Runner holds. F5: Pop out 38. Runner holds. F6: Pop out SS. Runner holds.
ERROR SEQUENCE
Error 1: Grounder mishandled. Batter safe. Runner to 2nd. Error 2: Wild throw. Batter safe, runner to 3rd
Error 3: Muffed ground ball. Batter safe. Runner to 2nd. Error 4: Outfielder kicks ball. Runner scores, batter gets
extra base.
Error 5: Ignore. No error occurs
MAN ON SECOND OUT CHART
G1: Ground out P - 1B. Runner holds. OBR-A runner to 3rd. G2: Ground out C - 1B. Runner holds. G3: Ground out 1B - u. Runner to 3rd. G4: Ground out 28- 1B. Runner to 3rd. G5: Ground out 38 - 1B. Runner holds. G6: Ground out SS - 18. Runner holds. GX1: Ground out P -18, Runner holds. OBR-A runner to 3rd. GX2: Ground out C - 1B. Runner holds. GX3: Ground out 18 - u. Runner to 3rd. GX4: Ground out 28- 1B. Runner to 3rd. GX5: Ground out 38 - 1B. Runner holds. GX6: Ground out SS- 18. Runner to 3rd. G1A: Ground out P - 1B. Runner to 3rd. G2A: Ground out C - 1B. Runner to 3rd.
G3A: Ground out 18- u. Runner to 3rd. G4A: Ground out 28 -1B. Runner to 3rd. GSA: Ground out 38- 1B. Runner to 3rd. G6A: Ground out SS - 1B. Runner to 3rd.
G3-1A: Ground out 1B - P. Runner to 3rd. F7: Fly out LF. See Tagging Up From Second on OF Fly F8: Fly out CF. See Tagging Up From Second on OF Fly F9: Fly out RF. See Tagging Up From Second on OF Fly FD7: Fly out deep LF. See Tagging Up From Second on OF Fly FD8: Fly out deep CF. See Tagging Up From Second on OF Fly FD9: Fly out deep RF. See Tagging Up From Second on OF Fly L1: Line out P. Runner holds. L3: Line out 1B. Runner holds. L4: Line out 213. Runner holds. CD-4 at 213 doubles off runner L5: Line out 38. Runner holds. L6: Line out SS. Runner holds. Fl: Soft pop out P. Runner holds. F2: Foul out C. Runner holds. F3: Foul out 113. Runner holds. F4: Pop out 28. Runner holds. F5: Pop out 313. Runner holds. F6: Pop out SS. Runner holds.
ERROR SEQUENCE
Error 1: Ground ball through fielder legs. Batter safe. Runner to 3rd. OBR-A runner scores if two outs.
Error 2: Wild throw. Batter to 2nd. Runner scores. Error 3: Ball rolls up fielder arm and can't make play. Batter
safe. Runner holds. If 2 outs, runner advances to 3rd.
Error 4: Outfielder drops ball. Batter takes extra base. Runner
scores.
Error 5: Runner scores, batter takes extra base, thrown out if
outfielder is T5
Updated January 5, 2016
MAN ON THIRD OUT CHART
G1: INFIELD IN: Ground out P - 1B. Runner holds.
INFIELD BACK: Ground out P - 18. Runner holds.
G2: IN: Ground out C - 1B. Runner holds.
BACK: Ground out C - 18. Runner holds.
G3: IN: Consult Defensive Option Chart
BACK: Ground out 1B - u. OBR A or B scores. C, D or E holds
G4: IN: Consult Defensive Option Chart
BACK: Ground out 2B - 1B. OBR A, B or C scores. D or E holds
G5: IN: Consult Defensive Option Chart
BACK: Ground out 3B-1B. OBR A scores. Others have Def Option
G6: IN: Consult Defensive Option Chart BACK: Ground out SS - 1B. OBR A, B or C scores. D or E holds
GX1: IN: Ground out P - 1B. Runner holds.
BACK: Ground out P - 1B. Runner holds.
