merged (6)

of 36/36
PEMANFAATAN ENZIM PAPAIN GETAH PEPAYA GUNA MELUNAKKAN DAGING KARYA TULIS ILMIAH Karya Tulis Ini Digunakan Untuk Mengikuti Lomba Penulisan Kreatifitas Masyarakat di Universitas Jenderal Soedirman Solo, Jawa Tengah Diusulkan Oleh: Dessy Syafira (Ketua) (13141 008) Muhamad Nawasi (Anggota) (141510 026) Yuliyanti (Anggota) (13141 073) PROGRAM STUDI IPA (Ilmu Pengetahuan Alam) SMA NEGERI 8 KABUPATEN TANGERANG BANTEN 2015

Post on 08-Nov-2015

31 views

Category:

Documents

5 download

Embed Size (px)

DESCRIPTION

Penelitian SMAN 8 Kab. Tangerang

TRANSCRIPT

  • PEMANFAATAN ENZIM PAPAIN GETAH PEPAYA GUNA

    MELUNAKKAN DAGING

    KARYA TULIS ILMIAH

    Karya Tulis Ini Digunakan Untuk Mengikuti Lomba Penulisan Kreatifitas

    Masyarakat di Universitas Jenderal Soedirman Solo, Jawa Tengah

    Diusulkan Oleh:

    Dessy Syafira (Ketua) (13141 008)

    Muhamad Nawasi (Anggota) (141510 026)

    Yuliyanti (Anggota) (13141 073)

    PROGRAM STUDI IPA (Ilmu Pengetahuan Alam)

    SMA NEGERI 8 KABUPATEN TANGERANG

    BANTEN

    2015

  • i

    KATA PENGANTAR

    Keanugerahan dari Allah SWT yang maha agung menjadi kekuatan

    kepada penulis untuk segera menyelesaikan karya tulis ini tepat pada waktunya.

    Oleh karena itu, tiada kata yang terindah selain ucapan syukur karena penulis

    dapat menyelesaikan karya tulis ini yang berjudul PEMANFAATAN ENZIM PAPAIN GETAH BUAH PEPAYA UNTUK MELUNAKKAN DAGING karya tulis ini diajukan untuk mengikuti Lomba Penulisan Kreatifitas Masyarakat di

    Universitas Jenderal Soedirman Solo, Jawa Tengah.

    Di dalam penulisan karya tulis ini, penulis merasa bahwa banyak

    hambatan yang telah dihadapi. Namun, berkat bimbingan dan dukungan dari

    berbagai pihak, hambatan hambatan tersebut dapat teratasi. Oleh karena itu,

    penulis mengucapkan terima kasih kepada:

    1. Drs. H. Dedi Heryadi, sebagai Kepala Sekolah SMA Negeri 8 Kabupaten Tangerang.

    2. Drs. Ardi, M.Pd., sebagai Kesiswaan SMA Negeri 8 Kabupaten Tangerang.

    3. Bambang Afianto, S.Pd., sebagai Wakil Kepala Sekolah bagian Kurikulum SMS Negeri 8 Kabupaten Tangerang.

    4. Sumantri, S.Pd. MM., sebagai Pembina OSIS SMA Negeri 8 Kabupaten Tangerang.

    5. Sunarsih, S.Pd., sebagai Pembimbing. 6. Ade Hidayat, S.Pd., sebagai Pembimbing. 7. Muhammad Rozikhin, sebagai Pembimbing. 8. Keluarga dan seluruh civitas SMA Negeri 8 Kabupaten Tangerang.

    Disamping itu, penulis menyadari bahwa karya tulis ini masih jauh dari

    kesempurnaan. Hal ini dapat diibaratkan Tak Ada Gading Yang Tak Retak. Oleh sebab itu, penulis juga mengharapkan saran dan kritik yang bersifat

    konstruktif demi penyempuraan karya tulis ini. Semoga karya tulis yang

    sederhana ini dapat bermanfaat, baik sebagai menjadi sumber informasi maupun

    sumber inspirasi, bagi para pembaca.

    Tangerang, 19 Mei 2015

    Penulis

  • ii

    DAFTAR ISI

    HALAMAN SAMPUL .......... i

    KATA PENGANTAR ......ii

    DAFTAR ISI ...iii

    BAB I PENDAHULUAN

    Latar Belakang ...............1

    Rumusan Masalah ..................2

    Tujuan ..... ..........2

    BAB II METODOLOGI PENELITIAN

    Jenis Penelitian .. ...........4

    Variabel . ...........4

    Waktu dan Tempat Penelitian ... ...........4

    Instrumen Penelitian ........... .5

    Jenis Data ... ..........5

    Rancangan Penulisan . ..........5

    Teknik Pengumpulan Data . ..........6

    Teknik Analisis .. ...........6

    Teknik Penarikan Kesimpulan ... ...........7

    BAB III HASIL DAN PEMBAHASAN

  • iii

    Alat dan Bahan ..............8

    Prosedur Penelitian ............8

    Hasil Penelitian.......................8

    Pembahasan .................................................................................................14

    BAB IV PENUTUP

    Kesimpulan ............16

    Saran............................................................................................................16

    DAFTAR PUSTAKA

  • 1

    PEMANFAATANENZIMPAPAINGETAHBUAHPEPAYAUNTUKMELUNA

    KKANDAGING

    ABSTRAK

    Penelitianinibertujuanuntukmengetahuikondisioptimumreaksienzimpapain

    getahbuahpepayauntukmelunakkandaging.Untukmencapaitujuandilakukan

    penelitiandilaboratoriumdenganpenahapansebagaiberikut:Penyediaangetahb

    uahpepaya,pengaktifanenzimprotease,perlakuanreaksienzimdalamberbagaivariasi,s

    uhu,konsentrasi,pengukuranproteinterlarutmenggunakanmetodeLowry,pengukuran

    kelunakanmenggunakanalatteksturometer.

    Datayangdiperolehdianalisissecaradeskriptif.Hasilyangdiperolehadalah:

    (1)Adaperbedaanbeberapaparameteraktifitasenzimdantingkatkelunakandagingolehp

    erlakuandengandantanpapengaktif.

    (2)EnzimpapaindenganpengaktifoptimumbekerjamelunakkandagingpadapH5,5;suh

    u500

    C;konsentrasienzim0,05gram;dankonsentrasisubstrat1,0gramdenganaktifitassp

    esifiksebesar50,21x10-3

    unit/mgserta tingkatkelunakan

    7,50g/mm3

    . (3)Enzimpapaintanpazatpengaktifkanoptimumbekerjamelunakkandagi

    ngpadapH5,5;suhu500C;

    konsentrasienzim0,075gramdankonsentrasisubstrat1,0denganaktifitasspesifiksebesa

    r41,6068x10-3unit/mgsertatingkatkelunakansebesar8,4189g/mm3.Hasil

    yangdiperolehmemberikanindikasipadapemanfaatangetahbuahpepayauntukmenghe

    matenergipadaprosespengolahandaging. Katakunci:Enzim Papain,Aktifitasenzim, Tingkatkelunakandaging

  • 2

    BAB I

    PENDAHULUAN

    A. Latar Belakang

    Krisisenergimerupakanmasalahyangmelandaduniasaatini,betapatidak,cadangan

    minyakbumisemakinmenipissementarakonsumenenergisemakinbertambah.Salah-

    satudampakyangmelandabangsaIndonesiaadalahhargaBBM(bahanbakarminyak)yan

    gtidakstabildancenderungnaik.PemerintahtidaklagimampumempertahankanBBMber

    subsidiyangumumnyasangatdiperlukanolehmasyarakat.HargaBBMmerupakansalah-

    satutolakukurperekonomiandunia.

    Banyakupayayangdisarankanolehpemerintah,misalnyamelaluisloganhematen

    ergihematbiaya.Melaluihematenergi,cadanganminyakbumiakandapatdipertahankan

    .Upayahematenergipadaprinsipnyadapatdilakukanolehsemualapisanmasyarakat.Pem

    akaianenergiuntukmemasakdidapurdapatditekanbiayanyamelaluipemanfaatanproses

    kimiayangsehat.Misalnya,energiuntukmemasakdagingyangkayaseratproteindapatdik

    urangimelaluipemanfaatanteknologienzim.

