noerlina dkk.pdf

of 13/13
1 ANALISIS DAN PERANCANGAN SISTEM INFORMASI AKUNTANSI PEMBELIAN DAN PERSEDIAAN PADA IKP CO Noerlina, Anderes Gui, Suryanto Jurusan Sistem Informasi, Program Studi Komputerisasi Akuntansi, Universitas Bina Nusantara, [email protected] Abstrak Dalam memenuhi kebutuhan sistem informasi yang diperlukan oleh IKP Co, maka dilakukanlah analisis dan perancangan sistem pembelian dan persediaan barang yang bertujuan untuk menganalisa sistem yang sedang berjalan, serta mengidentifikasi masalah yang ada agar dapat dilakukan perancangan sistem informasi baru yang dapat mengatasi masalah yang dihadapi khususnya mengenai sistem informasi akuntansi pembelian dan persediaan. Metode penelitian yang digunakan yaitu dengan menggunakan metode analisis dan metode perancangan. Metode analisis yaitu analisis langsung terhadap sistem yang berjalan, mengidentifikasi kebutuhan informasi, dan mengidentifikasikan kebutuhan sistem. Metode perancangan yaitu merancang sistem baru untuk mengantikan atau memperbaharui sistem yang sedang berjalan dengan menggunakan pendekatan object oriented analysis and design ( OOA&D ). Teknik pengumpulan data yang digunakan yaitu dengan melakukan wawancara serta studi dokumentasi yang diikutsertakan dalam proses pembelian dan persediaan barang. Hasil yang dicapai dari analisis dan perancangan yang dilakukan adalah laporan yang berhubungan dengan pembelian dan persediaan dan tampilan layar yang dapat digunakan untuk melakukan transaksi pembelian dan persediaan. Kesimpulannya adalah : sistem informasi yang digunakan masih semi manual dalam pencatatan pembelian dan persediaan barang sehingga memungkinkan kesalahan dalam pencatatan, membutuhkan waktu yang lama dalam melakukan pengecekan dan selain itu juga memperlambat proses transaksi pembelian, belum terdapatnya link yang menghubungkan datadata antar bagian purchasing, accounting dan warehouse sehingga menyebabkan lambatnya arus informasi yang dibutuhkan, adanya fungsi ganda pada bagian accounting, yaitu sebagai finance dan akuntansi. Akibat dari pembagian tugas yang rangkap akan menimbulkan resiko yang merugikan untuk perusahaan, serta perlu dirancangnya sistem informasi untuk mendukung operasional perusahaan. Kata kunci: sistem informasi, pembelian dan persediaan, analisis dan perancangan system . 1. LATAR BELAKANG Kunci penting didalam memenangkan bisnis adalah kebutuhan akan informasi yang cepat dan tepat, terlebih lagi di zaman era globalisasi seperti saat ini. Tersedianya sistem informasi bermanfaat dalam mengambil keputusan manajemen

Post on 15-Jan-2017

229 views

Category:

Documents

0 download

Embed Size (px)

TRANSCRIPT

1

ANALISISDANPERANCANGANSISTEMINFORMASIAKUNTANSIPEMBELIANDANPERSEDIAANPADAIKPCO

Noerlina,AnderesGui,SuryantoJurusanSistemInformasi,ProgramStudiKomputerisasiAkuntansi,

UniversitasBinaNusantara,[email protected]