GX2: IN: Ground out C - 1B. Runner holds. BACK: Ground out P - 18. Runner holds.
GX3: IN: Ground out 1B - u. Runner holds with Def Option for A or B
BACK: Ground out 1B - u. OBR-A, B or C scores.
GX4: IN: Ground out 2B - 18. Runner holds.
BACK: Ground out 28 - 1B. OBR-A, B or C scores.
GX5: IN: Ground out 38 - 1B. Runner holds.
BACK: Ground out 38- 1B. OBR-A, B or C scores.
GX6: IN: Ground out SS - 1B. Runner holds.
BACK: Ground out SS - 1B. OBR-A, B or C scores.
G1A: IN: Ground out P - 113. OBR-A or B scores.
BACK: Ground out P - 11 Runner scores.
G2A: IN: Ground out C - 18. Runner holds.
BACK: Ground out C - 18. OBR A scores
G3A: IN: Single thru infield. Runner scores.
BACK: Ground out 1B - u. Runner scores.
G4A: IN: Single thru infield. Runner scores.
BACK: Ground out 2B - 1B. Runner scores.
G5A: IN: Single thru infield. Runner scores.
BACK: Ground out 38 - 113. Runner scores.
G6A: IN: Single thru infield. Runner scores.
BACK: Ground out SS - 1B. Runner scores.
G3-1A: Ground out 1B - P. Runner scores, except OBR-E.
F7: Fly out LF. See Tagging Up From Third on OF Fly F8: Fly out CF. See Tagging Up From Third on OF Fly F9: Fly out RF. See Tagging Up From Third on OF Fly
FD7: Fly out deep LF. See Tagging Up From Third on OF Fly FD8: Fly out deep CF. See Tagging Up From Third on OF Fly.
FD9: Fly out deep RF. See Tagging Up From Third on OF Fly
L1:
Line out P. Runner holds.
L3: Line out 1B. Runner holds. L4: Line out 2B. Runner holds. L5: Line out 3B. Runner holds. CD-4 at 38 doubles off L6: Line out SS. Runner holds.
Fl:
Pop out P. Runner hold. F2: Pop out C. Runner hold.
F3: Pop out 1B. Runner hold. F4: Pop out 28. Runner hold. F5: Pop out 38. Runner hold.
F6: Pop out SS. Runner hold.
ERROR SEQUENCE
Error 1: Ground ball off fielder's chest. Batter safe. Runner scores. Error 2: Wild throw. Batter to 2nd. Runner scores.
Error 3: outs. Batter safe.
Ball sticks in fielder's glove. Runner scores IF two
Ball booted away. Batter to third on single, scores
Error 4: on double or triple. Runner scores. Outfielder drops ball. Runner scores. Batter out
Error 5: . trying for additional base. OBR-A or B safe in
MAN ON FIRST AND SECOND OUT CHART
G1: Double play ground out, P-SS-1B. Runner on 2nd advances. G2: Double play ground out, C-3B-1B. Runner on 1st advances. G3: Double play ground out, 1B-SS-1B. Runner on 2nd advances. G4: Double play ground out, 28-1B. Runner on 2nd advances. G5: Double play ground out, 3B-2B-1B. Runner on 2nd advances. G6: Double play groundout, SS-1B. Runner on 2nd advances. GX1: Force out at 2nd, P-2B. Batter safe. Runner on 2nd advances. GX2: Force out at 3rd, C-3B. Batter safe. Runner on 1st advances. GX3: Force out at 2nd, 1B-SS. Batter safe. Runner on 2nd advances. GX4: Force out at 2nd, 2B-SS. Batter safe. Runner on 2nd advances. GX5: Force out at 3rd, 38-u. Batter safe. Runner on 1st advances. GX6: Force out at 2nd, SS-2B. Batter safe. Runner on 2nd advances. G1A: Ground out, P-1B. Runners advance.
G2A: Ground out, C - 1B. Runners advance.
G3A: Ground out, 18- u. Runners advance.