    Pemanfaatanbioteknologiuntukmengatasikrisisenergidanjugapengolahanlimba

    htelahbanyakdilakukan.Silabantahun1994telahmencobamelakukanpengolahanlimba

    hserbukgergajikayumenjadigula,meskipunhasilnyasangatsedikit(Silaban,1994).Tahu

    n2010,limbahampaskelapatelahdigunakansebagaimediauntukmemproduksitoksoflav

    indanhasilnyasangatmemuaskan(Silaban,2010).Penelitiyangsamajugatelahmencoba

    memanfaatkanubijalarputihuntukmemproduksibioetanolmelaluifermentasi(Rahmad

    anidanSilaban,2011).

    Surveypendahuluanyangdilakukankeberbagaidapurwarungmakan,rumahmaka

    nbahkanrestoranmenunjukkanbahwauntukmemasak10kilorendangdagingsapidiperlu

  • 3

    kanwaktusekitar4jamdenganpemanasanyangterusmenerus,baikpakaikayubakar,kom

    pormasakmaupunkomporgas.Prosespemasakandengansuhuyangtinggidanwaktuyang

    lamainihanyauntukmemperolehdagingyanglunak,empuk,mudahdikunyahataumudah

    dicerna.Padahal,prosespemanasansuhutinggidanwaktulamainidapatmenurunkannilai

    gizidisampingmemerlukanenergiyangjumlahnyabanyak(Silaban,2009).

    B. Rumusan Masalah

    Berdasarkan latar belakang diatas, rumusan masalah yang muncul adalah

    bagaimana cara kerja enzim papain getah pepaya dalam melunakan daging?

    C. Tujuan

    Berdasarkan rumusan masalah diatas tujuan penelitian ini yaitu untuk

    mengetahui cara kerja dari enzim papain dari getah pepaya dalam hal melunakkan

    daging.

    BAB II

    TINJAUAN PUSTAKA

  • 4

    A. Tanaman Pepaya

    Pepaya (Carica papaya L.) merupakan tanaman yang berasal dari Amerika

    tropis.Buah pepaya tergolong buah yang popular dan digemari oleh hampir seluruh

    penduduk penghuni bumi ini.Batang, daun, dan buah pepaya muda mengandung

    getah berwarna putih. Getah ini mengandung suatu enzim pemecah protein atau

    enzim proteolitik yang disebut papain ( Kalie, 2010 ).

    Dalam sistematika (taksonomi) tumbuh-tumbuhan, tanaman pepaya (Carica

    papaya L.) diklasifikasikan sebagai berikut:

    Kingdom : Plantae

    Divisio : Spermatophyta

    Subdivisio : Angiospermae

    Class : Dicotyledonae

    Ordo : Caricales

    Familia : Caricaceae

    Genus : Carica

    Species : Carica papaya L.

    (Sumber: Hutapea, 2011)

  • 5

    Tabel 2.1. Komposisi gizi buah pepaya masak, pepaya muda, dan daun

    pepaya per 100 gram

    Zat Gizi Buah pepaya masak Buah pepaya muda Daun Pepaya

    Energi (kkal) 46 26 79

    Protein (g) 0,5 2,1 8,0

    Lemak (g) 0 0,1 2,0

    Karbohidrat (g) 12,2 4,9 11,9

    Kalsium (mg) 23 50 353

    Fosfor (mg) 12 16 63

    Besi (mg) 1,7 0,4 0,8

    Vitamin A (SI) 365 50 18.250

    Vitamin B1 (mg) 0,04 0,02 0,15

    Vitamin C (mg) 78 19 140

    Air (g) 86,7 92,3 75,4

    (Sumber: Direktorat Gizi DepkesRI, 2012)

    Hampir semua bagian tanaman pepaya dapat dimanfaatkan, mulai dari

    daun, batang, akar, maupun buah. Getah pepaya yang sering disebut sebagai

    papain dapat digunakan untuk berbagai macam keperluan, antara lain : penjernih

    bir, pengempuk daging, bahan baku industri penyamak kulit, serta digunakan

    dalam industri farmasi dan kosmetik ( Warisno, 2003 ).

    B. Kandungan Kimia pada Getah Pepaya

    Getah pepaya cukup banyak mengandung enzim yang bersifat proteolitik

    (pengurai protein ). Sehingga tepung getah pepaya kering banyak digunakan oleh

    para pengusaha industri maupun ibu-ibu rumah tangga untuk mengolah berbagai

    macam produk (Warisno, 2003).

  • 6

    Dalam getah pepaya terkandung enzim-enzim protease yaitu papain dan

    kimopapain. Kadar papain dan kimopapain dalam buah pepaya muda berturut-

    turut 10 % dan 45%. Lebih dari 50 asam amino terkandung dalam getah pepaya

    kering itu antara lain asam aspartat, treonin, serin, asam glutamat, prolin, glisin,

    alanin, valine, isoleusin, leusin, tirosin, phenilalanin, histidin, lysin, arginin,

    tritophan, dan sistein. Papain merupakan satu dari enzim paling kuat yang

    dihasilkan oleh seluruh bagian tanaman papaya. kecuali biji dan akar. Buah

    merupakan bagian tanaman yang menghasilkan getah paling banyak (Kalie,

    1999).

    Getah papaya termasuk enzim proteolitik dimana dapat memecah senyawa

    protein menjadi pepton. Contoh enzim proteolitik lainnya adalah bromeilin pada

    nanas, renin pada sapi dan babi. Pemakaiannya masih jarang lantaran sulit

    diekstrak dan aktivitasnya lebih rendah dibanding papain.

    C. Protein

    Protein merupakan salah satu kelompok bahan makronutrien. Tidak seperti

    bahan makronutrien lainnya (karbohidrat, lemak), protein ini berperan lebih

    penting dalam pembentukan biomolekul daripada sumber energi. Namun

    demikian apabila organisme sedang kekurangan energi, maka protein ini dapat

    juga di pakai sebagai sumber energi. Keistimewaan lain dari protein adalah

    strukturnya yang selain mengandung N, C, H, O, kadang mengandung S, P, dan

    Fe (Sudarmadji, 2009). Protein adalah suatu zat makanan yang sangat penting

    bagi tubuh, karena zat ini disamping berfungsi sebagai zat pembangun dan

    pengatur, Protein adalah sumber asam- asam amino yang mengandung unsur C,

    H, O dan N yang tidak dimiliki oleh lemak atau karbohidrat. Molekul protein

    mengandung pula posfor, belerang dan ada jenis protein yang mengandung unsur

    logam seperti besi dan tembaga (Budianto, 2009).

    Protein mempunyai berat molekul antara lima ribu hingga beberapa juta.

    Protein terdiri atas rantai-rantai asam amino, yang terikat satu sama lain dalam

    ikatan peptida. Asam amino yang terdiri atas unsur-unsur karbon, hidrogen,

    oksigen dan nitrogen ; beberapa asam amino disamping itu mengandung unsur-

  • 7

    unsur fosfor, besi, iodium, dan cobalt. Unsur nitrogen adalah unsur utama protein,

    karena terdapat di dalam semua protein akan tetapi tidak terdapat di dalam

    karbohidrat dan lemak. Unsur nitrogen merupakan 16% dari berat protein.

    Molekul protein lebih kompleks daripada karbohidrat dan lemak dalam hal berat

    molekul dan keanekaragaman unit-unit asam amino yang membentuknya

    (Almatsier, 2009).

    D. Struktur dan Sifat Protein

    Molekul protein merupakan rantai panjang yang tersusun oleh mata rantai

    asam-asam amino. Dalam molekul protein, asam-asam amino saling dirangkaikan

    melalui reaksi gugusan karboksil asam amino yang satu dengan gugusan amino

    dari asam amino yang lain, sehingga terjadi ikatan yang disebut ikatan peptida.

    Ikatan pepetida ini merupakan ikatan tingkat primer. Dua molekul asam amino

    yang saling diikatkan dengan cara demikian disebut ikatan dipeptida. Bila tiga

    molekul asam amino, disebut tripeptida dan bila lebih banyak lagi disebut

    polipeptida. Polipeptida yang hanya terdiri dari sejumlah beberapa molekul asam

    amino disebut oligopeptida. Molekul protein adalah suatu polypeptida, dimana

    sejumlah besar asam-asam aminonya saling dipertautkan dengan ikatan peptida

    tersebut (Gaman dan Sherrington, 2012).