Abstrak

DalammemenuhikebutuhansisteminformasiyangdiperlukanolehIKPCo,makadilakukanlahanalisisdanperancangan sistempembeliandanpersediaanbarangyangbertujuanuntukmenganalisasistemyangsedangberjalan,sertamengidentifikasimasalahyangadaagardapatdilakukanperancangansistem informasibaruyangdapatmengatasimasalahyangdihadapikhususnyamengenaisisteminformasiakuntansipembeliandanpersediaan. Metode penelitian yang digunakan yaitu denganmenggunakanmetodeanalisisdanmetodeperancangan.Metodeanalisisyaituanalisis langsung terhadap sistemyangberjalan,mengidentifikasikebutuhan informasi, dan mengidentifikasikan kebutuhan sistem.Metode perancangan yaitu merancang sistem baru untuk mengantikanataumemperbaharuisistemyangsedangberjalandenganmenggunakanpendekatan object oriented analysis and design ( OOA&D ). Teknikpengumpulandatayangdigunakanyaitudenganmelakukanwawancarasertastudi dokumentasiyangdiikutsertakandalamprosespembeliandanpersediaan barang. Hasil yang dicapai dari analisis dan perancanganyangdilakukanadalahlaporanyangberhubungandenganpembeliandanpersediaan dan tampilan layar yang dapat digunakan untukmelakukantransaksi pembelian dan persediaan. Kesimpulannya adalah : sisteminformasi yang digunakan masih semi manual dalam pencatatanpembelian dan persediaan barang sehingga memungkinkan kesalahandalam pencatatan, membutuhkan waktu yang lama dalam melakukanpengecekan dan selain itu juga memperlambat proses transaksipembelian,belumterdapatnyalinkyangmenghubungkandatadataantarbagian purchasing, accounting dan warehouse sehingga menyebabkanlambatnya arus informasi yang dibutuhkan, adanya fungsi ganda padabagian accounting, yaitu sebagai finance dan akuntansi. Akibat daripembagian tugas yang rangkap akan menimbulkan resiko yangmerugikanuntukperusahaan,sertaperludirancangnyasisteminformasiuntukmendukungoperasionalperusahaan.

Kata kunci: sistem informasi, pembelian dan persediaan, analisis danperancangan system

.1.LATARBELAKANG

Kuncipentingdidalammemenangkanbisnisadalahkebutuhanakaninformasi

yang cepat dan tepat, terlebih lagi di zaman era globalisasi seperti saat ini.

Tersedianya sistem informasi bermanfaat dalammengambil keputusanmanajemen

2

secaraumumdanmanajemenpersediaanbarangsecarakhusus,sehinggaperusahaan

semakin menyadari akan pentingnya informasi dalam memperlancar kegiatan

usahanya.

Analisis masalah pada IKP Co yaitu mempunyai data dan dokumen yang

mencatat informasi mengenai pembelian dan persediaan barang namun belum

terkelola dengan baik, akibatnya perusahaan kesulitan dalam menangani transaksi

pembelian dan persediaan barang tersebut. IKP Co masih menggunakan banyak

dokumenyangberedarsehinggamembutuhkanbiayaoperasionalyangcukupbesar

untuk mencetak dokumendokumen tersebut. Salah satu kesulitan yang terdapat

dalam aktifitas aliran dokumen antara tiaptiap transaksi belum terintegrasi antara

bagianpurchasing,bagianaccountingdanbagianwarehouse.Selainitupencatatan

sistemtransaksipembeliandanpersediaanbarangmasihdilakukansecarabatchline,

lalu adanya fungsi ganda pada bagian accounting sehingga memungkinkan

terjadinya kecurangan. Prosedur yang sedang berjalan pada IKP Co dirasakan

kurang efisien dalam memenuhi kebutuhan perusahaan akan data dan informasi

yangsemakincepatdigunakanuntukpengambilankeputusan.

Salah satu solusiuntukmengatasikesulitandidalam transaksipembeliandan

persediaan barang adalah merancang sistem akuntansi pembelian dan persediaan

yang saling terintegrasi dengan menggunakan pendekatan OOA&D (Object

Oriented Analisis andDesign). DenganOOA&Ddiharapkan dapat meningkatkan

efisiensi biaya dan waktu yang dibutuhkan oleh enduser dalam menjalankan

aktivitasdantanggungjawabnyadiperusahaan.

