ask the expert fall/winter 2011
DESCRIPTION
Ask the Expert Fall/Winter 2011TRANSCRIPT
The Fall/Winter 2011 Ask the Expert publication is an advertising supplement of:
Learn More From Those Who Have the Answers...
All in Our Local Community!
. . . . . . . . . . . . . .How to
Colonial SouthinSuranCe
Colonial SouthinSuranCe
55 Mathews Drive, Suite 205Hilton Head Island, SC 29926
ColonialSouthInsurance.com
“ I called Cheri Borghi at Colonial South
Insurance for an auto insurance quote.
I was very impressed with her prompt
service. She called me back the same day
and saved me over $1000.”
— Pam Bautista - Hilton Head Island.
“ I called Colonial South Insurance and found Cheri to be very professional and informative. I now have a better understanding of my policies.”— Doreen Shaw- Hilton Head Island
Greg, I wanted to thank you for finding
me such a great deal on my insurance.
Not only did you save me money on my
home and automobiles, the policies are with
good reputable companies.
— Karl Sneed — Hilton Head Island
Call Us Today!• Homeowner• Auto• Wind and Hail• Flood• Life and Health
Greg CastnerCheri Borghi
Annamarie Keen
. . . . . . . . . . . . . .How toTable of Contents:Table of Contents:
How to select the best golf cart byCoastalCustomCarts..............Pg.5How to choose a carpet cleaner byEvergreenNatural.....................Pg.6How to successfully rent your home byEquitableProperty
Management...................................Pg.7How to pair wine with food byVineyard55...............................Pg.8How to choose an auto repair center byTurn1AutoCare......................Pg.9How to market your business byTidbitsofHHBB.....................Pg.10How to find a good salon byJocelyn’sNexxFaze
Salon&Spa...................................Pg.11How to know when to choose an architect byJamesOgdenArchitect..........Pg.12How to hire an audio/visual professional byAmbrosicHomeTheater
Designs,LLC................................Pg.13How to eliminate cancer from your body naturally byCircleofHealth.......................Pg.14
How to choose a Gullah restaurant byKinfolksGullahGrubs&
SeafoodRestaurant......................Pg.15How to gauge the future of real estate byTheAllianceGroupRealty.....Pg.16How to choose an appliance repair service byWilliamsApplianceRepair....Pg.17How to choose an in-home health care provider byComforcareSeniorServices..Pg.18How to save money on telecommunications services bySchooleyMitchell..................Pg.19How to generate more leads... and more sales! byE.G.PerformanceSolutions..Pg.20How to choose a great gift byScentsy.....................................Pg.21How to choose a wedding planner byLisaKenwardEvents..............Pg.22
Ask the Expert is a supplement by KPA Office Outsource, LLC, publishing company of Tidbits of Hilton Head, Bluffton and Beaufort,
P.O. Box 4858, Hilton Head Island, SC 29938
For more than 165 years, New York Life has brought peace of mind to millions of Americans. We would like to do the same for you in retirement. Guaranteed Lifetime Income Annuities from New York Life Insurance and Annuity Corporation offer a promise of a regular paycheck for the rest of your life. For more information about our products and services, contact me:
Mike TripkaAgentNew York Life Insurance Company142 Pinecrest Circle, Bluffton, SC P. 843.540.9022 F. [email protected]
Guaranteed Lifetime Income refers to annuity contracts issued by New York Life Insurance and Annuity Corporation (A Delaware Corporation), a wholly-owned subsidiary of New York Life Insurance Company. The guarantee is backed by the claims-paying ability of the issue.
c 2011 New York Life Insurance Company, 51 Madison Avenue, New York, NY 10010
In most jurisdictions the policy form numbers for the Lifetime Income Annuity are: Life Only: 203-169, Primary and Secondary Joint Life Annuity: 203-170, Life w Percent of Premium Death Benefit: 203-171, Life w Cash Refund: 203-172, Life w Guaranteed Period: 203-173, Primary and Secondary Joint Life Annuity w
Guaranteed Period: 203-174. State variants may apply.SMRU00398966CV (Exp. 02/01/13)
A of a never paycheckfor all .
Pyour retirement days
end ngrom se - ii
ONLY YAMAHA OFFERS THE FOLLOWING IMPORTANT EXCLUSIVE FEATURES:
• MARINEGRADEELECTRONICSareimpervioustohumidityandmoisture,helpingtoensuretheextra-longlifeofallelectroniccomponents.ThisisafeatureexclusivetoYamaha!
• Yamaha’sexclusiveTRU-TRACKSUSPENSIONSYSTEMprovidesforsuperior,saferhandlingandthemostcomfortablerideofanycartmade.
• Yamaha’sexclusiveHALOGENHEADLIGHTSprovideforgreaterdrivervisibility,verysimilartotheheadlightsonyourautomobile.Thisisunmatchedbyanyotherbrandofgolfcart.
• The HEAVY DUTY PARTS in the SUSPENSION, STEERING, TRANSAXLE, andFRAMEmeantheYamahagolfcartwillstillbeprovidingdailytrouble-freeuselongaftertheotherbrandsofcartsarenolongerinuse.ThisisexclusivetoYamaha!
• TheYamahaFRAMEisthestrongestofanygolfcartmade.Theframeispowder-coated,whichprevents it fromrustpermanently.Hereagain, the researchanddevelopmentfromYamaha’sMarineDivisionprovidesthetechnologyforthisveryvaluablebenefittotheowner.
TheseareonlyafewoftheexclusivefeaturesfoundoneveryYamahaGolfCart!By:
MargieDonley,OwnerofCoastalCustomCartsLaurieReiners,CertifiedGolfCartSpecialistTonyBernardo,ShowroomAssociate
How to select the best golf cart
Carpet, Upholstery, Tile & House Cleaning
Serving the Low Country from Hilton Head, to Sun City and BeyondHomes, Condos, Apartments,
Businesses, RV’s
“Do it Natural or Don’t Do it At All.”