G4A: Ground out, 213 - 1B. Runners advance.
G5A: Ground out, 38- 1B. Runners advance.
G6A: Ground out, SS - 1B. Runners advance.
G3-1A: Ground out, 18- P. Runners advance. F7: Fly out LF. See Tagging Up From Second on OF Fly F8: Fly out CF. See Tagging Up From Second on OF Fly F9: Fly out RF. See Tagging Up From Second on OF Fly FD7: Fly out deep LF. See Tagging Up From Second on OF Fly FD8: Fly out deep CF. See Tagging Up From Second on OF Fly FD9: Fly out deep RF. See Tagging Up From Second on OF Fly L1:
Line out P. Runners hold. CD-4 at P doubles runner off 1st. L3: Line out 18. Runners hold. L4: Line out 28. Runners hold. LS:
Line out 38. Runners hold. L6:
Line out SS. Runners hold. CD-4 at SS doubles runner off 1st. Fl:
Pop out P. Runners hold. F2: Pop out C. Runners hold.
F3: Pop out 18. Runners hold. F4: Pop out 28. Runners hold. F5: Pop out 3B. Runners hold. F6: Pop out SS. Runners hold.
ERROR SEQUENCE
Error 1: Fielder can't control ball. Batter safe. Runners advance.
Error 2: Wild throw. Batter to 2nd, runners advance 2 bases.
Error 3: Muffed grounder. Batter safe. Runners advance.
Error 4: Outfielder over runs ball. Batter gets extra base. Runners score.
Error 5: No error. Ignore.
Updated January 5, 2016
MAN ON FIRST AND THIRD OUT CHART
G1: INFIELD IN: Runner on 3rd out P - C. Runner to second. Batter safe
G4A: IN: Single thru the infield. Runners advance two bases. INFIELD BACK: Double play P - SS - 1B. Runner scores. BACK: Batter out 2B-1B. Runners advance one base.
G2: IN: Batter out C-1B. Runner on 1st to 2nd. Runner on 3rd holds. GSA: IN: Single thru the infield. Runners advance two bases. BACK: Batter out C-1B. Runner on 1st to 2nd. Runner on 3rd holds. BACK: Batter out 3B-1B. Runners advance one base.
G3: IN: Consult DEFENSE OPTION CHART
G6A: IN: Single thru the infield. Runners advance two bases. BACK: Double play 1B-SS-1B. OBR-A safe at 1st. Runner scores. BACK: Batter out 55-1B, Runners advance one base.
G4: IN: Batter out 2B-1B. Runner on 1st to 2nd. Runner on 3rd holds. G3-1A: Ground out 1B - P. Runners advance one base. BACK: Double play 2B-SS-1B. Runner on 3rd scores.
F7:
Fly out LF. See Tagging Up From Third on OF Fly G5: IN: Batter out 3B-1B. Runner on 1st to 2nd. Runner on 3rd holds. F8:
Fly out CF. See Tagging Up From Third on OF Fly
BACK: Double play 3B-2B-1B. Runner on 3rd scores. F9:
Fly out RF. See Tagging Up From Third on OF Fly
G6: IN: Batter out SS-1B. Runner on 1st to 2nd. Runner on 3rd holds. FD7: Fly out deep LF.See Tagging Up From Third on OF Fly BACK: Double play SS-2B-1B. Runner on 3rd scores. FD8: Fly out deep CF. See Tagging Up From Third on OF Fly
FD9: Fly out deep RF. See Tagging Up From Third on OF Fly GX1: IN: Batter out P-1B. Runner on 1st to 2nd. Runner on 3rd holds.
BACK: Batter safe. Runner at 1st forced at 2nd C-SS. Runner on 3rd scores. L1:
Line out P. Runners hold. L3: Line out 1B. Runners hold. CD-4 at 1B doubles off runner on 1st.