2.TINJAUANTEORI

Menurut OBrien (2001, p7) sistem informasi dapat berupa kombinasi

sumber dayasumber daya yang terorganisir darimanusia, perangkat keras, piranti

lunak, jaringan komunikasi, dan data yang mengumpulkan, mengubah, dan

mendistribusikaninformasipadasuatuorganisasi.

MenurutJones&Rama(2006,p5)theaccountinginformationsystemisasubsystem of anMIS (management information system) that provides accountingand financial information, as well as other information obtained in the routineprocessingofaccountingtransaction.

3

Menurut Jogiyanto (2005, p35), pengembangan sistem (Systems

Development)dapatberartimenyusunsuatu sistemyangbaruuntukmenggantikan

sistemlamasecarakeseluruhan ataumemperbaikisistemyangada.

AnalisissistemmenurutMcLeod(2001,p190)adalahpenelitianatassistem

yang telah ada dengan tujuan untuk merancang sistem baru atau diperbaharui.

Analisis lebih menekankan pada penyelidikan atas suatu masalah daripada

bagaimana sebuah solusi didefinisikan (Larman, 1998, p6). Perancangan sistem

adalah proses penterjemahan kebutuhan pemakai informasi ke dalam alternatif

rancangan sistem informasi yang diajukan pada pemakai informasi untuk

pertimbangan(Mulyadi,2001,p51)

MenurutJogiyantoHartono(2005,p130),langkahlangkahdasaryangharus

dilakukanolehanalisissistemsebagaiberikut:

1. Identify,yaitumengidentifikasimasalah

2. Understand,yaitumemahamikerjadarisistemyangada

3. Analyze,yaitumenganalisissistem

4. Report,yaitumembuatlaporanhasilanalisis

Ada3metodedalamanalisisdanperancangansistem,yaitu:

1. Metodetradisional,yaitumenggunakansistem FlowChart

2. Metodeterstruktur,yaitumenggunakanERDiagram,Normalisasi,DFD

3. MetodeberorientasiObjek(ObjectOriented)

Object Oriented Analysis adalah merupakan suatu analisis yang

mnenekankan pada penemuan dan penjabaran objectobject atau konsepkonsep

yangmanamengujikebutuhankebutuhandariperpektifkelasdanpenemuanobject

object di dalam kamus problem domain. Pada analisis, para pengembang

menggunakan objectuntukmenentukankebutuhankebutuhansistem.

Menurut Jones & Rama (2006, p68) UML is a language used for

specifying, visualizing, constructing, and documenting and information system,

yang artinyaUML adalah suatu bahasa yang digunakan untukmenspesifikasikan,

memvisualisasikan,membangun,danmendokumentasikansuatusisteminformasi.

RichPictureadalahgambaryangdigunakanselamapemilihansistemuntuk

menyatakan suatu keseluruhan persepsi tugas proyek pengembangan sistem. Rich

Picture dapat memperjelas pandangan user mengenai situasi, permasalahan, dan

mendapatkanpandangankeseluruhansituasidengancepat.

4

ClassDiagram,suatudiagramyangmenguraikansuatukumpulankelasdan

hubungan strukturaldarikumpulan classtersebut.

UseCaseDiagramadalahdiagramyangsecaragrafismenggambarkansiapa

yang akanmenggunakan sistemdan dengan cara apa pengguna dapat berinteraksi

dengansistem.

Menurut Mulyadi (2001, p.299) pembelian digunakan dalam perusahaan

untuk pengadaan barang yang diperlukan oleh perusahaan. Transaksi pembelian

dapatdigolongkanmenjadidua:

1.Pembelianlokaladalahpembeliandaripemasokdalamnegeri.

2.Pembelianimporadalahpembeliandaripemasokluarnegeri.

Sistem informasi pembelian adalah sistem yangmengatur prosedur tentang

kegiatan pengadaan barang yang diperlukan oleh perusahaan. Pada setiap

perusahaanpembelianmerupakansuatukegiatanyangdangatpentingdengantujuan

untukmenyediakan barang di gudangdengan tingkat yang palingminimum tetapi

masihcukupuntukmemenuhipermintaanperusahaan.