People friendly, pet-friendly, child friendly. Environmentally safer and more efficient than
most hot water extraction cleaners.Low moisture cleaning prevents the breeding ground for dust mites and mold. Our purpose is to provide you with a safe, effective way to clean your carpet using environmentally friendly products. Your
carpet will look cleaner, smell fresher and dry in 45 minutes or less while improving your indoor air quality of your home or business. A natural way to clean carpets using a combination of natural products with very little moisture involved (VLM).
Jim Collard • Owner843-715-0886 office • 843-415-6336 cell • [email protected] • www.evergreennatural.net
Member LMCCALicensed, Insured
IICRCCertified
INSTITUTEof
INSPECTIONCLEANING
and RESTORATION
®CERTIFICATION
10% OFF NEW CUSTOMERSWith Ad. TBofHHBB.
Call For Free Estimate & Further InformationReferences Available
Do you like the smell and feel of freshly cleaned carpet on your bare feet but hate the waiting time from when it was completed to when you can walk on it? How often do you have guests arriving in two hours and all of a sudden realize you should have cleaned your carpets and now are on your hands and knees spot cleaning? Do you wish you could get your carpets cleaned more often but worry about health hazards due to the chemicals used? Evergreen Natural provides a healthy, safe alternative using a dry carpet cleaning process.
Q: What is dry carpet cleaning and do you use dry cleaning
chemicals?
A:We actually use a process calledVLM (very low moisture) and
anorganiccompoundwhichismachinebrushed into the carpet and extractedusingthesamemachine.Itisthedryingtimethatisimportant.Wecanhaveyourcarpetdryinlessthan45minutes.We do not use dry cleaning chemicals.The chemical used in the process isbio-degradable, neutral ph safe, nontoxic, people friendly, pet friendly andenvironmentallysafe.
Q: I have been having my carpets steam cleaned for years. Why
should I change?
A:That is a good question. First,did you know that your carpet
will remain wet for six (6) hours ormore and that some chemicals, soapsandsurfactantswillremaininthecarpetwhich encourage re-soiling. Secondly,manycarpetcleaningcompaniesmarkettheirservicesassteamcleaningwhilenosteamisinvolvedatall.Youmayseesomewatervapor,butwater temperaturesarefar below what would be classified assteam. After the dry out period, manyspots and traffic areas appear soiledagain.Thisiscalledwicking.Our VLM process prevents wicking
as well as the breeding ground for dustmites and mold. It also helps improveindoorairqualityandprovidesnoticeableimprovementinsmokyroomsorroomswithpooraircirculation.A process that is safe with minimalinconvenience, no sticky residue, quickdrying and smells fresh = One HappyCustomer.
How to choose a carpet cleaner
Q: Why do I need a professional property management company?
A:Propertymanagementcompanieslike Equitable are essential in
order to maximize your revenue andminimizeyourexpenses.Theselectionof a qualified tenant is an involvedprocessthatshouldincludebackgroundand reference checks, and that’s onlythebeginning.Onceatenantissecuredand a lease is signed, all issues thatariseneedtobehandledexpeditiouslyand professionally. Additionally, theSouthCarolinaResidentialLandlord-TenantActmustbecarefullyadheredto.Individualswhomanagetheirownpropertyandhave limitedexperiencewith this law risk exposure to legalramifications.
Q: How will I know that my property is being cared for if I
choose Equitable?
A: Wecareforyourpropertyasifitwereourown.Weguarantee
that on-site inspections of yourproperty at move-in, during tenancy,and at move-out will contribute tomaintaining its integrity. We selectvendorsthatareheldtothehighestofstandardsinpartneringwithustocarefor your home. In addition, werecognizeefficiency,costeffectiveness,and continuous communication ascrucial elements in exceeding theexpectations of owners and tenants.Ourphilosophyis“ifwetakegreatcareofourtenants,theywilltakeexcellentcareofyourproperty.”
Q: Why should I choose Equitable over another company?
A: EquitablePropertyManagement,LLC is a successful property
management company licensed in thestateofSouthCarolina..Foundedin2003with only three clients, we now manageover 160 investment properties. Oursterlingreputationprecedesus.Withoneofthelowestfeestructuresintheareaandno “nickeling and diming,” we providetrue partnership, protecting you frompotential pitfalls that can occur in therental process. The right property man-agementcompanycanguideyouthroughthe rental processes seamlessly. Fromchoosingtherighttenanttoprotectingtheintegrityofyourproperty,youcan’tputapricetagonpeaceofmind.
How to successfully rent your home
Our company name, EQUITABLE, is the driving force behind our company’s culture. Equitable is defined as “fair to all parties as dictated by reason and conscience.” My team and I take great pride in our commitment to this philosophy along with our dedication to exceptional communication and personal attention. Let us show you the true meaning of property management. We look forward to partnering with you. — Geri Colucci ~ Principal/Property Manager-in-Charge
Wine, Beer, Cheese, and Tapas from around the World!Bluffton’s first and only growler station.
Nightly Specials:Monday Captains Night: Starting at 4pm till close. Half off drinks and
appetizers for anybody with a boat!Tuesday Retail Night: 15% off bottles of wine and no in-house corkage
fees. Specialty wine and food pairings.Wednesday Ladies Night: 15% off drinks and appetizers, and no in-house
corkage fees for ladies from 4pm until close. Live music featuring Ken Kolbe 6pm-9pm.
Thursday Farmers Market: Happy hour starting at 4pm–7pm. Specialty wine tasting 2pm-5pm.
Friday Night: Happy hour starting at 4pm-7pm. Live music from 8 till 11pm with Alan Stockard.
Saturday Night: Happy hour starting at 4pm–7pm. Live music featuring Harry Santana 8pm–11pm.
55 Calhoun StreetBluffton, SC 29910
843-757-9463(WINE)
vineyard55.com
Hours:Monday 4 p.m. till CloseTuesday 4 p.m. till Close
Wednesday through Saturday
11 a.m. till Close
How to pair wine with food
Q: I’ve heard that drinking wine, especially red wine, is good for
me. Is this true?