GX2: IN: Runner on 3rd in rundown C-3B-C. Runner on 1st to 3rd. Batter to 2nd. L4:
Line out 2B. Runners hold. BACK: Batter safe. Runner forced at second C-SS. Runner on 3rd scores. L5:
Line out 3B. Runners hold.
L6:
Line out SS. Runners hold. GX3: IN: Batter out 1B - u. Runner on 1st to 2nd. Runner on 3rd holds.
BACK: Batter safe. Batter forced at 2nd 1B-SS. Runner on 3rd scores. Fl:
Pop out P. Runner hold. F2: Foul pop up near stands. CD-3 or 4 makes great catch for out.
GX4: IN: Runner out at home 2B-C. Batter safe. Runner on 1st to 2nd. F3:
Foul pop out 1B. Runners hold. BACK: Batter safe. Runner on 1st forced at 2nd 2B-u. Runner on 3rd scores. F4:
Pop out 2B. Runners hold.
F5:
Pop out 3B. Runners hold. GX5: IN: Batter out 3B-1B. Runner on 1st to 2nd. Runner on 3rd holds. F6:
Pop out SS. Runners hold.
BACK: Batter safe. Runner at 1st forced at 2nd 3B-2B. Runner on 3rd scores. ERROR SEQUENCE
GX6: IN: Batter out SS-1B. Runner on 1st to 2nd. Runner on 3rd holds. Error 1: Misplayed. Batter safe. Runners advance one base. BACK: Batter safe. Runner at 1st forced SS-2B. Runner on 3rd scores. Error 2: Wild throw. Batter to 2nd. Runners score except
OBR-D or E runner on first stops at third. G1A: IN: Batter out P-1B. Runner on 1st to 2nd. Runner on 3rd scores. Error 3: Booted grounder. Batter safe. Runner on 1st to 2nd.
BACK: Batter out P-1B. Runner on 1st to 2nd. Runner on 3rd scores. Runner on 3rd scores IF two outs. Error 4: Outfielder kicks ball. Batter and base runners advance
G2A: IN: Batter out C-1B. Runner on 1st to 2nd. Runner on 3rd holds. one extra base. BACK: Batter out C-1B. Runner on 1st to 2nd. Runner on 3rd scores. Error 5: Outfielder relays wildly. Batter holds base hit to. Runners
advance one extra base. G3A: IN: Single thru the infield. Runners advance two bases.
BACK: Batter out 1B-u. Runners advance one base.
UNUSUAL PLAYS (Z CHART)
11: Catcher argues balls and strikes. Ejected from game. 12: Pitcher argues balls and strikes. Ejected from game. 13: Batter argues balls and strikes. Ejected from game. 14: Batter hits slow roller to 1st. Pitcher covers, but batter is
rules safe. Argument results and first baseman ejected. 15: Batter hits long fly ball, ruled foul. Batter argues and is ejected. 16: Pitcher is doctoring the ball. Ejected from this game. 17: On a full count, pitcher goes to mouth. Called ball four. 18: Batter called out for using illegal bat. Catcher gets putout 21: Skies open and Biblical rain begins. Game called. 22: Storm warnings issued and game halted for fan safety. 23: April Only: Game called because of cold. 24-25: April Only: Spring showers. Game called. 26: Rain delay. Draw new RN for minutes of delay.
If over 28, each pitcher PB is reduced by ONE. 27: Applies with at least a runner at 1st, if no runner at 1st, draw new PB.
If less than two outs, the batter hits a bloop single to RF but passes the runner. The batter is out first unassisted and all runners advance one base. If two outs, play as a bloop double to RF.
28: Batter swings at 2 strike pitch. Catcher misses ball and batter safe at first. Runners advance one base.
31: Batter doubles down RF line, but misses first base. OUT on appeal. Runners score if not third out. If 3rd out, inning over.
32: ONLY WHEN MAN ON FIRST: Runner steals second. SS argues call and is ejected.
33: ONLY WHEN MAN ON FIRST: Runner out stealing second. Argues call and is ejected.