    Protein merupakan molekul yang sangat besar, sehingga mudah sekali

    mengalami perubahan bentuk fisik maupun aktivitas biologis. Banyak faktor yang

    menyebabkan perubahan sifat alamiah protein misalnya : panas, asam, basa,

    pelarut organik, pH, garam, logam berat, maupun sinar radiasi radioaktif.

    Perubahan sifat fisik yang mudah diamati adalah terjadinya penjendalan (menjadi

    tidak larut) atau pemadatan (Sudarmadji, 2009). Ada protein yang larut dalam air,

    ada pula yang tidak larut dalam air, tetapi semua protein tidak larut dalam pelarut

    lemak seperti misalnya etil eter. Daya larut protein akan berkurang jika

    ditambahkan garam, akibatnya protein akan terpisah sebagai endapan.

    Apabila protein dipanaskan atau ditambahkan alkohol, maka protein akan

    menggumpal. Hal ini disebabkan alkohol menarik mantel air yang melingkupi

    molekul-molekul protein. Adanya gugus amino dan karboksil bebas pada ujung-

  • 8

    ujung rantai molekul protein, menyebabkan protein mempunyai banyak muatan

    dan bersifat amfoter (dapat bereaksi dengan asam maupun basa). Dalam larutan

    asam (pH rendah), gugus amino bereaksi dengan H+, sehingga protein bermuatan

    positif. Bila pada kondisi ini dilakukan elektrolisis, molekul protein akan bergerak

    kearah katoda. Dan sebaliknya, dalam larutan basa (pH tinggi) molekul protein

    akan bereaksi sebagai asam atau bermuatan negatif, sehingga molekul protein

    akan bergerak menuju anoda (Winarno, 2012).

    E. Jenis-jenis Protein

    Klasifikasi protein dapat dilakukan dengan berbagai cara :

    1. Berdasarkan bentuknya :

    a. Protein fibriler (skleroprotein)

    Adalah protein yang berbentuk serabut. Protein ini tidak larut dalam

    pelarut-pelarut encer, baik larutan garam, asam basa ataupun alkohol.

    Contohnya kolagen yang terdapat pada tulang rawan, miosin pada

    otot, keratin pada rambut, dan fibrin pada gumpalan darah.

    b. Protein globuler (steroprotein)

    Adalah protein yang berbentuk bola. Protein ini larut dalam larutan

    garam dan asam encer, juga lebih mudah berubah dibawah pengaruh

    suhu, konsentrasi garam, pelarut asam dan basa dibandingkan protein

    fibriler. Protein ini mudah terdenaturasi, yaitu susunan molekulnya

    berubah diikuti dengan perubahan sifat fisik dan fisiologiknya seperti

    yang dialami oleh enzim dan hormon.

    2. Berdasarkan kelarutannya, protein globuler dapat dibagi dalam

    beberapa grup:

    a. Albumin yaitu, larut dalam air dan terkoagulasi oleh panas.

    Contohnya albumin telur, albumin serum, dan laktalbumin dalam

    susu.

    b. Globulin yaitu, tidak larut dalam air, terkoagulasi oleh panas, larut

    dalam larutan garam encer, mengendap dalam larutan garam

  • 9

    konsentrasi tinggi. Contohnya adalah legumin dalam kacang-

    kacangan.

    c. Glutelin

    Tidak larut dalam pelarut netral tetapi larut dalam asam atau basa

    encer. Contohnya glutelin gandum.

    d. Prolamin atau gliadin

    Larut dalam alkohol 70-80% dan tak larut dalam air maupun

    alkohol absolut. Contohnya prolamin dalam gandum.

    e. Histon

    Larut dalam air dan tidak larut dalam amoniak encer. Contohnya

    adalah histon dalam hemoglobin.

    f. Protamin

    Protein paling sederhana dibandingkan protein-protein lainnya,

    tetapi lebih kompleks dari pada protein dan peptida, larut dalam air

    dan tidak terkoagulasi oleh panas.Contohnya salmin dalam ikan

    salmon (Budianto, 2009).

    3. Berdasarkan hasil hidrolisa total suatu protein dikelompokkan sebagai

    berikut:

    a. Asam amino esensial yaitu asam amino yang tidak dapat disintesa

    oleh tubuh dan harus tersedia dalam makanan yang dikonsumsi.

    Pada orang dewasa terdapat delapan jenis asam amino esensial:

    Lisin, Threonin, Leusin, Phenylalanin, Isoleusin, Methionin, Valin,

    dan Tryptophan. Sedangkan untuk anak-anak yang sedang tumbuh,

    ditambahkan dua jenis lagi ialah Histidin dan Arginin.

    b. Asam amino non esensial yaitu asam amino yang dapat disintesa

    oleh tubuh. Ialah: Alanin, Tirosin, Asparagin, Sistein, Asam

    aspartat, Glisin, Asam glutamat, Serin, Glutamin, dan Prolin

    (Sediaoetama, 2005).

  • 10

    F. Tingkat Degradasi Protein

    Protein dapat dibedakan menurut tingkat degradasinya, yaitu tingkat

    permulan denaturasi:

    1. Protein alami dalah protein dalam keadaan seperti protein dalam sel.

    2. Turunan protein yang merupakan hasil degradasi protein pada tingkat

    permulaan denaturasi. Dapat dibedakan sebagai protein turunan primer

    (protean, metaprotein) dan protein turunan sekunder (proteosa, pepton, dan

    peptida).

    a. Protein primer merupakan hasil hidrolisis yang ringan, sedangkan

    protein sekunder adalah hasil hidrolisis yang berat.

    b. Protean adalah hasil hidolisis oleh air, asam encer atau enzim yang

    bersifat tak larut. Contohnya adalah miosan dan edestan.

    c. Metaprotein merupakan hasil hidrolisi lebih lanjut oleh asam dan

    alkali dan larut dalam asam dan alkali encer tetapi tak larut dalam

    larutan-larutan garam netral. Contohnya asam albuminat dan alkali

    albuminat.

    d. Proteosa, bersifat larut dalam air dan tidak terkaogulasi oleh panas.

    Diendapkan oleh larutan (NH4)2SO4 jenuh.

    3. Pepton merupakan hasil hidrolisis yang larut dalam air tak terkaoagulasi

    oleh panas dan tidak mengalami salting out dengan ammonium sulfat

    tetapi mengendap oleh preaksi alkalid seperti asam fosfo tungstat

    (Winarno, 2002).

    G. Enzim

    Kata enzim diperkenalkan oleh Kuhne pada tahun 1878 untuk suatu zat

    yang bekerja pada suatu substrat. Kata enzim berasal dari bahasa Yunani yang

    berarti di dalam sel. Kuhne menjelaskan bahwa enzim bukan suatu sel tetapi

    terdapat di dalam sel. Definisi yang dikemukakan adalah enzim merupakan

    protein yang mempunyai daya katalitik karena aktivitas spesifiknya (Dixon,

    2009). Enzim adalah protein yang diproduksi dari sel hidup dan digunakan oleh

    sel-sel untuk mengkatalisis reaksi kimia yang spesifik.

  • 11

    Enzim memiliki tenaga katalitik yang luar biasa dan biasanya lebih besar

    dari katalisator sintetik. Spesifitas enzim sangat tinggi terhadap substratnya.

    Tanpa pembentukan produk samping enzim merupakan unit fungsional untuk

    metabolisme dalam sel, bekerja menurut urutan yang teratur. Sistem enzim

    terkoordinasi dengan baik menghasilkan suatu hubungan yang harmonis diantara

    sejumlah aktivitas metabolic yang berbeda (Shahib, 2002).

    Klasifikasi enzim didasarkan pada jenis reaksi yang dikatalisisnya, seperti

    direkomendasikan oleh Commision on Enzyme of the International Union of

    Biochemistry ( CEIUB ). Menurut sistem ini, enzim dibagi lagi menjadi beberapa

    sub golongan. Penamaan enzim diawali dengan nama substrat, diikuti oleh macam

    reaksi yang dikatalisis dan akhiran-ase (Muchtadi et al, 2002).