Menurut Mulyadi (2001, p302), sistem akuntansi pembelian digunakan

dalamperusahaanuntukpengadaanbarangyangdiperlukanolehperusahaan.

MenurutMulyadi(2001,p300) fungsiyangterkaitdalamsistempembelian

adalahsebagaiberikut:

1. FungsiGudang

2. FungsiPembelian

3. FungsiPenerimaan

4. FungsiAkuntansi

Persediaan merupakan barangbarang yang dimiliki untuk dijual ke dalam

kegiatan normal perusahaan serta, untuk perusahaan manufaktur, barangbarang

yangsedangdiproduksiatauakandimasukkankedalamprosesproduksi.

MenurutMulyadi (2001, p553), Sistem Informasi persediaan adalah suatu

sistem yang menyediakan informasi atau laporanlaporan yang dibutuhkan oleh

pihakmanajemenyangberhubungandenganoperasipemesanan,penyimpanan,dan

persediaanbahanbaku.

MenurutMulyadi(2001,p553),sistemakuntansipersediaanbertujuanuntuk

mencatatmutasitiapjenispersediaanyangdisimpandigudang.Sisteminiberkaitan

5

eratdengansistempenjualansistemreturpenjualan,sistempembelian,sistemretur

pembeliandansistemakuntansibiayaproduksi.

MetodePenilaianPersediaan

Menurut Niswonger, Fess dan Warren (1999, p366) dalam menilai

persediaan,metodeyangdigunakanyaitu:

1. MetodeFIFO(FirstInFirstOut)

FIFO adalah metode penetapan harga pokok persediaan, di mana dianggap

bahwa barangbarang yang pertama kali dibeli akan merupakan barang yang

dijual pertama kali. Dalam metode ini persediaan akhir dinilai dengan harga

pokokpembelianpalingakhir.

2. MetodeLIFO(LastInFirstOut)

LIFOadalahmetodepenetapanhargaokokpersediaandimanadianggapbahwa

barangbarang yangpaling akhir dibelimerupakan barang yangdijual pertama

kali. Dalam metode ini, persediaan akhir akan dinilai dengan harga pokok

pembelianterdahulu.

3. MetodeRatarata(Average)

Ratarataadalahmetodepenetapan hargapokokpersediaandimanadi anggap

bahwa harga pokok ratarata dari barang yang tersedia dijual akan digunakan

untuk menilai harga pokok barang yang dijual dan yang terdapat dalam

persediaan.

KebijakandalamPersediaanmeliputi:

a. LeadTime

Lead timemerupakanwaktu yangdihitungsejaksatupesananpembelianpada

supplierdilakukansampaisaatbarangtersebutditerimaolehpembeli.

b. SafetyStock

Untukmenghadapipermintaanyangbervariasiperusahaanbiasanyamempunyai

tingkatpersediaantertentusebagaipengamananyangdisebut safetyataubuffer

stocks. Safety stock ini menyediakan sejumlah persediaan selama lead time,

Handoko(2001,p335).

c. ROP(ReOrderPoint)

6

PerhitunganROPmenggunakanrumus:

ROP=dxL

ROP=TitikPemesananUlang

d=Permintaanperhari

L=LeadTime,waktupengiriman

ROP adalah kuantitas di mana persediaan harus ditambahkan untukmenandai

pemesananulang.

d. EOQ(EconomicOrderQuantity)

PerhitunganEOQmenggunakanrumus:

EOQ=2DS

H

EOQ=JumlahOptimalPemesananBarang(Unit)

D=PermintaanTahunanBarangPersediaan(Unit/Tahun)

S=BiayaPemesananuntuksetiapPesanan(Harga)

H=BiayaPenyimpanan(Harga/Unit/Tahun)

e. MinimumStock

PersediaanMinimummerupakanbataspersediaanyangpalingkecilyangharus

adauntuksuatujenisbarang.