34: ONLY WHEN MAN ON FIRST: Runner caught off first and out 1-3-4-3. Any runner on 3rd scores.
35: ONLY WHEN MAN ON FIRST: Runner picked off and out P-1B. Any runners on 2nd or 3rd advance one base.
36: ONLY WHEN THIRD OCCUPIED: Runner picked off base, C-3B-C. Other runners hold.
37: Catcher drops third strike. Batter safe at first, runners advance but man on 3rd holds unless forced ahead.
38: Batter singles to RF and runners advance two bases. Batter turns wrong way and is picked off base, RF - 1B.
41: Batter checks swing, but hits slow roller to first, but runs into ball. Called out. Putout to catcher. Runners hold except man on 1st.
42: ONLY WHEN FIRST AND SECOND: Ground ball hits runner on first. Batter gets single, runner called out. Runner on second holds.
43: Catcher interference. Batter to first, runners advance. Error on C. 44: Fan interference on foul into stands. Batter out. Runners
hold. Putout to SS. 45-78: CONSULT Z FIELDING CHART 81-88: CONSULT Z INJURY CHART
Updated January 5, 2016
MAN ON SECOND AND THIRD OUT CHART Z FIELDING CHART
G1: INFIELD IN: Batter out P-1B. Runners hold. G4A: IN: Single thru the infield. Runners advance two bases. This chart is used when referred to from Z chart. Obtain a
G2:
INFIELD BACK: Batter out P-1B. Runners hold.
IN: Batter out C-1B. Runners hold.
BACK: Batter out 2B-16. Runners advance one base.
GSA: IN: Batter out 3B-1B. Runners hold.
new random number and apply below. NOTE: 11-34 are
used ONLY WHEN A RUNNER IS ON FIRST BASE. If 1st not
BACK: Batter out C-1B. Runners hold. BACK: Batter out 3B-1B. Runners advance one base. occupied, ignore and play on.
G3: IN: Consult DEFENSE OPTION CHART G6A: IN: Single thru the infield. Runners advance two bases.
BACK: Batter out 1B-u. OBR-A, B or C on 3rd scores. BACK: Batter out 55-1B. Runners advance one base. 11-14: Grounder to first. If 1B is CD-3 or 4, double play 1B-SS-1B.
If 1B is CD-1 or 2, batter out 1B - u. Runner advances G4: IN: Consult DEFENSE OPTION CHART G3-1A: Ground out 1B - P. Runners advance one base. 15-18: Grounder to second. If 2B is CD-3 or 4, double play 2B-SS-1B.
BACK: Batter out 2B-1B. OBR-A, B or C on 3rd scores. If 2B is CD-1 or 2, batter out 2B-1B. Runner advances. F7: Fly out LF. See Tagging Up From Third on OF Fly 21-24: Grounder to short. If SS is CD-3 or 4, double play SS-2B-1B.
G5: IN: Consult DEFENSE OPTION CHART F8: Fly out CF. See Tagging Up From Third on OF Fly If SS is CD-1 or 2, batter out 55-1B. Runner advances. BACK: Batter out 3B-1B. OBR-A on 3rd scores. F9: Fly out RF. See Tagging Up From Third on OF Fly 25-28: Grounder to third. If 3B is CD-3 or 4, double play 3B-2B-1B.
If 3B is CD-1 or 2, batter out 3B-1B. Runner advances. G6: IN: Consult DEFENSE OPTION CHART FD7: Fly out deep LF. See Tagging Up From Third on OF Fly 31-34: Grounder to pitcher. If P is CD-3 or 4, double play P-SS-1B.
BACK: Batter out 55-1B. OBR-A, B or C on 3rd scores. FD8: Fly out deep CF. See Tagging Up From Third on OF Fly If P is CD-1 or 2, batter out P-1B. Runner advances. FD9: Fly out deep RF. See Tagging Up From Third on OF Fly
GX1: IN: Batter out P-1B. Runners hold. BELOW APPLY IN ANY BASE SITUATION:
BACK: Batter out P-1B. Runners hold. L1: Line out P. Runners hold. 35-38: Difficult grounder to first. CD-3 or 4, batter out, runners adv. L3: Line out 1B. Runners hold. If CD-1 or 2, infield single. Runners advance one base.