    Tabel 2.2. Golongan enzim dan reaksi yang dikatalisisnya

    No Kelas Utama Jenis Reaksi yang dikatalis

    1. Oksidoreduktase Pemindahan electron

    2. Transferase Reaksi pemindahan gugus fungsional

    3. Hidrolase Reaksi hidrolisis (pemindahan gugus

    fungsional ke air)

    4. Liase

    Penambahan gugus ke ikatan ganda

    atau

    sebaliknya

    5. Isomerase Pemindahan gugus di dalam molekul

    menghasilkan isomer

    6. Ligase Pembentukan ikatan C-C, C-S, C-O dan

  • 12

    C-

    N oleh reaksi kondensasi yang

    berkaitan

    dengan penguraian ATP

    (Sumber : Lehninger, 2013 )

    Enzim dikatakan sebagai suatu kelompok protein yang berperan sangat

    penting dalam aktivitas biologis.Dalam jumlah yang sangat kecil, enzim dapat

    mengatur reaksi tertentu sehingga dalam keadaan normal tidak terjadi

    penyimpangan-penyimpangan hasil akhir reaksinya. Enzim ini akan kehilangan

    aktivitasnya akibat panas, asam atau basa kuat, pelarut organik, atau pengaruh

    lain yang bisa menyebabkan denaturasi protein. Enzim dikatakan mempunyai

    sifat sangat khas, karena hanya bekerja pada substratnya (Girindra, 2010).

    Hampir semua enzim yang telah diketahui adalah protein sehingga enzim

    merupakan biokatalisator yang dibentuk dari molekul protein terutama yang

    berbentuk globulan. Enzim yang berperan penting dalam hidrolisis protein ada 2

    yaitu protease yang dapat memecah ikatan protein menjadi peptide, dan peptidase

    yang dapat memecah ikatan peptida menjadi asam amino. Dengan kombinasi

    protease dan peptidase dapat memecah 90% ikatan peptide (Fennema, 2005).

    H. Enzim Papain

    Papain adalah suatu zat ( enzim ) yang dapat diperoleh dari getah tanaman

    pepaya dan buah pepaya muda. Getah pepaya mengandung sebanyak 10% papain,

    45% kimopapain dan lisozim sebesar 20% (Winarno, 1986). Getah pepaya

    tersebut terdapat hampir di semua bagian tanaman pepaya, kecuali bagian akar

    dan biji. Kandungan papain paling banyak terdapat dalam buah pepaya yang

    masih muda (Warisno, 2003 ).

    Berdasarkan klasifikasi the international union of biochemistry, papain

    termasuk enzim hidrolase yang mengkatalisis reaksi hidrolisis suatu substrat

    dengan pertolongan molekul air. Aktivitas katalisis papain dilakukan melalui

  • 13

    hidrolisis yang berlangsung pada sisi-sisi aktif papain (Wong, 2009 diacu dalam

    Budiman, 2003). Aktivitas enzim papain cukup spesifik karena papain hanya

    dapat mengkatalisis proses hidrolisis dengan baik pada kondisi pH serta suhu

    dalam kisaran waktu tertentu. Papain mempunyai kondisi pH 5,0 7,0, tetapi

    untuk pH optimumnya tergantung pada substrat (Muchtadi et al., 2002). Suhu

    optimal papain sendiri adalah 50-60oC (Winarno, 2006).

    Sebagai enzim proteolitik, papain memiliki nilai ekonomi tinggi dan

    banyak digunakan dalam industri besar. Meskipun telah diketahui ada beberapa

    enzim protease yang dihasilkan dari tanaman lain, ternyata papain merupakan

    enzim yang paling banyak dan sering digunakan. Oleh karenanya, potensi pasar

    papain dalam perdagangan dunia masih cukup besar (Kalie, 2009).

    I. Jenis-jenis Enzim Papain

    Dalam dunia perdagangan, dikenal dua macam papain, yaitu papain kasar

    (crude papain) dan papain murni (crystal papain). Papain kasar (crude papain)

    adalah getah pepaya yang telah dikeringkan, kemudian dihaluskan hingga menjadi

    berbentuk tepung. Papain murni (crystal papain) adalah hasil pemisahan dan

    pemurnian papain kasar menjadi empat macam protein proteolitik, yaitu papain,

    chimopapain A, chimopapain B, dan papain peptidase A (Warisno, 2003).

    Oleh karena sifat chimopapain A dan chimopapain B sifatnya agak mirip,

    maka keduanya dapat disebut sebagai chimopapain saja. Keempat jenis enzim

    proteolitik tersebut biasanya disebut papain saja atau papain kasar. Jumlah papain

    kasar akan lebih banyak dari papain murni, tetapi sifat daya enzimatis papain

    kasar lebih rendah dari papain murni. Hal tersebut dikarenakan aktivitas enzim

    sebanding dengan kemurnian enzim tersebut, dimana semakin tinggi tingkat

    kemurnian suatu enzim maka aktivitasnya akan semakin meningkat.

    J. Manfaat Enzim Papain

    Berbagai penelitian kini sedang dilakukan dalam usaha pemanfaatan

    enzim papain atau enzim sejenis lainnya pada bidang-bidang industri lain yang

    belum digunakan. Prospek pemasaran papain tampaknya kian cerah. Papain dapat

  • 14

    digunakan dalam industri pengolahan daging. Daging dari hewan tua pun dapat

    menjadi lunak kalau menggunakan papain. Biasanya daging hewan tua bertekstur

    sangat keras (alot). Dengan demikian hadirnya papain dapat menaikkan ekspor

    atau impor hewan tua yang sebelumnya tidak laku dipasaran. Papain sebagai

    pelunak daging (meat tenderizer) banyak diperdagangkan dalam kemasan kecil

    sesuai kebutuhan rumah tangga. Penggunaan papain pada daging akan menambah

    nikmat rasa daging. Daging akan menjadi empuk sehingga mudah dipotong,

    digigit, dikunyah, dan nilai gizi daging akan meningkat (Kalie, 2009 ).

    Menurut Tekno Pangan dan Agroindustri (2008), manfaat lain dari papain

    adalah:

    1. Papain dapat digunakan sebagai bahan penghancur sisa atau buangan hasil

    industri pengalengan ikan menjadi bubur ikan atau konsentrasi protein

    hewani.

    2. Pada industri penyamakan kulit, papain sering digunakan untuk

    melembutkan kulit. Kulit yang lembut dapat dibuat sarung tangan, jaket,

    bahkan kaus kaki.

    3. Papain sangat berperan dalam industri bir atau sering disebut sebagai obat

    antidingin atau stabililiser.

    4. Papain dapat juga digunakan sebagai bahan aktif dalam preparat farmasi

    seperti untuk obat gangguan pencernaan protein, dispesia, gastritis, serta

    obat cacing.

    5. Papain dapat digunakan sebagai bahan aktif dalam pembuatan krim

    pembersih kulit, terutama muka. Ini disebabkan papain dapat melarutkan

    sel-sel mati yang melekat pada kulit dan sukar terlepas dengan cara fisik.

    6. Papain dijadikan bahan aktif dalam pembuatan pasta gigi. papain dalam

    pasta gigi dapat membersihkan sisa protein yang melekat pada gigi. Sisa

    protein ini sering menimbulkan bau busuk bila terlalu lama dibiarkan.

    7. Bahan pencuci kain sutera (deterjen) untuk membuang serat yang

    berlebihan.

    8. Bahan pencuci lensa sehingga menjadi lembut .

  • 15

    9. Bahan Pelarut geltin dalam proses perolehan kembali (recovery) perak dari

    film yang sudah tidak terpakai.

    10. Bahan perenyah dalam pembuatan kue kering seperti cracker.

    11. Bahan penggumpal susu pada pembuatan keju sehingga menghilangkan

    keraguan sebagian konsumen tentang pemakaian rennin dari usus babi

    untuk menggumpalkan susu.

    K. Penentuan Aktivitas Enzim

    Penentuan aktivitas enzim dapat dilakukan dengan mengukur kecepatan

    reaksi yang dikatalitis oleh enzim tersebut. Dalam keadaan norma, kecepatan

    reaksi yang diukur sesuai dengan aktivitas enzim yang ada. Satu unit aktivitas

    enzim didefinisikan sebagai jumlah enzim yang menyebabkan perubahan

    absorban 0,001/menit pada kondisi optimumnya, berarti perubahan substrat dari

    suatu mikromalekul produk meningkatkan kenaikan absorban sebesar 0,001.

    Aktivitas spesifik adalah jumlah unit enzim per milligram protein atau suatu

    ukuran kemurnian enzim menjadi maksimum dan tetap jika enzim sudah berada

    dalam keadaan murni (Lidya, dkk., 2000).