MenurutMulyadi(2001,p579),fungsiyangterkaitdalamsistempersediaan

adalah:

1. Panitiaperhitunganfisik

2. Fungsiakuntansi

3. Fungsigudang

3.METODOLOGIPENELITIAN

Metodologipenelitianyangdigunakanyaitu:

a. MetodologiAnalisis,terdiridaritigatahapsebagaiberikut:

1.Surveiatassistemyangsedangberjalan.

2.Analisisterhadaptemuanhasilsurvei.

3.Identifikasiterhadaptemuanhasilsurvei.

b. MetodologiPerancangan,terdiridarisepuluhtahapsebagaiberikut:

1. Overview

2. Pembuatan Activitydiagram

7

3. PembuatanUMLdiagram

4. Pembuatan UseCasediagram

5. Perancangan database

6. Perancanganformulir

7. Perancanganlayar

8. Perancanganlaporan

9. Navigationdiagram

10. Implementasisistem

4.PEMBAHASAN

Adapunmasalahyangdihadapiolehperusahaan IKPCoadalahsebagai

berikut:

1. Sistem informasi yang digunakan masih semi manual dalam pencatatan

pembeliandanpersediaanbarang.

Rekomendasi: Merancang sistem informasi akuntansi pembelian dan

persediaan yang terkomputerisasi. Dengan pembuatan aplikasi

akuntansi yang dapat mempermudah dan mempercepat

perusahaandalammelakukanprosestransaksi.

2. Belum terdapatnya link yang menghubungkan datadata antar bagian

purchasing,accountingdanwarehouse.

Rekomendasi : Membuat aplikasi program yang saling terhubung. Dengan

terdapatnya link yang menghubungkan datadata antar bagian

maka dapatmempercepat arus informasi pada perusahaan dan

memudahkandalampencariandata.Selainjugadirancangsuatu

kontrol untuk dapat melihat datadata tertentu sesuai dengan

hakaksesmasingmasingbagian.

3. Adanya fungsi ganda pada bagian accounting, yaitu sebagai finance dan

accounting.

Rekomendasi : Melakukanpemisahanfungsi financedanaccounting.Mengkaji

ulang danmelakukan pemisahan fungsi, tugas danwewenang

dalamstrukturorganisasidenganmemisahkanbagianfinancial

dan accounting. Hal ini dimaksudkan agar selalu terjadi

pengecekan internal (internal check) dalam pelaksanaan suatu

8

transaksi, sehingga dapat mengurangi kemungkinan terjadinya

kecurangan.

4.Arusdokumenyangtidakefisienkarenamelibatkanbanyakpihak.

Rekomendasi : Mengurangi keterlibatan beberapa pihak. Dengan melibatkan

hanya pihakpihak yang penting dan terpercaya dalam

melakukan pengecekan dan penandatanganan pada dokumen

dokumen maka akan mempercepat arus dokumen dalam

perusahaan.

5. Kontrolterhadapsoftwareprogramkurangkarenadatahanyadiketahuimasing

masingbagiansehinggamemungkinkanterjadinyakecurangan.

Rekomendasi : Meningkatkan kontrol terhadap software program. Dengan

melakukan pembatasan di mana jika data tersebut tidak dapat

diedit lagi jikasudah tersimpan.Sehinggadapatmenghasilkan

laporanlaporanyangterjamin.