A:My degree is in Health andFitness so I feel obligated to
answerthisquestionfirst.Wineisfullofhealthy compounds that range fromtanninsandpolyphenolstoalcoholandthat so-called magic bullet: resveratrol.Studies Show that moderate wineconsumption,that’saglassortwoadaycan lower the risk of heart attack formiddle-aged people by some 30% to50%.Redwinehasalsobeenknowntoraise your good cholesterol whileloweringthebad.Someofthesebenefitsareattributedtotheresveratrolfoundinwine. Wines with the highest levels ofresveratrol include Tannat and PinotNoir, especially Pinot Noir grown incoolerclimates.Itseemsthatresveratrol,muchlikeacid,caneasilybecookedoutofgrapes.Goodnewsforthoseloversof
Oregon, Austrian, and German PinotNoir!
Q: Can you tell us some of the basics when it comes to pairing
wines with food?
A: In my experience as a winedrinkeryoudon’talwayshaveto
stickwiththeruleofthumbthatweallknowwhichis,redwinewithsteakandwhite wine with seafood. Everyone’spallets are differentand we all seem todrink the wine varietal we enjoy themost no matter what we are having. Ibelieveoneshoulddrinkwhattheylikeand not feel they have to drink a winejust based on what they are having toeat. Don’t get me wrong, there aredefinitely wines that when paired withfoodcanbringoutthetrueflavorsandenhanceyourmeal.Iammerelysayingdon’tbeafraidtoexploredifferentwinesorstickwithyourfavorite.
ButtoansweryourquestionIwouldliketo focus on cheese and wine pairingssincetheduoarewhatwespecializeinatVineyard 55. We are coming into theseason of parties and entertaining so Iwillsharethreethingswithyouandtwoof them are rules of thumb to besuccessful at hosting any get together.Thefirstthinginpairingwineandcheeseissticktoregions,suchasyoucanpairadelicious chevre from France with abottle of French Champagne from theChampagne region of France. Secondruleofthumbistopairredwineswithhardcheesesandwhitewineswithsoftcheeses.ThethirdthingIhaveforyouisdon’tbeafraidtobreaktherules.Aslongas you are surrounded by family andfriends, eat and drink what YOU likeandotherswillenjoythemaswell.Cheers,Joey RinaldiManager Vineyard 55
21C Kittie’s Landing Road, Bluffton(843) 815-AUTO
FOR FRIENDLYSERVICE & GREAT PRICES
Ford Factory TrainedDomestc & Foreign CarsFleet DiscountsFamily Friendly Waiting Room
Oil ChangesElectricalScheduled MaintenanceOverhauls & Repairs... And more!
Open Mon.-Fri. 8-5 • Sat. 8-2 (Behind Montana’s)
FREE TireRotation and Brake
Inspection with An OilChange* w/Tidbits Ad
*Some exclusions apply.
THREE THINGS TO CONSIDER WHEN CHOOSING YOUR AUTO REPAIR CENTER:
REPUTATIONWhat kind of reputation does the facility you areconsideringhave?Thereputationofacompanyshouldalwaysbea factorwhenchoosingarepairshop. Wesuggest reading the company’s reviews left by pastcustomers and consider the following: Were theysatisfied?Was the staffprofessional?Andmostofalldidthevehiclegetrepairedcorrectly?
COST Intoday’seconomynoonewantstooverpayfortheirrepairs;however,findingthebestdealmaynotbethebest decision. We suggest finding a facility the willprovidereliablepartsandservicethatarebackedbyanationwidewarranty.Thelastthingyouwantistopaymorethanonceforthesamerepair.
QUALIFICATIONSIstheshopyouareconsideringqualifiedtodiagnose
andrepairtheconcernsonyourvehicles?Wesuggestlooking into the certifications the facility and itstechnicianshave.Are theyASEcertifiedand/orhavethey acquired any manufacture specific training?Youmayfindthatsomerepairfacilitiesareknowntospecialize inacertainmakeofvehicleprovidingyouwithanoptionotherthanadealership.
TESTIMONIALS:“Thank you so much for your fast and friendly service!! Reasonable and reliable what more could you ask for. Thank you again!!” — Gahagan Patterson, G & J Equipment Rental“Excellent work, timely, and at a fair price. That’s a lot to ask for in a repair shop, but Ryan Morgan and Turn 1 Auto deliver. I would highly recommend using their services.” — Todd Hoke“Turn 1 Auto Care has friendly staff and amazing customer service! Their service is great and reliable; they care about their customers and their needs. I would highly recommend them to everyone! — Tonya Chittum
How to choose an auto repair center
KPA Office Outsource, LLC • 843-368-2997 • Fax: [email protected] • www.tidbitsofhhbb.com
Find us onFacebook
GET MORE RESULTS!The Neatest Little Paper
Ever Read®
Affordable Advertising Options
How to market your business
Do you own your own business? Promoting your business is one of the most important things you can do to be successful, whether you own a salon or a restaurant franchise, and everything in between! Here are a few tips to help you get started:1. Determining Your Market PositionWhat makes your business special? Areyou the only one in town who offers aparticular product or service? Are youthemostaffordableintown?Doyouofferyearsofexperienceandexpertisethatcanbenefit your customer? Whatever it is,there is something that makes yourbusiness unique. Once you havedetermined what that factor is, you canthenpromoteyourbusinessinamannerthatwillmakeyoustandout!2. Sizing Up the CompetitionDo you know who your competition is?Now that you know what your uniquesellingpositionis,arethereotherbusinessesin town that share the same position? Ifnot, you have a corner on the market! Ifthere is, you may have to compete onanotheraspectsuchasprice.Studyingyour
competitor’s business will keep youinformedonmarketconditions,andmayaffectthedirectionyoutakeyourbusiness.Print advertising is an affordable way tostandoutamongstyourcompetitors.3. Recognizing Your Target CustomerSo you now know your position in themarketplace and have determined yourcompetition. Now it is time to establishyourtargetconsumer.Isthereaparticulardemographicsuchassexoragethatyourproduct or service resonates with?Perhapsthereisademographicthatyoucantargetinordertogrowyourbusiness.Onceyouknowwhoyouare talking to,you can then, and only then, chooseaffectivemediaoutletstoeffectivelyreachthat target. Print advertising is a greatway to reach specific demographics.Tidbits of Hilton Head, Bluffton and
Beaufort reaches both the military andlocal communities with a broadreadership from kids to senior citizensduetoouruniqueblendofcontent.Tidbits of Hilton Head, Bluffton andBeauforthasmarketingexpertswhowillhelp you determine what makes yourbusinessuniqueandpromoteitinawaythat will make you stand out. We evenofferlittleextrassuchaslogodesign,freeofcharge!Wegooutofourwaytohelplocal businesses prosper, because yoursuccess is our success. Advertising inTidbits is affordable, effective, and hasmassreach.PeopleloveTidbitssomuchtheybringithomeandshareitwiththeirfamilies,unlikearadioorTVadwhichlasts30secondsandisgoneforever.Callusandfindouthowwecanhelpmarketyourbusiness!