    Menurut Soedarmadji (2002) aktivitas enzim dipengaruhi oleh beberapa

    faktor antara lain:

    1. Konsentrasi Substrat

    Dalam contoh, berbanding lurus dengan konsentasi. Pada konsentrasi

    substrat tertentu perbandingan kecepatan enzim meningkat.

    2. Pengaruh pH

    Aktivitas enzim sangat bergantung pada pH dimana ia berada. Setiap

    enzim mempunyai pH optimum yang berarti konsentrasi tertentu dimana

    reaksi enzim berada dalam keadaan maksimal. pH terbaik adalah yang

    mendekati netral.

    3. Konsentrasi enzim

    Pengaruh konsentrasi enzim pada laju aktivitas enzim dengan derajat

    pemurnian tinggi dalam densitas tertentu terhadap suatu hubungan linier

    diantara jumlah enzim dan taraf aktivitas enzim.

  • 16

    4. Temperatur

    Reaksi kimia baik katalis / nonkatalis menjadi cepat reaksinya bila suhu

    dinaikan. Pada reaksi katalis enzim umumnya hanya berlaku

    sampai 60oC. Di atas suhu ini akan menonaktifkan enzim. Minimumnya

    enzim menjadi lambat dan terhenti pada 70oC80oC.

    5. Racun Enzim

    Senyawa kimia tertentu secara selektif menghambat kerja enzim spesifik.

    Contoh : penicillin akan membatasi tempat aktif suatu enzim yang

    digunakan oleh banyak bakteri untuk membuat dinding selnya.

    L. Daging

    Daging adalah sekumpulan otot yang melekat pada kerangka. Istilah

    daging dibedakan dengan karkas. Daging didefinisikan juga sebagai semua

    jaringan hewan dan semua produk hasil pengolahan jaringan-jaringan tersebut

    yang sesuai untuk dimakan serta tidak menimbulkan gangguan kesehatan bagi

    yang memakannya. Unit esensial jaringan urat daging adalah serat yang terdiri

    dari bentukan elemen-elemen protein, miofibril, larutan yang ada di antaranya,

    sarkoplasma, jaringan tubulus yang halus, sarkoplasmik retikulum dan serat yang

    terikat oleh sarkolema (Lawrie, 2011).

    M. Komposisi Kimia Daging

    Daging sebagai sumber protein hewani memiliki nilai hayati (biological

    value) yang tinggi, mengandung 19% protein, 5% lemak, 70% air, 3,5% zat-zat

    non protein dan 2,5% mineral dan bahan-bahan lainnya (Forrest et al, 2002).

    Komposisi daging menurut Lawrie (1991) terdiri atas 75% air, 18% protein, 3,5%

    lemak dan 3,5% zat-zat non protein yang dapat larut. Secara umum, komposisi

    kimia daging terdiri atas 70% air, 20% protein, 9% lemak dan 1% abu. Jumlah ini

    akan berubah bila hewan digemukkan yang akan menurunkan persentase air dan

    protein serta meningkatkan persentase lemak (Romans et al, 1994). Daging

    merupakan sumber utama untuk mendapatkan asam amino esensial. Asam amino

  • 17

    esensial terpenting di dalam otot segar adalah alanin, glisin, asam glutamat, dan

    histidin. amino (Lawrie, 2001).

    Kandungan lemak pada daging menentukan kualitas daging karena lemak

    menentukan cita rasa dan aroma daging. Keragaman yang nyata pada komposisi

    lemak terdapat antara jenis ternak memamah biak dan ternak tidak memamah biak

    adalah karena adanya hidrogenasi oleh mikroorganisme rumen (Soeparno, 2008).

    Tabel 2.3. Komposisi zat gizi beberapa jenis daging per 100 g bahan

    Zat Gizi Daging

    Sapi Kerbau Ayam

    Air (g) 66 84 0

    Protein (g) 18,8 18,7 18,2

    Energi (kal) 207 84 302

    Lemak (g) 14 0,5 25

    Kalsium (mg) 11 7 14

    Besi (mg) 2,8 2 1,5

    Vitamin A (SI) 30 0 810

    ( Sumber: Hasbullah, 2004)

    N. Pengempukan Daging

    Salah satu penilaian mutu daging adalah sifat keempukkan daging yang

    dinyatakan dengan sifat mudah dikunyah.Keempukkan daging berhubungan

    dengan komposisi daging itu sendiri, yaiut berupa jaringan pengikat, serabut

    daging, serta sel-sel lemak yang ada diantara sel serabut daging.Kualitas daging

    dipengaruhi oleh factor sebelum dan sesudah pemotonggan.Faktor sebelum

    dipengaruhi genetic, spesies, bangsa, tipe ternak, jenis kelamin, umur, pakan

    ternak termasuk bahan aditif (hormone, antibiotik dan mineral).Faktor setelah

    pemotongan antara lain meliputi metode pelayuan, stimulasi listrik, metode

  • 18

    pemasakan, pH, bahan tambahan termasuk enzim pengempuk daging, hormon dan

    antibiotika, lemak intramuskular, metode penyimpanan dan preservasi, macam

    otot daging dan lokasi otot daging.

    Keempukan daging bervariasi sesuai dengan jenis otot atau letak daging

    pada karkas. Contoh, daging jenis has dalam lebih empuk dibanding daging

    sengkel karena adanya perbedaan jaringan ikat pada jenis daging tersebut. Has

    dalam memiliki jaringan ikat yang lebih sedikit dibandingkan dengan sengkel.

    Jumlah jaringan ikat berkaitan dengan fungsi otot pada ternak hidup.Sengkel

    terutama digunakan dalam pergerakan sehingga memiliki jaringan ikat lebih

    banyak. Sementara itu, has dalam hanya mendukung fungsi ternak sehingga

    jaringan ikatnya lebih sedikit (Balai Besar Penelitian dan Pengembangan

    Pascapanen Pertanian, 2010).

    Penggunaan enzim untuk pengempukkan daging telah lama dilakukan.

    Nenek moyang kita sudah biasa menggunakan daun papaya untuk membungkus

    daging agar kenyal, namun mereka belum paham apa yang menyebabkan daging

    itu lunak bila dibungkus dengan daun papaya. Kini pengempukkan daging sudah

    maju yaitu dengan menggunakan enzim proteolitik.

    Secara biokimia, pelunakkan daging dapat dianggap sebagai proses

    degradasi protein struktur/serat atau berubahnya struktur kuartener menjadi

    struktur sederhana. Salah satu cara untuk mengubah struktur ini adalah melalui

    hidrolisis dengan bantuan enzim proteolitik. Reaksi hidrolisis protein menjadi

    pepton-pepton dapat dianalisis berdasarkan aktivitas enzim proteolitik. Oleh

    sebab itu tingkat kelunakkan daging dapat diasumsikan sebandig dengan

    aktivitas proteolitik yang diberikan (Winarno, 2006).

    Pelunakan daging secara fisika melalui pemasakan, merupakan proses

    perubahan struktur serat protein dari yang rigid menjadi amorf sehingga secara

    fisik dapat dilihat dari kenyal menjadi empuk, dari yang sulit dikunyah menjadi

    mudah. Pengempukan daging terkadang disertai dengan melarutnya sebagian

    protein artinya keempukan daging dapat dilihat dari 2 parameter, yakni

    berdasarkan uji fisik atas serat daging dan atau berdasarkan uji biokimia protein

    terlarut (Silaban, 2009).

  • 19

    Protein merupakan kelompok nutrien yang amat penting bagi tubuh

    manusia, sehingga disebut proteos artinya pemula. Senyawa ini didapatkan dalam

    sitoplasma pada semua sel hidup, baik binatang maupun tanaman. Protein

    mempunyai bermacam-macam fungsi bagi tubuh, yaitu sebagai enzim, zat

    pengatur pergerakan, pertahanan tubuh, alat pengangkut dan lain-lain (Winarno,

    2002).

    Pelunakan daging secara kimia dapat dilakukan melalui dua cara yakni

    secara enzimatis dan non enzimatis. Secara enzimatis menggunakan enzim

    protease sedangkan non enzimatis menggunakan asam. Pelunakan menggunakan

    asam ini sering dilakukan, baik di rumah maupun di restoran, hanya saja dapat

    mengurangi nilai gizinya karena sebagian protein dapat terdenaturasi atau rusak

    oleh asam.