GX2: IN: Batter out C-1B. Runners hold. L4: Line out 2B. Runners hold. 41-44: Difficult grounder to second. CD-3 or 4, batter out, runners BACK: Batter out C-1B. Runners hold. L5: Line out 3B. Runners hold. advance. If CD-1 or 2, infield single. Runners adv. one base.
L6: Line out SS. Runners hold. 45-48: Difficult grounder to short. CD-3 or 4, batter out, runners GX3: IN: Batter out 1B-u. Runners hold. advance. If CD-1 or 2, infield single. Runners adv. one base.
BACK: Batter out 1B-u. OBR-A, B or Con 3rd scores.; A or B on 2nd advances Fl: Foul pop out P. Runners hold. F2: Foul pop up C. Runners hold.
51-54: Difficult grounder to third. CD-3 or 4, batter out, runners
advance. If CD-1 or 2, infield single. Runners adv. one base. GX4: IN: Batter out 2B-1B. Runners hold. F3: Pop out 1B. Runners hold.
BACK: Batter out 2B-1B. OBR-A, B or Con 3rd scores; A or B on 2nd advances F4: Fly out 2B near RF line. OBR-A on 3rd scores.
F5: Pop out 3B. Runners hold.
55-63 Difficult fly to left. CD-3 or 4, batter out, runners
hold. CD-1 or 2, double to LF, all runners score GX5: IN: Batter out 3B-1B. Runners hold. F6: Pop out SS. Runners hold. 64-74: Difficult fly to center. CD-3 or 4, batter out, runners hold. If
BACK: Batter out 3B-1B. OBR A or B on 3rd scores CD-1 or 2, double off CF wall. All runners score. ERROR SEQUENCE 75-83: Difficult fly to right. CD-3 or 4, batter out, runner on 3rd
GX6: IN: Batter out 55-1B. Runners hold. Error 1: Booted ground ball. Batter safe. Runners advance one scores. If CD-1 or 2, double to RF, all runners score. BACK: Batter out 55-1B. Runner on 3rd scores. Runner on 2nd holds. base.
Error 2: Wild throw. Batter to 2nd and both runners score. 84-87: Difficult pop foul to catcher. CD-3 or 4 makes catch, runners
hold. CD-1 or 2 ball drops into seats. Batter still up. G1A: IN: Batter out P-1B. OBR-A on 3rd scores. Error 3: Booted grounder. Batter safe. Runners advance one 88: TRIPLE PLAY
BACK: Batter out P-1B. OBR-A on 3rd scores. base if two out Men on 1st & 2nd: Line drive to SS, to 2B and to 1B. Error 4: Ball goes to wall. Batter and runners score. Men on 1st & 3rd: Line drive to 3B, steps on bag and to 1B.
G2A: IN: Batter out C-1B. Runners hold. Error 5: Ignore. No error. Men on 2nd & 3rd: Line drive to 2B, steps on bag and to 1B. BACK: Batter out C-16. Runners hold. Loaded: Liner to P, who throws to 3B and to 1B.
IF LESS THAN TWO MEN ON WHEN TRIPLE PLAY:
G3A: IN: Batter out 1B-u. OBR-A on 3rd scores.
BACK: Batter out 1B-u. Runners advance one base.
Score as line out 1B, runners hold except runner on 1st
is doubled off.
Updated January 5, 2016
BASES LOADED OUT CHART
G1: INFIELD IN: Runner on 3rd out at home, P-C. Batter safe. Other runners adv.
INFIELD BACK: Runner on 3rd out at home, P-C. Batter safe. Other runrs. adv.
G2: IN: Runner on 3rd out at home, C-u. Batter safe. Other runners advance. BACK: Double play C-1B. Other runners advance.