TabelAnalisisKebutuhanInformasi

Informasi

Status Keterangan

Sudah

Ada

Belum

Ada

Butuh Tidak

Butuh

Nota Permohonan Pembelian dan

PenerimaanBarang

SuratPermintaanPenawaranHarga

PurchaseOrder

NotaPenerimaanBahandanBarang

NotaPenerimaanProduk

NotaPengambilanBahandanBarang

NotaPengambilanProduk

BuktiKasKeluar

SuratPemberitahuanBarangRusak

NotaReturPembelian

LaporanPersediaan(Bahan,Barang)

9

LaporanPersediaan(Produk)

LaporanPembelian

LaporanPenerimaanBahandanBarang

LaporanPenerimaanProduk

Laporan PengambilanBahandanBarang

LaporanPengambilanProduk

LaporanPemberitahuanBarangRusak

LaporanReturPembelian

LaporanHutang

LaporanPembayaranPembelian

LaporanKinerjaSupplier

RANCANGANSISTEMYANGDIUSULKAN

OverviewActivityDiagramDiusulkan

10

OverviewActivityDiagram

Supplier Pemohon

MembuatNP3B

TtdNP3B

MenerimaPO

Mengirimbarang

&SuratJalan

PO

B:Barang

S:Supplier

Membayar

ProsedurPembeliandanPersediaanBarang

NP3B

Bag.Warehouse Bag.Purchasing Bag.Accounting Komputer

NP3Bsign

MembuatPO

SJ

MembuatNotaPenerimaan

Bahan&Barang

MenerimaSJ

MembuatNotaPengambilanBahan&Barang

Mengambilbarang

NP3B

Menagih

POsign

invoice

BuktiTransfer

MenerimaPembayaran

PO:Purchase_Order

NPB:Nota_PenerimaanBahan&Barang

J:Jurnal

NPGB:Nota_PengambilanBahan&Barang

P:Pembayaran

SJ

Bag.Finance

Kwitansi

Membuatform

Pembayaran

MembuatSPBR

SPBR

MembuatNotaRetur

Pembelian

PO:Purchase_Order

B:Barang

ReturPembelian

Menerimakwitansi

Kwitansi

J:Jurnal

N:NP3B

MembuatSPPH

SPPHSPPH:SrtPermintaanPenawaranHarga

SPBR:Surat_PemberitahuanBarang_Rusak

BKK

NPB:Nota_PenerimaanBahan&Barang

S:Supplier

B:Barang

N:NP3B

S:Supplier

RP:ReturPembelian

MengirimSPHSPH

NPB

NPGB

11

UMLClassDiagram

+read()+input()+delete()+print()

no_retur_pembelian:Stringtgl_retur:Dateno_SPBR:Stringno_NPB:Stringno_PO:Stringkd_supplier:Stringnm_supplier:Stringkd_karyawan:Stringdivisi:Stringtotal_harga:Long

Nota_Retur_Pembelian

+read()+input()+update()+delete()

kd_supplier:Stringnm_supplier:Stringcontact_person:Stringalamat:Stringkota:Stringkode_pos:Integernegara:Stringno_telp:Stringfax:Stringemail:Stringno_rekening:Stringnama_bank:Stringcabang_bank:Stringjml_transaksi:Integerjml_retur:IntegerJns_pelayanan:String

Supplier

+read()+input()+delete()+print()+hitung()

no_PO:Stringtgl_PO:Dateno_NP3B:Stringtgl_kirim:Datetgl_jth_tempo:Datekd_supplier:Stringnm_supplier:Stringalamat:Stringcontact_person:Stringkd_karyawan:Stringdivisi:Stringsub_total:Longgrand_total:Longstatus:Boolean

PO

+read()+input()+update()

kd_barang:Stringnm_barang:Stringspesifikasi:Stringunit:Stringjumlah:IntegerROP:IntegerEOQ:Integer

Barang

+login()+ubah_password()

kd_karyawan:Stringnm_karyawan:Stringpassword:Stringjnis_kelamin:Stringtmp_lahir:Stringtgl_lahir:Datealamat:Stringno_tlp:Stringdivisi:Stringjabatan:String

Karyawan

+read()+input()+update()

kd_bahan_baku:Stringnm_bahan_baku:Stringspesifikasi:Stringunit:Stringjumlah:IntegerROP:IntegerEOQ:Integer

