primate η-globin dna sequences and man's place among the great apes

5

' Nature Publishing Group 1986

Upload: jerry-l

Post on 21-Jul-2016

217 views

Category:

Documents

4 download

Report

Download

Embed Size (px):

TRANSCRIPT

Page 1: Primate η-globin DNA sequences and man's place among the great apes

© Nature Publishing Group1986

Page 2: Primate η-globin DNA sequences and man's place among the great apes

© Nature Publishing Group1986

Page 3: Primate η-globin DNA sequences and man's place among the great apes

© Nature Publishing Group1986

Page 4: Primate η-globin DNA sequences and man's place among the great apes

© Nature Publishing Group1986

Page 5: Primate η-globin DNA sequences and man's place among the great apes

© Nature Publishing Group1986

Primate project

Hemoglobin (Hb) Hb is found in RBCs its main function is to transport O 2 to tissues. Structure: 2 parts : heme + globin Globin: four globin chains (2

-Globin Gene Regulation and Nuclear Organisation

Effect vitro DNA methylation ,-globin expression

Primate features

One man's magic is another man's engineering · “One man's magic is another man's engineering” ... FARM is a model which provides an integration of different ... agricultural

Non Human Primateปี 5-52 - Kasetsart University Human Primate 5.52.pdf · Primate Taxonomy (Revise) Order Primate Suborder Infraorder Superfamily Strepsirhini Lemuriformes Loriformes

Limited Number of Globin Genes in HumanDNA10-7, or 0.198 ngof globin DNA.FromEq. [1] wecan calculate the %hybridization, P, expected for anynumberof globin gene copiespresent.Forexample,inExp.1,

-globin ( 141) and -globin (146) V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS--H---GSAQVKGHGKKVADAL VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAF

Primate Presentation

Beta Globin Gene Cluster

Anemia Karena Kelainan Sintesis Globin

One man's rags are another man's riches: identifying

Journey of discovery - Primate Evolution Yr13 …...Journey of Discovery - Primate Evolution p.2 What is a primate? Although there are distinguishing features between different primate

3.Anemia Akibat Kelainan Sintesis Globin

Man's community(Man's)

Primate Taxonomy

"It's A Man's, Man's, Man's World"

Chapter 5: Primates. Primate Video Primate Characteristics After the video; what are primate Characteristics: _________________

CCXIV. THE OSMOTIC PRESSURE OF GLOBIN

Primate intelligence

Globin Gene Variants in EasternPolynesia

PBL Gen Globin Pasca

Globin X is a six-coordinate globin that reduces nitrite ... · Globin X is a six-coordinate globin that reduces nitrite to nitric oxide in fish red blood cells Paola Cortia, Jianmin

Molecular Basis for the Evolution of Species …human -globin baboon -globin chimera, observed in Fig. 3A.Asfor -globin, no single residue substitution improved binding by S. aureus

Primate Suborders Figure 10.1: Summary of traditional primate classification

Molecular Haematology I Globin Disorders

Primate Presents: Gordon McLachlan talks digital campaigns | Primate Presents

-globin subunits for hemoglobin synthesis · to the α thalassemia silent carrier strain, termed α-globin*α/αα, which lacks 1 of 4 α- globin genes and exhibits minimal erythroid

Primate Origins

Primate evolution

Hemoglobinopathies. Hemoglobin structure globin globin globin Hgb A tetramer

"It's A Man's, Man's, Man's World" By: Said Ismail Abdulrahman