G3: IN: Runner on 3rd out at home, 1B-C. Batter safe. Runners
advance. OBR-E batter is doubled at 1st, 1B-C-1B. BACK: Runner on 3rd out at home, 1B-C. Batter safe. Other
runners advance.
G4: IN: Runner on 3rd out at home, 2B-C. Batter safe. Other runners advance. BACK: Double play 2B-SS-1B. Runners on 2nd & 3rd advance.
G5: IN: Runner on 3rd out at home, 3B-C. Batter safe. Other runners advance.
BACK: Double play 3B-2B-1B. Runners on 2nd & 3rd advance.
G6: IN: Runner on 3rd out at home, SS-C. Batter safe. Other runners advance.
BACK: Double play SS-2B-1B. Runners on 2nd & 3rd advance.
GX1: Double play P-C-1B. Other runners advance.
GX2: Double play C-1B. Other runners advance.
GX3: IN: Runner on 3rd out at home, 1B-C. Batter safe. Runners advance.
BACK: Batter out at first 1B-u. Other runners advance.
GX4: IN: Runner on 3rd out at home, 2B-C. Batter safe. Other runners advance.
BACK: Force out at 2nd, 2B-SS. Batter safe. Runners on 2nd & 3rd advance.
GX5: IN: Runner on 3rd out at home, 3B-C. Batter safe. Other runners advance.
BACK: Force out at 2nd, 3B-2B. Batter safe. Runners on 2nd & 3rd advance.
GX6: IN: Runner on 3rd out at home, SS-C. Batter safe. Other runners advance. BACK: Double play SS-3B-1B. Runners on 1st and 3rd advance.
G1A: Runner on 3rd out at home P-C. Batter safe and other runners
advance. If catcher is CD-3 or 4, batter out at 1st. Double play. P-
C-1B.
G2A: Batter out C-1B. Runners advance.
G3A: IN: Single thru infield. Runners advance one base.
BACK: Batter out at first 1B-u. Other runners advance.
G4A: IN: Single thru infield. Runners advance one base.
BACK: Batter out 2B-1B. Runners advance.
GSA: IN: Single down LF line, all runners score. Batter stops at 1st.
BACK: Batter out 3B-1B. Runners advance.
G6A: IN: Single thru the infield. Runners advance two bases. BACK: Batter out 55-1B. Runners advance.
G3-1A: Batter out at 1st 1B-P. Runners advance.
F7: Fly out to LF. See Tagging Up From Third on OF Fly F8: Fly out to CF. See Tagging Up From Third on OF Fly F9: Fly out to RF. See Tagging Up From Third on OF Fly
FD7: Fly out deep LF. See Tagging Up From Third on OF Fly FD8: Fly out deep CF. See Tagging Up From Third on OF Fly FD9: Fly out deep RF. See Tagging Up From Third on OF Fly
L1:
Line out P. Runners hold. CD-4 pitcher also doubles runner off 3rd. L3: Line out 1B. Runners hold. L4: Line out 2B. Runners hold.
L5: Line out 3B. Runners hold. L6: Line out SS. Runners hold.
Fl:
Pop out P. Runners hold.
F2: Pop out C. Runners hold.
F3: Pop out 1B. Runners hold.
F4: Pop out 2B. Runners hold. F5: Pop out 3B. Runners hold.
F6: Pop out SS. Runners hold.
ERROR SEQUENCE Error 1: Fielder bobbles ball. Batter safe and runners advance one
base. If two outs, OBR-A or B on 2nd also scores. Error 2: Wild throw. Batter to 2nd and runners advance two
bases. If two outs, OBR-A or B on 1st also scores. Error 3: Fielder cannot get ball out of glove. Batter safe. Runners
advance one base. Error 4: Ignore. No error.
Error 5: Hit gets thru fielder, to wall. Runners and batter score. If
OF is CD-3 or 4 he makes proper play and runners
advance 1 for single, 2 for double and 3 for triple.
Updated January 5, 2016