Jocelyn ’s Nexx FazeSalon & Spa
15%Discount onAl l Services*
Stylists and Barbers wanted. Students Welcome.
.
Gift Certificates available at www.jocelynsnexxfazesalonspa.com*Does not apply to retail merchandise. Cannot be combined with other offers.
Stylists and Barbers wanted. Students Welcome.Walk-in Customers &Ask the Expert Readers
(843) 645-4247
(843) 705-2050) 59 D Riverwalk Business Park
Bluffton/Okatie, SC
FINDING A SALONAskafriendorstrangerwhosehair
youadmire.Donotbeafraidtoask.Ifyouarelucky,theyjustmighthaveabusinesscardwithaphonenumberandaddress.
Walkintoasalon.Sitandwatchhowthe stylists are with their customers andotherco-workers.
Googledifferentsalonsinyourarea. Ask questions on products. Do the
stylists use the same products on thecustomersastheysellupfront?Howlonghave they worked and trained with theproductstheyuse?
Lookforastylistwithsimilarhairtoyours—curly,straight,fine,orthin.Theywill probably have the same issues thatyouhavewithyourhair.
Askforthepricelist.Askifthepricesarealacart,etc.Combiningserviceswillsometimessaveyoumoney.
Afteryoufindyoursalonlookfortwostylistsinthesamesalonsoyouwillnotbe lost when one stylist cannot be there
whenyouneedyourhairservice.Isthesaloncommunityfriendly?Do
they participate in local fundraisers andcharities?
GETTING THE MOST FROM YOUR NEW STYLIST.
Bringinpicturesofcuts,colorsandtypesofhair.
Listentoyourstylistontheiropinion. Ask for a quote before the service.
If you can’t afford the price, ask for anysuggestiontocutcosts.
Youareatthesalonforexpertadviceand service. Do not overwhelm yourstylist by telling him or her how to cuteachhair.
If the cut was not perfect, go backandletthestylistknowyourconcernsandreviewwhatyouwantedandletthestylistgettoknowyouandyourpersonality.Ibetyou will have a good experience. If not,thenchangetoanotherstylistinthesalonortoanothersalon.
Try to build a relationship with asalon. They might be pricey but if youarealoyalcustomer,Iknowyouwillgetbreaksonproductsandserviceswithoutaskingorproducingacoupon.
Allsalonsaredifferent.Ifyourstylistkeeps up on his or her education, theyshouldbeconfidentinallaspectsofhairstyling.
HOW MUCH SHOULD YOU TIP AND SHOULD YOU TIP THE OWNER OR MANAGER?
Typically15-20%tipisprovidedtoyourstylists.Asfortippingtheowner/manager,itusedtobethattheownercharged10to20%morethanotherstylists.Sothenyouwould not tip. But if the owner does notchargeanydifferentthentipwhatyoufeelisappropriate.Mostnewcustomerswanttheownerbecauseofthechancetheyaremoreexperiencedorsimplybecausetheydon’thavetotiptheowner.
— Yours truly, Jocelyn Corwin
How to find a good salon with the best service value and satisfaction
James Ogden, Architect, AIA, NCARBHilton Head Island, South Carolina
(843) 368-2851 • www.jamesogdenarchitect.com
James Ogden, Architect, AIA, NCARBHilton Head Island, South Carolina
(843) 368-2851 • www.jamesogdenarchitect.com
JAMES OGDENA R C H I T E C T
JAMES OGDENA R C H I T E C T
James Ogden, Architect is a boutique architectural practice that emphasizes personal
attention to our clients design goals and budget. We work closely with our client’s to understand
their dreams, desires and needs, to create a final successful architectural solution
that they will be proud of.
Visit our gallery at:www.jamesogdenarchitect.com
BEFORE
AFTERAFTER
Why do you need an Architect? The largest single investment for most people is their home — an investment that needs to be maintained, nurtured and cared for to ensure that its value and livability con-tinue to keep up with the homeowner’s expectations and the market place. The best way to do this is consult with an architect before initiating any home improvement projects or new home construction.
Architects are first and foremostproblem solvers in home and buildingdesign. They possess a unique blend ofknowledgeandskillsetscomprisingdesigntalent,buildingcodeandby-lawexpertise,thelatestbuildingproductandtechnologyinformation, and construction processoversight experience. State licensingboards require architects to constantlyupdate and enhance this knowledgeand these skill sets by completingcontinuing education courses relatingto recent building product/technologydevelopments,environmental/sustainabledesign issues and Health, Safety andWelfare.Iftheminimumannualnumberof course credits is not maintained, anarchitect’s licensure (registration) will be
revokedandhe/shecannolongerclaimtobeanarchitect.
As with the selection of anyprofessional,itisimportantforthehomeowner to verify an architect’s referencesandreputation;viewcompletedprojectsand most importantly interview thearchitect. There needs to be a meetingof the minds as it is the architect whowill guide the homeowner through thedesignprocess,preparetheconstructiondocuments, solicit bids from reputablegeneral contractors on behalf of thehomeowner,comparethosebidsandhelpthe homeowner select the best generalcontractor to undertake the project.Rememberthattheleastexpensivebidisnotnecessarilythebestbid!