    Pelunakan daging secara enzimatis hingga saat ini belum banyak

    dilakukan. Belum banyak penelitian yang mengkaji hal ini, karena keterbatasan

    sumber enzim dan juga keterbatasan referensi atas nilai gizi makanan yang diolah

    secara enzim. Menurut perkiraan,perlakuan enzimatis terhadap daging sebelum

    dimasak dapat menghemat energi atau bahan bakar. Karena, enzim protease

    terlebih dahulu akan mengubah struktur serat protein yang sukar larut. Padahal,

    daging yang telah direndam dengan ekstrak enzim protease tidak lagi dimasak

    berlama-lama untuk memperoleh daging yang empuk. Artinya, teknologi ini akan

    hemat energi.

    Banyak hewan, mikroba dan tanaman yang dikenal mampu menghasilkan

    enzim protease. Dalam getah buah papaya, terdapat enzim protease, juga dalam

    buah nenas dan mangga. Hanya saja getah dan enzim mangga ini jumlahnya

    sangat sedikit sehingga sulit untuk diproduksi dalam skala besar. Dalam upaya

    meningkatkan nilai gizi makanan dan mengatasi krisis energi, perlu dilakukan

    penelitian mencari sumberdaya alam yang baru dan dapat diperbaharui (renewable

    resources). Melalui penelitian ini, upaya dalam mengatasi krisis energi sebagian

    dapat teratasi, di samping meningkatkan nilai gizi yang bermuara pada

    kesejahteraan masyarakat.

  • 20

    BAB III

    METODOLOGI PENELITIAN

    A. Jenis Penelitian

    Jenis Penelitian yang digunakan adalah eksperimen, yaitu dengan

    mengamati langsung semua variabel yang ada untuk mendapatkan data yang

    akurat sehingga dapat menghasilkan informasi-informasi baru tentang

    pemanfaatan getah pepaya dan penggunaan enzim papain yang terdapat pada

    getah pepaya yang dapat diterapkan dalam kehidupan sehari-hari.

    B. Variabel

    Dalam penelitian ini penulis menggunakan getah pepaya yang memiliki

    kandungan enzim papain dimana variabel eksperimen adalah getah pepaya

    sebagai alternatif untuk melunakkan daging. Untuk variabel kontrol kita gunakan

    zat kimia.

    C. Waktu dan Tempat Penelitian

    Penelitian ini dilaksanakan selama 1 bulan sejak awal bulan maret sampai

    awal bulan april 2015. Peneitian ini dilaksanakan di Laboratorium IPA SMA

    Negeri 8 Kabupaten Tangerang.

    D. Instrumen Penelitian

    Dalam penelitian ini, instrumen yang digunakan adalah getah pepaya yang

    diamsumsikan mempunyai enzim papain yang dapat melunakkan daging.

    E. Jenis Data

    Jenis data, fakta atau informasi yang dikumpulkan dalam penelitian ini

    adalah data primer dan sekunder. Data primer adalah data yang berasal dari hasil

    eksperimen dan data sekunder berupa buku dan artikel. Buku dan artikel yang

    digunakan sebagian besar diperoleh dari buku-buku biokimia.

  • 21

    BAB IV

    HASIL DAN PEMBAHASAN

    A. AlatdanBahan

    Alat-

    alatyangdigunakandalampenelitianiniyaituwadahpenampunggetah,alatpenyadapg

    etah,freezedryer,mixer,lumpangdanalu,spektronik-

    20,cuvet,pHmeter,lemaries,thermometer,sentrifuge,tabungsentrifuge,pipetmikro,

    neracaanalitik,gelasukur,erlenmeyer,labuukur,gelasukur,pipettetes,dantabungrea

    ksi. Bahan-bahan

    yangdigunakanpadapenelitianiniadalahgetahbuahpapaya,dagingsapibagianleher,

    NaCl,NaOH,NaKC4H4O6.2H2O,Na2CO3,CuSO4.5H2O,asamtrikloroasetat(TC

    A),BovinSerumAlbumin(BSA),Na2HPO4.2H2O,C6H8O7.2H2O,Na3C6H5O7.

    H2O,Folin, Ciocalteau,danaquades.

    B. ProsedurKerja

    1. Penyediaanpreparatenzimpapain

    Buahpapayayangdigunakanadalahbuahmengkalyangtelahberumu

    r2-

    3bulan.Buahyangsedangdalammasapenyadapanharustetaptergantungpa

    dabatangpohonnya.

    Penyadapandilakukandenganmenorehkanalatsadappadakulitbuahdaripa

    ngkalmenujuujungbuah.Kedalamantorehanantara1-

    2mm,setelahditorehgetahditampungdenganwadah(TeknoPangandanAgr

    oindustri,2008).

    Getahpepayahasilpenyadapandicampurkandenganlarutanpengakti

    fyangterdiridari1literaquadesdan3gramNaCldimanaperbandingannyayai

    tu1:4,kemudiandiadukhinggameratadenganalatpengaduk(mixer)sampai

    membentukemulsigetahberwarnaputihsusuyangagakkental.Emulsigetah

  • 22

    dimasukkandalamwadahplastik,laludimasukkandalamfreezedryerpadas

    uhu-400

    Chinggaberbentukserpihan-

    serpihanberwarnaputihkekuningan,kemudianserpihanputihdigerushingg

    aberbentuktepung(papainkasar).Untukdiperbandingandilakukanpadaen

    zimtanpaperlakuan(tanpapengaktif).

    2. Penetapanaktifitasenzimpapaingetahbuahpepaya

    Halpertamayangdilakukanadalahstandarisasipreparatmenurutmetode

    Lowry.Kedalamtabungreaksidipipetsebanyak2mLlarutanbovineserumalb

    umin(BSA)100ppm.

    Ditambahkan5mLpereaksiC,segeradikocokdandibiarkanpadasuhukamars

    elama10menit.Kemudianditambahkan0,5mLpereaksiFolinCiocalteau,koc

    oksegeradanbiarkanpadasuhukamarselama30menit.Selanjutnyaserapandi

    bacapadapanjanggelombang600-

    800nm,hinggadiperolehserapanmaksimum.Halyangsamadilakukanpadabl

    anko,HanyapadablankolarutanBSAdigantidenganaquades(Silaban,1999).

    Aktifitaspreparatuntukmelunakkandagingdilakukanpadavariasitingka

    tkeasamandansuhu. Kedalam5tabungsentrifugedimasukkanmasing-

    masing1gramdagingbagianleheryang

    diiristipisberbentukkubusdanlarutanbufferdenganpH5padatabungA;pH5,5

    padatabungB;pH6padatabungC;pH6,5padatabungD;danpH7padatabungE

    .Laludibiarkanpadasuhukamarselama5menit.Kedalamsediaaniniditambah

    preparatenzimlaludikocokperlahan-

    lahandandibiarkankembaliselama30menit.Aktivitasenzimdihentikandeng

    anmenambahkan2mLlarutanTCA5%.Semuasediaandisentrifugapadakece

    patan3.400rpmselama10menit.

    Sebanyak2mLsupernatanyangdidugamengandungproteinterlarutdi

    ambilkemudiandiukurkadarnyamenggunakanmetodeLowry.PadapHoptim

    umyangdidapat,dilakukanreaksienzimpadavariasisuhuyaitu500C,550C,da

    n600C,variasikonsentrasienzimdenganrentang0,5g;0,25g;0,1g;0,075g;0,0

    5g;dan0,025gsertavariasikonsentrasisubstratdenganrentang0,5g;0,75g;1,0

  • 23

    g;1,25g;dan1,5g)

    AdapunkadarproteinterlarutnyadiukurdenganmetodeLowrydengan

    prosedursebanyak2mLsampeldalamtabungreaksiditambahi5mLreagenC,d

    ikocoksegeradandibiarkanpada

    suhukamarselama10menit.Kedalamsediaaniniditambahkan0,5mLpereaksi

    FolinCiocalteau,dikocokdandibiarkandalamsuhuoptimumhingga30menit.

    selanjutnyabacaabsorbansinyapadapanjanggelombangmaksimum.Sement

    araitu,aktifitasenzimjugadapatditentukandenganmengukurteksturdagingse

    telahreaksi(proteintaklarut)denganmenggunakanalatteksturometer.