Bahan_baku

+read()+input()+delete()

no_NPB:Integertgl_NPB:Dateno_PO:Stringno_SJ:Integerkd_karyawan:Stringdivisi:Stringkd_supplier:Stringnm_supplier:String

Nota_Penerimaan_Bahan&Barang

+input()+delete()+ubah_status()

no_PO:Stringkd_barang:Stringnm_barang:Stringjumlah:Integerunit:Stringharga_satuan:Longtotal_harga_satuan:Long

PO_Detail

+read()+input()+delete()+print()

Bag_Accounting

+cek_stok()+read()+input()+update()+delete()+print()

Bag_Warehouse

+beli()+read()+input()+update()+delete()+print()

Bag_Purchasing

+bayar()+read()

Bag_Finance

1

1..*

+input()+delete()

no_NPB:Stringkd_barang:Stringnm_barang:Stringjumlah:Integerunit:String

NPB_Detail

1

1..*

+read()+input()+delete()

no_NPGB:Stringtgl_NPGB:Dateno_NP3B:Stringkd_karyawan:Stringdivisi:String

Nota_Pengambilan_Bahan&Barang

+input()+delete()

no_NPGB:Stringkd_barang:Stringnm_barang:Stringjumlah:Integerunit:String

NPGB_Detail

1

1..*

+input()+delete()

no_retur:Stringkd_barang:Stringnm_barang:Stringjumlah:Integerunit:Stringketerangan:Stringsatuan_harga:Longtotal_harga_satuan:Long

NRP_Detail

11..*

+read()+input()+delete()+print()+hitung()

no_pembayaran:Stringtgl_pembayaran:Dateno_PO:Stringtgl_jth_tempo:Datekd_supplier:Stringnm_supplier:Stringkd_karyawan:Stringdivisi:Stringtagihan:Longgrand_total:Longsisa_hutang:Long

FormPembayaran

+input()

no_pembayaran:Stringpembayaran_ke:Stringtgl_cicilan:Datejenis_pembayaran:Stringcara_pembayaran:Stringjml_pembayaran:Long

Pembayaran_Detail

1

1..*

kd_inventory:Stringnm_inventory:Stringspesifikasi:Stringunit:Stringjumlah:Integerstok_minimum:Integer

Inventory

+read()+input()+update()+delete()

kd_produk:Stringnm_produk:Stringspesifikasi:Stringunit:Stringjumlah:Integerstok_minimum:Integer

Produk

+read()+input()+delete()+print()

no_NP3B:Stringtgl_NP3B:Datetgl_keperluan:Datekd_karyawan:Stringdivisi:String

NP3B

+input()+delete()

no_NP3B:Stringkd_barang:Stringnm_barang:Stringjumlah:Integerunit:Stringstok_barang:Integer

NP3B_Detail

1

1..*

+read()+input()+delete()

no_NPP:Stringtgl_NPP:Datekode_karyawan:Stringdivisi:String

Nota_Penerimaan_Produk

+input()+delete()

no_NPP:Stringkd_produk:Stringnm_produk:Stringjumlah:Integerunit:String

NPP_Detail

1

1..*

+read()+input()+delete()

no_NPGP:Stringtgl_NPGP:Datekd_karyawan:Stringdivisi:String

Nota_Pengambilan_Produk

+input()+delete()

no_NPGP:Stringkd_produk:Stringnm_produk:Stringjumlah:Integerunit:String

NPGP_Detail

1

1..*

1

1..*

1

1..*

0..1

1

1..*

1

11..*

1..*

1

1

1..*

1

1..*

1

1..*

1..*

1

1

1..*

1

0..* 1

1..*

1

1

1

1

1

0..1

1..*

1

1..*

11

1..*

1..*

1

1..*

1

1..*

1

1..*

1

1..*

1

1..*

1

1..*

1

+read()+input()+delete()+print()

no_SPPH:Stringtgl_SPPH:Datekd_supplier:Stringnm_supplier:String

SPPH

+input()+delete()+ubah_status()

no_SPPH:Stringkd_barang:Stringnm_barang:Stringjumlah:Integerunit:Stringharga_satuan:Long