The presence of the architect on siteduringconstructionwillhelpensurethattheprojectbeingbuiltforthehomeownerby the general contractor is consistentwith the construction documents. Thearchitectisalsoaresourceforthegeneralcontractor to aid in understanding allelementsofthedesignandconstructiondocuments.
At its best, home construction/renovationisateamsportwiththeclientas team owner, the architect as coachand the general contractor as captain.All team owners know that to build awinning team, the first selection is thecoach.Inthecaseofhomeimprovementprojectsornewhomeconstruction,thisisanarchitect.
How to know when to choose an architect
Combining the latest technology with our customer-focused approach.Combining the latest technology with our customer-focused approach.
How to hire an audio/visual professional
HElPful tiPs oN sEEkiNg AND WorkiNg WitH AN ElEctroNics iNstAllAtioN comPANyThere is nothing complicated about connecting a DVD player to a tV. Nor is there anything difficult about hanging a flat panel tV on a wall. With the help of a manual, some people might even be able to program a universal remote control to operate the system they just installed. But, before you get started, you might ask yourself, “Are you going to install and hook up all your new electronic equipment yourself?” if it’s a basic entertainment system, you might just be able to manage. Anything more complicated such as a quality home theater system, whole house audio or automated control system then you might be best to leave the job to a trained professional.
Q: Who Are the Pros?
A: Known as an Electronic Systems Contractors (ESC), these
individualsorcompaniesfunctionjustlikeany contractor you might hire to work onyour home. The ESC knows how to makeyourhouseperform,lookandsoundbetter.Formanypeople,lookingforagoodcustomelectronics company is like being plunkeddowninaforeignland.Thereisnoneedtofeel intimidated, but where do you start.MostESCs,suchasAmbrosicHomeTheaterDesigns,LLC,liveandbreathetechnology.It’s their passion. They understandtechnology and take hands-on training
throughout the year to expand theirknowledge on all things electronic for thehome. These activities are essential tounderstanding the types of technologiesthatwillbebestforeachclient’shomeandhow to design and install them properly.HaveyoueverlookedatthespecsonabigscreenTVandtriedtocompare?Goahead;you’llsoonrealizejusthowdifficultitistocomparisonshop.
Q: How do I Know Who to Hire?
A: Check their credentials. Look at whattypesofsystemsthecompany
specialize in, and what licenses andcertifications they have. CEDIA (Custom
Electronic Design and InstallationAssociation) is a trade organization ofthousands of custom electronicsprofessionals.LookforCEDIAcertificationasasignofaprofessionalelectronicsystemscontractor. Ambrosic Home TheaterDesigns, LLC, is both CEDIA and ISFcertified.IN THE ENDElectronic systems are not perfect evenwhen they are professionally installed. AnElectronics Systems Contractor can offertheassurancethatifandwhenyouencounterproblems, there’ssomebodytherewhocanhelpyou.AmbrosicHomeTheaterDesigns,LLCoffersitsclients24/7customerservice.
How to eliminate cancer from your body naturally!
Q: Is cancer merely a vitamin deficiency disease?
A:There is mounting evidence that cancer is avitamin deficiency. Centuries ago we used to
eatmilletandlinseedbreadrichinB17,butnowweeatwheatbreadwhichhasnoneatall.Ourancestorsusedtocarefullycrushtheseedsofplums,loquats,cherries,apples,andapricots,andmixthekernelsinwiththeirhomemaderecipes.ThekernelsofallthesefruitscontainsomeofthemostpotentsourcesofB17intheworld.
Q: How can I get vitamin B17 into my diet?
A: The most concentrated levels of vitamin B17are in apricot kernels and apple seeds. The
easiest and most nutritious way is to get the B17ChocolateBarsorB17SpiceBrowniesavailableattheCircleofHealthinBluffton,SC.Alsoavailablearetheapricotkernelsbythemselves.
Q: What else can I do to heal my body from cancer?
A: There are so many things we can donutritionally to kill cancer cells, and rebuild
our immune systems: in addition to B17: VitaminslikeC,andD,TeaslikeLoquatandEssiacTeas,andherbs like Graviola, Astragalus and Astaxanthin tonameafew.
Q: Any other suggestions?
A: Yes, replace all body products that would introduce chemicals into your lymph system,
suchasSLS shampoos, toothpaste,deodorants,bodylotionsandperfumes,andreplacethemwithcoconutoil,andothernatural,chemical-freeoptions.
Q: Where can I get more information on vitamin B17 and cancer?
A: For more information see the video “WorldWithoutCancer”inasix-partvideoatYouTube.
com, and scan the barcode below with your smartphonetovisittheCircleofHealthvideo.Youwillbeamazed!
843-815-4782
Kinfolks Gullah grubs & seafood RestaurantKinfolks Gullah grubs & seafood RestaurantAuthentic Gullah Cuisine and Dining ExperienceAuthentic Gullah Cuisine and Dining Experience
Fish, pork, chicken and beef dishes (complimented with traditional Gullah sides!)
Daily specialsSeparate party room availableGullah artwork on display!
“We welcome you to our table. Our food is prepared to order using the freshest, local ingredients whenever possible. Thank you and enjoy!”“We welcome you to our table. Our food is prepared to order using the freshest, local ingredients whenever possible. Thank you and enjoy!”
70 Pennington Drive . Sheridan Park . Blufftonwww.kinfolksgullahseafood.com
Q: What’s the unique difference between Geechee, Gullah and
Soul Food cooking?
A:The natural, geographic, andclimaticadvantagesofdifferent
sections of the Southern Coast haveplayed an important part of theGeechee/Gullah cookery. All threehave unique European, African andNativeAmericanblendofingredientsthat are used in each cultural dish.Even though most of the Cajun andCreole flavors are used in Geechee/Gullahfoods,theyareindividualanddistinctiveinitstechniqueofcookingtogiveasuperb“downSouth”taste.Geechee food has more of a robusttaste with a flare of Georgia andFlorida’ssoutherncookingtechniquesofaone-potcookedmeal.Forinstancethe rice pot “Prioleau” is rice, meatwithpeasorbeansallcookedtogether.