    C. HasildanPembahasan

    1. Ketersediaanpreparatenzimpapaingetahbuahpepaya

    Getahpapayadisadapyangberumur2-

    3bulankarenapadamasatersebutgetahyang dihasilkan akan maksimal.

    Penyedapan getah tidak boleh terlalu dalam (maksimal 1-2 mm)

    dikarenakan penyadapan yang terlalu dalam akan merusak buah pepaya.

    Pencampuran

    getahdenganbahanNaClialahuntukmengaktifkangugusdisulfidapadapapai

    nsehinggaaktivitasdaripapainakanmeningkat(TeknoPangandanAgroindust

    ri,2008).Getahyangtelahdicampurdenganpengaktifdimixersehinggamemb

    entukemulsiputih.

    Emulsiputihdikeringkandenganmenggunakanfreezedryer,haltersebut

    dikarenakanpengeringandenganfreezedryerdapatmenjagakualitaspapaindi

    bandingkanpengeringandenganpanasmatahariyangdapatmembuatgetahpa

    paya(papain)mudahtercemarolehkotoran,debu,serangga,cendawandanbak

    terisehinggaakanmerusakkualitaspapainyangdihasilkan,selainitucahayam

    ataharidanudaramenyebabkangetahmembekudanpapainmenjaditeroksidas

    isehinggadayaenzimatispapainmenjadirusak,akibatnyakualitaspapainmen

    jadirendah(Kalie,1999).

    Dari30mLgetahpapaya(crudeenzyme)diperolehsekitar12,18grampapa

    inkering.Sebagaipembandingmakadigunakanlahenzimpapaintanpaperlak

  • 24

    uan(getahbuahpapaya).Enzimpapainyangaktifdankeringinitahanhingga2b

    ulanjikadisimpanpadasuhu270Csedangkanenzimtanpapengaktifanlangsun

    grusakdantakbertahanlebihdari1haripadasuhu270C.Halinidiperolehdaripe

    ngamatanlangsungsaatpenelitian.

    2. Penentuanaktivitasenzimpapainmelunakkandaging

    Daridataabsorbansididapatkanbahwaserapanmaksimumpada=75

    0nm.Selanjutnyasemuapengukuranabsorbansiuntuksetiapperlakuandibaca

    padapanjanggelombangyangsama.AktivitasenzimditentukandengancaraP

    adapenentuanpanjanggelombangmaksimumlarutanstandarBovinSerumAl

    bumin(BSA) denganmenggunakan metode lowry, dimana metode lowry

    merupakanpengembangandarimetodebiuret.

    Dalammetodeiniterlibat2reaksi.Awalnya,kompleksCu2proteinaka

    nterbentuksebagaimanametodebiuret,yangdalamsuasanaalkalisCu2+akant

    ereduksimenjadiCu+

    .IonCu+

    kemudianakanmereduksireagenFolin-

    Ciocalteu,kompleksphosphomolibdat-

    phosphotungstat,menghasilkanheterpolymolybdenum

    blueakibatreaksioksidasigugusaromatik(rantaisampingasamamino)terkata

    lisCu,yangmemberikanwarnabiruintensif.KeuntunganmetodeLowryadala

    hlebihsensitif(100kali)daripadametodeBiuretsehinggamemerlukansampel

    proteinyanglebihsedikit.

    Menghitungkadarproteinsubstratyangdapatdiuraikanolehenzimdariprot

    einyangtidaklarutmenjadiproteinyangdapatlarut.

    1. PengaruhpHterhadaptingkatkelunakandaging

    KondisipHyangbervariasiberpengaruhterhadapaktivitasspesifike

    nzimyangbekerjamenguraikansubstrat(proteindaging).pHyangdivaria

    sikanadalahpH5,0;5,5;6,0;6,5dan7,0dimanamenurutbebarapaliteratur

    bahwaenzimpapainbekerjapadarentanganpHtersebut.

    Tabel1.PengaruhpHterhadapaktivitasdantingkatkelunakandaging

  • 25

    pH

    AktivitasSpesifi

    k(10-3

    unit/mg)

    Tingkat

    Kelunaka

    n(g/mm3)

    +

    -

    +

    -

    5.0

    30.8897

    27.867

    5

    14.0845

    14.0187

    5.5

    43.1261

    38.743

    0

    11.3004

    11.7216

    6.0

    33.7910

    31.804

    2

    12.2467

    12.6582

    6.5

    31.2174

    31.628

    5

    12.6330

    13.4342

    7.0

    26.7324

    29.250

    7

    13.7058

    13.0201

    ket:+(enzimdenganpengaktif)-(enzimtanpapengaktif)

    Hasilpenelitianmenunjukkanbahwaenzimpapaindengandantanpazatpenga

    ktifoptimumpadapH5,5.Penentuantingkatkelunakkandagingdenganalatteksturom

    eterjugamemberikanhasilyangsama,yaituteksturdaginglebihkecilpadapH5,5ataud

    engankatalaindaginglebihlunakpadapH5,5.Haltersebutmenunjukkanbahwaenzim

    papainpadakeadaandenganpengaktifatautanpapengaktiftetapmemilikipHyangsam

    ayaitu5,5.

    Gambar1.PengaruhpHterhadapaktivitasdantingkatkelunakandaging

    AktivitasenzimsangatdipengaruhiolehpHmedium.pHoptimummeru

    pakanpHsaatguguspemberidanpenerimaprotonyangberperanpentingpadasi

  • 26

    sikatalitikenzimataupadasisipengikatsubstratberadadalamtingkationisasiya

    ngdiinginkan,sehinggasubstratlebihmudahberinteraksidengansisikatalitiken

    zim.

    Berdasarkanhasilpenelitianini,peningkatanaktivitasenzimdenganpe

    ngaktifdantanpapengaktifmulaiteramatidaripH5,0sampaipHoptimum5,5yai

    tupadaenzimdenganpengaktifsebesar43.1261x10-

    3unit/mgdanpadaenzimtanpapengaktifsebesar38.7430x10-

    3unit/mg(Gambar1).PenurunanaktivitasenzimpadapH6,0terjadikarenalingk

    ungandi

    sekitarsisiaktifenzimmengalamikekuranganjumlahproton(Kumaunangdank

    amu,2011).

    2. Pengaruhsuhuterhadaptingkatkelunakandaging

    PadaperlakuanvariasipHtelahdiperolehhasilbahwaaktivitasenzimma

    ksimumberadapadapHoptimumadalahpH5,5.Hasilinidigunakanuntukmene

    ntukanaktivitasenzimberikutnyapadaberbagaisuhu,apabilaenzimditambahk

    anpadasuhuyangtidaktepatmakaaktivitasenzimdalammelunakkandagingme

    njaditidakoptimal.

    Tabel2.Pengaruhsuhuterhadapaktivitasdantingkatkelunakandaging

    Suhu

    (0

    C)

    AktivitasSpesifi

    k(10-3

    unit/mg)

    TingkatKelunaka

    n(g/mm3

    )

    +

    -

    +

    -

    50

    44.5495

    40.3543

    9.4045

    11.1538

    55

    40.0918

    37.8084

    11.3490

    12.5831

    60

    37.5114

    34.4885

    12.1475

    13.8575

    Suhusangateratberhubungandenganenergiaktivitasdankestabilanenzim.

    Peningkatansuhudapatmenyebabkanpeningkatankecepatanreaksidansecarabers

    amaanmeningkatkankecepataninaktivasienzim.Gambar2menunjukkansuhuopti

    mumberadapadatemperatur50o

    Cdengan,sedangkanpadasuhu55o

    Cterjadipenuru

  • 27

    nanaktivitasenzim.

    Halinidikarenakansemakintinggisuhumakasemakintinggipulalajureaksi,akantet

    apisuhuyangterlalutinggiakanmerusakstrukturenzim(denaturasienzim)sehingga

    kerjaenzimakanberkurang(Yuniwati,dkk.,2003).

    Gambar2.Pengaruhsuhuterhadapaktivitasdantingkatkelunakandaging

    3. Pengaruhkonsentrasienzimterhadaptingkatkelunakandaging

    PadaperlakuanvariasipHdansuhutelahdiperolehkondisioptimu

    menzimpapainyangberadapadapH5,5dansuhu50oC.selanjutnyaunt

    ukvariasikonsentrasienzim0,5;0,25;1,0;0,075;0,05dan0,025gram.