SPPH_Detail

1

1..*

+read()+input()+delete()+print()

no_SPBR:Stringtgl_SPBR:Dateno_NPB:Stringkd_karyawan:Stringdivisi:String

SPBR

+input()+delete()

no_SPBR:Stringkd_barang:Stringnm_barang:Stringjumlah:Integerunit:Stringketerangan:String

SPBR_Detail

1

1..*

1

0..1

1

1

1

1..*

1..*

1

1..*

1

1..*

1

1..*

1

1

1..*

1

1..*1..*

1

1..*

1

12

StrukturMenudalamAplikasi

UbahPassword

Master

MenuUtama

Laporan

HiGum

Keluar

Setting Jurnal

Produk

Raisafob

Bahan

Barang

HiGum

Raisafob

Supplier

Transaksi

Pembelian

NP3B

SPPH

PurchaseOrder

ReturPembelian

Pembayaran

Pengeluaran

Penerimaan

Bahan&Barang

Produk

Bahan&Barang

Produk

SPBR

Pembelian

Penerimaan

Bahan&Barang

Produk

Pengambilan

Bahan&Barang

Produk

Pembayaran

Hutang

SPBR

ReturPembelian

Barang

Bahan

Produk

HiGum

Raisafob

HiGum

Raisafob

KinerjaSupplier

1

5.KESIMPULAN

Kesimpulandaripembahasandiatasadalahsebagaiberikut:

1. Sistem informasi yang digunakan masih semi manual sehingga memungkinkan

kesalahandalampencatatandanmemperlambatprosestransaksipembelian.

2. Belum terdapatnya link yang menghubungkan datadata antar bagian purchasing,

accountingdanwarehouse.

1. Adanyafungsigandapadabagianaccounting,yaitusebagai financedanakuntansi.

2. Perusahaanbelummemilikiprosedurpencatatanreturpembelian.

3. Alur proses bisnis yang diterapkan oleh perusahaan sudah cukup baik, sehingga

hanya diperlukan penyesuaian terhadap sistem yangdiusulkan dengan sistem yang

telahada.

4. Pada sistem yang baru terdapat laporankinerja supplier berdasarkanperbandingan

transaksipembeliandenganreturpembelianyangterjadiselamaperiodetertentu.

5. ROP dan EOQ pada sistem yang baru diharapkan dapat mengontrol persediaan

sesuaiyangdibutuhkan.

6.DAFTARPUSTAKA

[1]Handoko,T.Tani.2001.DasarDasarManajemenProduksidanOperasi,edisike1.FakultasEkonomiUniversitasGajahMada,Yogyakarta.

[2]Jogiyanto,HM.2005.AnalisisdanDesainSistemInformasiPendekatanTerstruktur,edisike3.AndiOffset,Yogyakarta.

[3]Jones,FrederickL.,Rama,DasarathaV.2006.AccountingInformationSystems:ABusinessProcessApproach.SouthWesternPublishing.

[4] Larman, Craig. 1998. Applying UML and Patterns: An Introduction to ObjectOrientedAnalysisandDesign.PrenticeHall,USA.

[5]McLeod,Raymond.2001. SistemInformasiManajemen,edisiIndonesia,edisike7.TerjemahanTeguh,Hendra,danSukardi,Hardi.PT.Prehallindo,Jakarta.

[6]Mulyadi.2001.SistemAkuntansi,edisike3,cetakanke3.SalembaEmpat,Jakarta.[7] OBrien, J.A. 2003. Introduction To Information System: Essential For The E

BusinessEnterprice,11thedition.McGrawHill,NewYork.