TheGumboPot“SoupPot”cooksyourtomatoes, vegetables, and meats alltogether.IntheGreensPotsor“messofgreens”weputcollards,mustardorturnipgreenswithwaterandmeat,letitcooktenderlythenaddrice,tomakeafulldeliciousmeal.Gullah foods are mostly stewed,grilledorroasted—verylittleisfried.Because the Gullahians are mostlylocatedonthewatercoastoftheSeaIslands a lot of the dishes includeseafoodandwholegrains.Threegreatwell known tasty traditional dishesare grits served up with sumptuous,freshly caught stewed shrimps andgravy,stewedfishwithsavorybrowngravy,andalsoSeafoodGumbo!SoulfoodisacombinationofGeecheeandGullahcreatingsavory,appetizingdishes from plain, every dayingredients. It’s called Soul food
because food was often used tocelebrateandbringfamiliestogether.It was time of happiness andthanksgiving. It is also said that thewomenwhocookedthefoodputtheirhearts and soul into it. Another ol’sayingis“thewaytoaman’sheartisthroughhisstomach”.Come to Kinfolks Gullah Grubs & Seafood Restaurant to taste FREEsamples of a magnificent array ofsouthernhomestylecookingthatwillgiveyouanexperienceofLowcountrycooking.
Geechee:Fried grits with deep brown savory gravy and shrimpsGullah:Taste of Lowcountry Seafood GumboSoul food:Mouth-watering taste of skillet fried buttermilk cornbread
How to choose a Gullah restaurant
www.thealliancegrouprealty.comwww.facebook.com/thealliancegrouprealty
www.thealliancegrouprealty.comwww.facebook.com/thealliancegrouprealty
LOCATED IN THE FRESH MARKET SHOPPES
843-785-5200LOCATED IN THE FRESH MARKET SHOPPES
843-785-5200
Will the real estate market re-bound? We’re optimistic! let’s look at what has changed: interest rates are at historic lows, sellers are desperate, and attractive properties are in abundance at greatly reduced prices. Now, let’s look at what has not changed: People love homes, ownership is preferred over renting, Hilton Head is paradise, and you can’t raise a family in a mutual fund.
Q: Where are the REAL bargains?
A:Some buyers believe itsforeclosures, others say short
sales. The real answer is deals areeverywhere. Usually the best bargainsaresnappedupveryquicklywhentheyfirst hit the market because they arepriced correctly. Occasionally, we seepropertiesdeeplynegotiatedafterbeingonthemarketforalongtime,becomingstale,andthesellerbecomingdesperate.Realtors are really your best sourcebecausetheywatchitdailyandknowitwhen they see it. Find a good Realtorwho will work hard for you. They willfindyouwhatyou’relookingfor.
Q: Why buy verses rent?
A: When the housing marketslumps rents go up. Rents are
up and getting harder to find. As atenant, you’re paying the landlord’smortgagewithoutowningthehome.
With today’s prices, many tenantscouldowntheirhomeforwhatthey’repayinginrent.Plus,there’snothinglikeowningyourownhome.Youcanfixit,change it, improve it, or pass it ontoyour kids. Also, when you own, yourmortgage interest is tax deductible.Everymonthyouarepayingdowntheprinciple on that mortgage, and anyappreciationisyourgain.
Q: How can I get my property sold?
A: Buyers remain in the driver’sseat and they’re doing their
homework; this is because technologymakes it easy to see all properties. Intoday’s market, people can fall in lovewithahouse,butthere’splentytochoosefrom includingmany thatareavailablethroughforeclosures.So,ifthepriceisn’tright, buyers move onto the next oneuntiltheyfindthebargainthey’relookingfor. If you want to sell your house, besure it’s clean, appealing, and pricedaggressively. The good news is yourproperty“will”sell.But,unfortunately,itmaynotbeatthepriceyou’dlike.
How to gauge the future of real estate
Low Cost Repairs!Same Day Service!Low Cost Repairs!Same Day Service!
How to choose an appliance repair service
it can be difficult to know which appliance repair service to call when one of your appliances break down. There are some things you should look for and watch out for, when deciding. if you’ve ever felt that you were overcharged, or taken advantage of, by an appliance repair service, you need to read this.TIPS• Consider the value of the appliance youarerepairing.Itmaybemoreeconomicaltoreplaceanappliancethantorepairit,whencost, life expectancy, and efficiency areconsidered.•Beforereplacinganappliance,it’sworthaservicecalltofindoutexactlywhat’swrong.Manytimespeoplewillbuyanewappliancewithout even checking out what it wouldtaketofixtheonetheyhave.Theyassumeit’sgoingtocosttoomuchwhensometimesit’saquick,minor,inexpensiverepair.Where do I look when I need an appliance repair service?
AAsk your friends for a referral.Theverybestwaytofindanappliancerepairserviceisby “Referral”. When someone you knowrecommends a company they were
completely happy with (which includesservice,price,professionalism,etc.)thenyoualreadyknowyou’regettingagoodcompany.Justbesureyoutrustthisperson’sopinion!BLook for license and insurance.Theadyou’re looking at should say “Licensed &Insured”andthenchecktomakesuretheirlicensenumberisvalidandtheirinsuranceiscurrent.CCheck how long the company’s been in business at the same location, under the same name. A company with a long localhistory isabetterbet thanarecentstartupwithnohistoryinthearea.Carl Williams, owner of Williams Appliance Repair has been servicing appliances for over 15 years.D Weigh the benefits of the personal attention you will receive from a family-owned business vs. the unknown technician
a larger company will send.Alocalpersonhas a reputation to uphold locally. Arepresentative of a large national chain,however, may or may not be concernedaboutgivingyouthebestdealsorservice.E Ask a specific question. For example:“Hi, I have a Kenmore gas dryer that wasworking fine until today. It still runs finebutthere’snoheatatall.IfallIneedisanewigniterreplaced,howmuchwouldthetotalrepaircostme?Iunderstandthatyoumayfind other things wrong and the estimateyougivemeoverthephonecouldchange,butallI’maskingishowmuchwoulditcostme if all you had to do was replace theigniter?”Iftheywon’tanswerthatquestion,itshouldbearedflagtoyou.