    Tabel3.Pengaruhkonsentrasienzimterhadapaktivitasdantingkatkelunakanda

    ging

    Konsent

    rasiEnzi

    m(g)

    AktivitasSpesifi

    k(10-3

    unit/mg)

    TingkatKelunaka

    n(g/mm3)

    +

    -

    +

    -

    0,5

    43.8770

    39.8683

    9.3481

    10.9299

    0,25

    44.9041

    40.8180

    9.4787

    10.8305

    0,1

    44.9519

    40.4142

    8.6580

    10.2394

  • 28

    0,075

    46.4651

    42.4455

    8.4388

    8.9565

    0,05

    50.7884

    34.9933

    7.7129

    10.5024

    0,025

    41.0267

    31.1051

    8.8758

    12.1708

    Hasilpercobaanmenunjukkankonsentrasienzimberbedapadaenzimdengan

    pengaktifdantanpapengaktif.Padaenzimdenganpengaktiflebihoptimumberadapad

    a0,05gramdenganaktivitasspesifikyanglebihbesaryaitu50.7884x10-

    3unit/mgdanjugaditunjukkanhasilyangsamapadapenentuantingkatkelunakandagi

    ngdenganmenggunakanteksturometeryaitudaginglebihlunakpadapemberiankonse

    ntrasienzimsebesar0,05gram

    dengantekstursebesar7.7129g/mm3.Sedangkanpadaenzimtanpapengaktifkonsentr

    asioptimumberadapada0,075gramdenganaktivitasspesifikyanglebihbesaryaitu42.

    4455x10-3

    unit/mgdantekstursebesar8.9565g/mm3.

    Gambar3.Pengaruhkonsentrasienzimterhadapaktivitasdantingkatkelunak

    an

    Konsentrasienzimmempengaruhiaktivitasenzim.Semakinbesarkonsentrasi

    enzimsemakinbesarpulaaktivitasenzimtersebut.Sisiaktifsuatuenzimdapatdigunak

    anberulangkaliolehbanyaksubstrat.Substratyangberikatandengansisiaktifenzimak

  • 29

    anmembentukproduk,pelepasanprodukmenyebabkansisiaktifenzimbebasberikata

    ndengansubstratlainnya.

    Olehkarenanyadibutuhkansejumlahkecilenzimuntukmengkatalissejumla

    hbesarsubstrat.

    Tetapijumlahenzimyangterlalukecilmengakibatkanaktivitasenzimjugamenurun.

    Darigambar3.menunjukkanbahwakonsentrasienzimdenganpengaktifoptimumb

    eradapada0,05gramdenganaktivitas50.7884x10-3

    unit/mg,sedangkanpadakonsentrasidiatas0,05gaktivitasenzimlebihrendahhalter

    sebutdikarenakanenzimyangterlalubanyakmemungkinkanmediayangditambahk

    antidakmemadaidengankebutuhanaktivitasenzimyangada(Yuniwati,dkk.,2003).

    Danpadapenambahanenzim0,025gramterjadipenurunanaktivitasenzimdikarena

    kankecepatanreaksienzimatisakannaiksampaititiktertentudansetelahituaktivitas

    akanmenurun,halyangsamaterjadijugapadaenzimtanpalarutanpengaktif.

    4. Pengaruhkonsentrasisubstratterhadaptingkatkelunakandaging

    PadaperlakuanvariasipH,suhudankonsentrasienzimtelahdiperole

    hkondisioptimumenzimpapainyangberadapadapH5,5,suhu50oCdanko

    nsentrasienzimpapain0,05gram(padaenzimdenganpengaktif)dankonse

    ntrasienzim0,075gram(padaenzimtanpapengaktif).Selanjutnyauntukva

    riasikonsentrasiSubstrat0,5;0,75;0,1;1,25;dan1,5 gram.

    Tabel4.Pengaruhkonsentrasisubstratterhadapaktivitasdantingkatkelunakandagi

    ng

    AktivitasSpesifi

    k(10-3unit/mg)

    Tingkat

    Kelunaka

    n(g/mm3)

  • 30

    Konsentras

    iSubstrat(g

    )

    +

    +

    -

    0,5

    31.8522

    33.6286

    8.6083

    10.3479

    0,75

    40.4604

    35.3484

    9.4415

    9.6931

    1,0

    50.2120

    41.6068

    7.5097

    8.4189

    1,25

    35.7501

    32.9407

    9.1082

    9.9503

    1,5

    27.2273

    26.2449

    10.8922

    10.6019

    Hasilpercobaanmenunjukkankonsentrasisubstratyanglebihoptimumpadae

    nzim

    denganpengaktifdanenzimtanpapengaktifberadapada1,0gram.Padaenzimdenganp

    engaktifaktivitasspesifiksebesar50.212x10-

    3unit/mgdantekstursebesar7.5097g/mm3.sedangkanpadaenzimtanpapengaktifakt

    ivitasspesifiksebesar41.6068x10-3

    unit/mgdantekstursebesar8.4189g/mm3.

    Gambar4.Pengaruhkonsentrasisubstratterhadapaktivitasdantingkatkelunakanda

    ging

    Apabilasubstratterlalubanyakmakaaktivitasenzimkuranguntukmelakukanr

    eaksi,dansebaliknyajikasubstratterlalukecilmakasubstrat(daging)sebagaimediaya

    ngtersediatidakmemadaidengankebutuhanaktivitasenzimyangada.Sehinggajumla

    hsubstratdanenzimharusseimbanguntukmenghasilkanaktivitasyangmaksimum(Y

    uniwati,dkk.,2003).

  • 31

    BAB V

    PENUTUP

    A. Kesimpulan

    Enzim papain getah buah pepaya menunjukkan aktifitas melunakkan daging

    dimana enzim yang diaktifikan memiliki keaktifan yang lebih besar dibanding tanpa

    pengaktifan. Enzim papain dengan pengaktif bekerja melunakkan daging optimum

    pada pH 5,5, suhu 500C, konsentrasi enzim 0,05 g, konsentrasi substrat 1,0 g dengan

    aktivitas spesifik sebesar 50,2120 . 10-3 unit/mg serta tingkat kelunakan sebesar

    7,5097 g/mm3. Enzim papain tanpa pengaktif bekerja melunakkan daging optimum

    pada pH 5,5, suhu 500C, konsentrasi enzim 0,075 g, konsentrasi substrat 1,0 g dengan

    aktivitas spesifik sebesar 41,6068.10-3 unit/mg serta tingkat kelunakan sebesar

    8,4189 g/mm3

    B. Saran

    Saran penulis pada karya tulis ilmiah ini, jangan menyepelekan getah pepaya

    yang banyak dianggap kurang berguna. Karena getah pepaya dapat berguna untuk

    melunakan daging.karena mengandung enzim papain.

  • 32

    DAFTAR PUSTAKA

    Kalie,M.B.2009. BertanamPepaya.Jakarta:PTPenebarSwadaya

    Kumaunang,M.,danKamu,V. 2011.AktivitasEnzimBromeilindariEkstrak

    KulitNanas(Ananascomosus)jurnalilmiahsainsVol11no.2.

    Nani. 2007. Potensipasarpapainsangatbesar, http//ikm.kemenperin.go.id,

    diaksestanggal24Maret2012

    Silaban,R.,(2004),Pendekatanbioteknologidalampengoalahanlimbah kayu

    gergajimenjadigulaolehbakteriyanghidupdalamsaluranpencernaan bekicot.

    Bandung: ITB

    Silaban,R.2009.Kajianpemanfaatangetahbuahmanggauntuk

    melunakkandaging,MediaPrimaSains,Vol1No.1

    TeknoPangandanAgroindustri. 2008. EnzimPapainDariPapaya. Bogor: Jurusan

    TeknologiPanganDanGizi,Institut PertanianBogor

    Winarno,F.G. 2002.KimiaPangandanGizi. Jakarta: PT.GramediaPustaka Utama.

    Almatsier,S. 2009.PrinsipDasarIlmuGiz. Jakarta: Gramedia

    Budianto,A.K. 2009. Dasar-DasarIlmuGizi,Cetakanke-IV. Malang:

    UMM Press

    Budiman,A.2003.KajianTerhadapPengaruhEtanolSebagaiBahan

    PengendapdanPengaruhAir,BufferFosfatSertaEtanolPada Ekstraksi

    Papain. Bogor: FakultasTeknologiPertanianInstitutPertanianBogor