find arabidopsis protein homologs
DESCRIPTION
Mimulus unigenes. ESTs. Find Arabidopsis protein homologs. Arabidopsis proteins. Align Mimulus unigenes to Arabidopsis proteins (ESTWISE). Align Mimulus contig with Arabidopsis protein (ESTWISE). Arabidopsis gene models. Calculate intron positions/phases in - PowerPoint PPT PresentationTRANSCRIPT
Find Arabidopsis protein homologs
Align Mimulus contig with Arabidopsis protein (ESTWISE)
Calculate intron positions/phases in Arabidopsis proteins
Find corresponding positions in Mimulus
unigenes
Design primers spanning introns in Mimulus unigenes (Primer3)
Mimulus unigenes
Arabidopsisgene models
Arabidopsis proteins
ESTs
Geneticallymap
Align Mimulus unigenesto Arabidopsis
proteins (ESTWISE)
Physically map
(hybridizeto BACs)
Design overgos within exons
Design SNP assayfrom sequenced alleles
At5g24550 27 FSTTPLNRYSFPPHFDFGVASSAYQYEGAVEEGGRSPSIWDNFTHAFPE + + P NR FPP F FG ASSAYQ+EGA EGG+ PSIWD +TH FPE YESKPFNRTDFPPGFLFGAASSAYQFEGAAFEGGKGPSIWDTYTHQFPE MgUnigene 90 tgtactacagtccgtctgggttgtctggggtgggagcaatgatacctcg aacactagcatccgtttgcccccaatagcctaggagcgtgacacaatca taggtccctttatttttattttttatattatatgaatttgttctcataa
At5g24550 76 R-TNMDNGDVAVDFYHRYKDDIKLIKEMNMDSFRFSLSWSRILPSGKLS + + NGDVA DFYH YKDD+KL+K++ +D FR S++WSR+LP GKLS KIADRSNGDVANDFYHLYKDDVKLLKDLGLDVFRMSIAWSRVLPHGKLS MgUnigene 237 aaggcaaggggagttcctagggatcagtgcggtcatagttcgtccgaca atcaggagatcaataataaaatattaatgtattgtctcgcgttcagatg gattacctcgtcctttgtgttgagggtaagttcggcttgatagataaat
At5g24550 124 DGVNKEGVQFYKNLIDELIKNGIKPFVTIYHWDIPQALDDEYGSFLSPR GVNKEG+ FY N+I+EL+ NGI PFVT++ WD+PQAL+DEY FLSP RGVNKEGIAFYNNVINELLANGITPFVTLFLWDLPQALEDEYRGFLSPL MgUnigene 384 aggaaggagttaagaagccgagaactgactctgcccgcgggtagtcacc ggtaaagtctaaattaattcagtccttctttgatcactaaaaggttgct aagcaagtctccttctactataaaatgaattgcctaaagtataccatta
At5g24550 173 IIDDFRNFARFCFQEFGDKVSMWTTFNEPYVYSVSGYDAG---NKAIGR I+DD+ +F +CF+ FGD+V W TFNEP+V++ GYD G A GR IVDDYLDFVELCFKNFGDRVKNWITFNEPFVFTNGGYDGGFLGTLAxGR CONTIG5 531 agggtcgtggcttaatggcgaataatagctgtaaggtgggtcgacgcgc ttaaatattatgtaatgagtaagtctaactttcaggaaggttgctcNgg tgcttgtcgatctgtcatttgtgcaccggcgcatgcctgaccgtacctg
At5g24550 219 CSKWVN CS W N CSSWxN MgUnigene 678 ttttNa gccgga cgggct
Marker yield per EST
www.mimulusevolution.org
Duke Univ.John Willis
Fred Dietrich
Univ. of Washington Toby Bradshaw
CUGI Jeffery Tomkins
UNC Chapel HillTodd Vision
Michigan State Univ. Doug Schemske
Univ. of MontanaLila Fishman
Frontiers in Biological Research:
Integrated Ecological and Genomic Analysis of
Speciation in Mimulus
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.
QuickTime™ and aTIFF (Uncompressed) decompressor
are needed to see this picture.