See our weekly ad in Tidbits’ Here’s My Card section.
comforcare Home care is a leading non-medical, home health care provider that delivers the highest quality personal and homemaking services through reliable and experienced caregivers. We take pride in our rigorous, 10-step hiring process, the most thorough in the home health care industry.
The office for the study of Aging, Arnold school of Public Health at the university of south carolina, recommends interviewing home care providers to make better choices about the care you will receive. comforcare agrees and encourages individuals and families to do their homework, ask tough questions and make informed decisions.
Q: How are the client’s home health care needs assessed?
A: Before sending a caregiver into a client’shome,aqualifiedprofessional
should assess the individual’s needs. WithComForcare, a registered nurse performs acomprehensive assessment, including a homesafetycheckand fall riskevaluation. TheRNthendevelopsapersonalizedcareplan that isfollowedbythecaregiverateveryvisit.
Q: What is included in the hourly cost of home care services?
A: Muchmorethancaregiversalarygoes into the cost of home care services.
Employers are required by law to pay federal,stateandSocialSecuritytaxesoftheiremployees—ataskthatfallstotheconsumerifacaregiveris not employed by an agency. Worker’s
compensation insurance must be paid by theemployeraswell,shieldingtheconsumerfromsubstantialliability.
Q: What is the home care provider’s hiring process for caregivers?
A: Whentalkingtohomecareemployers, ask if they perform background and
reference checks. Running criminal, sexoffenderanddriver’sbackgroundcheckshelpprotect the client against physical,psychologicalorfinancialabuse,andreferencechecks verify a caregiver’s work history andexperience.ComForcare utilizes an RN to further test acaregiver’shealthcareknowledgeandskills.Inaddition, in-home “spot” checks are done toensure dependability and care plan followthrough.
Q: Who takes care of scheduling? What if I need assistance after hours?
A: Afirst-ratehomehealthcareprovider willmakecertaintherightcaregiveris
chosenforyourparticularneedsandisavailabletoyouaroundtheclock.Theagencywillhandleschedulingyourcaregiver,findingareplacementif your usual caregiver is ill or on vacation.ComForcarebeginsbymatchingyouandyourlovedonewithacompatiblecaregiver,takescareofallschedulingandisavailable24/7,365daysayearforallyourhomecareneeds.Regularfollowup calls to the client and family guaranteeconcernsareaddressedinatimelymanner.
Call ComForcare today for a FREE, no obligation, in-home visit! Our representative will answer all your questions about the care
we can provide you or your loved one.
How to choose an in-home health care provider
We are the telecom experts!We Know Your Telecom Services Inside and Out
Paul McMenamin, Schooley Mitchell Telecom Consultant
You could be spending less and getting more!
843-715-0136
Telecom Causing a PAIN in your wallet?
We understand your services inside and out!We “GET” your telecom needs and then match your services
We are the Telecom Experts and...We Can Help!
WE’LL SHOW YOU HOW TO SAVE MONEY!“Volunteers in Medicine secured
the services of Schooley Mitchell
in winter of ‘09. Paul M. worked
diligently with our staff to perform
an audit and evaluation of the
communication services we had
been paying for. Through their
efforts, we have nearly halved
our monthly telecom cost with no
degradation in service and faster
internet connection as well.” -
Frank W. Bowen, M.D., Medical
Director
telecommunications and reliable services are a key part of any business operations. We will often get our monthly bills, and as long as they are similar to what we paid last month, we write the check and move on. But are you sure that you know what you are paying for? Paul mcmenamin works with businesses across North America saving them money on their monthly spending. often companies are paying for services they stopped using a long time ago. sometimes there are billing errors that can be claimed for refunds. if you use wireless services in your business you are probably paying more than you need to.
Q: How do I know if my communi-cations charges are correct?
A:It is always a healthy step toconductanauditofyourservices.
This means understanding what you areusingversuswhatyouarepaying for.Aspart of my service I look at your bills,contactyourproviders,andfindoutwhatyour contract status is. The cost ofcommunications is dropping across theboard.Yourcurrentserviceprovidermayalso have some special offers available.Competition for services usually meansthat there is another provider who mayofferthesame,orbetter,forless.Icanhelpyouidentifytheopportunities.
Q: Why would I need you to look at my services?
A: 30years in the telecombusinesshasallowedmetounderstandthe
process from the ground up. I look atwhat you are using, and sometimes askyour provider to provide details andtrafficusageonlines.Youmayhavemoreofthemthanyouneed.Ifyouhaveseverallocations or moved your business youmaystillbechargedforserviceattheoldlocation,REALLY!Theproviderstellme“It is the client’s responsibility tounderstand their telecommunicationsneeds.” I can help you be sure you aredoingthat!
Q: My wireless bills just keep getting bigger. How can you help?
A: Wirelessserviceprovidershaveanumberofplansdesignedtomeet
theneedsof their“typical”clients.Yourbusiness is not “typical”. Sometimes apersonal family plan is best, sometimestheoffers forabusinessarebetter.Yourusage changes over time, and planadjustments can save you money oncostly overages. Here in the lowcountrywireless coverage is an issue for cellphones, and I understand where thecarriers have good and not so goodcoverage. I can help you get the servicequalityyouneed.
How to get the best deal for my communications dollar
As a small business owner — or solo professional — what are some of the most effective strategies to generate more leads…and ultimately more sales?
The key to running a prosperous business is to think of yourself first of all as marketer and secondly as a business owner. As a small business owner, you often find yourself doing your own marketing which can backfire if you don’t take the time to get acquainted with the basic principles of marketing. Here are a few lead-generation and client-Attraction strategies that will ensure plenty of customers for your business:The More Quality Leads You Generate, the More You’ll Sell
There are 2 steps to making a sale:1) First you have a lead who walks intoyourstore,orpicksupthephoneandcallsyou…2)Thenyouearntheirtrustenoughthattheydecidetobuyfromyou.
And it all starts with that lead; themore leads you can generate and earntheirtrust,themore$$$syoubringtothebankattheendoftheday.What are Your Top 3 Most Effective Lead-Generation Strategies?
When I ask my clients this question,many will say “Advertising, word ofmouth, networking, Yellow Pages…”
Someevensay“Idon’tknow…”Tokeepgeneratingqualityleads,itisimportanttounderstand the source of your mostqualified leads, that way you can spendmore of your advertising dollars — ormore of your efforts (networking,blogging,etc.)—inthatdirection.
Visit www.getMoreClientsPro.com to access dozens of lead-generation strategies (Full Access; No-Strings-Attached — FREE for 30-Days!)Advertising as Lead-Generation “Tool”
Whendonecorrectly,advertisingcanbe a great lead-generation tool; doneincorrectly,canbeagreatdrainonyourmarketingdollars.Toensureyouradsare
producing results, keep in mind thefollowing:1)Knowwhoyouaretargeting(targetmarket)andwhataretheirmainchallenges or desires (what keeps themupatnight?),2)offerasolutioninyourad AND a FREE irresistible offer, e.g.“Visit www.Solution2YourProblem.comtogetyour7-Tipsto…(solutiontotheirproblem or desire)”, 3) use PowerfulHeadlines that will capture the eye ofyourprospects
Visit www.getMoreClientsPro.com to access 350 of the Greatest Headlines that can jumpstart your marketing and advertising (Full Access; No-Strings-Attached — FREE for 30-Days!)
How to generate more leads...and more sales
How to choose a great gift
choosing a gift for that hard to buy for person or the person who has everything can sometimes be difficult. let scentsy help! scentsy has a wide variety of products, from different size warmers and plug-ins to room sprays, scents circles and more. Are you looking for a nice teacher gift? How about an alcohol free hand sanitizer? our fragrance foam comes in 15 fragrances and works great in the classroom. Need a gift for a wedding, father’s Day or christmas? We have something for everyone and all occasions. Any new baby or child would love one of our soft and cuddly scentsy Buddies filled with a fresh smelling scent Pak. And give mom one of our new solid perfumes for mother’s Day.
Q: What is Scentsy?
A: Scentsy is a direct selling, wickless candle company
headquartered in Meridian, Idaho.The company is owned by Orvilleand Heidi Thompson and sells itsproducts throughafieldsales forceof more than 200,000 independentsales representatives known asIndependent Scentsy Consultants,whomarketandsellScentsyproductsthroughhomeparties.
Q: What are wickless candles?
A: A wickless candle, called a ScentsyBaroraScentsyBrick,
is a highly fragrant wax bar that iswarmedtoreleasefragranceintotheair.Becausethewaxisgentlywarmedratherthanburned,itcanholdmorefragranceoilthanatraditionalcandle.And,becausethereisnoflame,thereis no smoke, soot, or lead. Scentsywicklesscandlesareasaferalternativetotraditionalcandles.
Q: How is the wax warmed?
A: Scentsy’s beautiful ceramicwarmers house a low-watt
light bulb that slowly melts theScentsyBarorScentsyBrick,fillingyourhomewithoneofmorethan80distinctive, long-lasting scents. Thecombination of a Scentsy Warmerwith a Scentsy Bar is known as aScentsySystem.Julie MoniotIndependent Scentsy Star Director
lisa kenward eventsk
lisa kenward eventslisa kenward eventsSOPHISTICATED. CREATIVE. MEMORABLE.
WEDDINGS and UNIQUE EVENTS
843.338.7883www.LisaKenwardEvents.com
How to choose a wedding planner
getting married? congratulations! once you’ve said “yes,” hire a Professional Bridal consultant that will help you ENJoy your DAy WitHout Worry.
WhenselectingaProfessionalBridalConsultant (PBC), choose one thatlistenstoyourdreamsandfindswaysto incorporate your ideas, theme, orfamily traditions into your ceremonyor reception. A PBC has earned thedesignation and has the knowledgeplus experience to ensure your day isasperfectaspossible.
APBCshouldasklotsofquestionspertaining to how you envision yourday.Besuretonotethespecificitemsyou want your PBC to take care of—invitations,hotelaccommodations,flowers/decorations for ceremonyand reception, guest table seating,ceremonyprogram,organizebreakfastor lunch for wedding party prior toceremony, music coordination, andweddingdaytimeline.It’syourchoice!
It’syourday!Day-of Coordination versus Eight
Months of Planning — Don’t waituntil themonthbeforeyourwedding
day to ask for help. Seek professionalguidancefromaPBCbeforeyouselectyourdateandlocation.HiringaPBCwillsaveyoumoney,asaPBCwillhelpyouuseyourbudgetasatooltoguideyourplanningdecisions.
Location, Location, Location —Spend the money for the venue youwant. Your venue selection reflectsyourstyleandpersonality.RelyontheknowledgeofyourPBCtoknowaboutallthebenefitsofthevenue.
Wedding Reception Menu — Didyou know that 30% to 40% of yourbudget is spent on the menu? YourPBC has extensive knowledge andexperience with menu selection,caterersandchefs.
Plan to enjoy every moment bypreplanning!Nowyou’reready tosay“Ido.”
By: Lisa Kenward, Professional Bridal Consultant (PBC)
Lisa Kenward Events — Sophisticated. Creative. Memorable.
Walk-In Bathtubs and Barrier Free Showers
Lifetime GuranteeMade in the USA
3047 Argent Boulevard, Suite 3843-645-0515
www.scwalkintubs.com
Satisfaction Guaranteed
Unbeatable Pricing
Recommended by Doctors for Safety and Pain
Management
Full Installation Within a Few Days!
(Includes removal of existing Shower/Tub)
100% Financing Available!
Before
After