may booster - 2019

San Rafael Elks #1108 May 2019 P a g e | 1

MAY BOOSTER - 2019

DearMembers,

Ithasbeenawonderfulandbusymonth.Assuch,theboosterfairyhasprovidedmewithalittleextraspace…

IwashonoredandpleasedtoreceiveonbehalfoftheOrderandourLodge,twoproclamationsofrecognitionandappreciationforourGoodWorksfromourpartnerswithArcMarin(forpeoplewithintellectualandphysicaldisabilities)andtheCityofSanRafael.FulldetailsofeacharesetforthinthisNewsLetter.IamproudtosayWeareDoingWell!

TheRitualContestforthe“Great”NorthwestDistrictisfastapproaching.YourveryownSanRafaelElksRitualTeamwillbecompetingtheweekendofMay3rdattheUkiahLodge…GOREDDEVILS!!!ThereisatremendousamountofworkintheplanningandexecutionofthiseventandyourOfficershavecommittednumeroushourspracticingoverthelastfewmonthsastheRitualTeambalancingtheirdutiesattheLodge,atwork,andathome.

IwanttothankourOfficers,candidate,andcoachforthehardworkwehaveputtowardthiswonderfulendeavor.Whileit’sfuntocompetewithourneighboringlodgestherealpurposeofRitualistoultimatelypresentourincomingmemberswithameaningfulrenditionoftheInitiationRitual.Wehopethisfirstimpressioninspiresournewandoldmemberstobecomeinvolvedinouractivitiesandevents.

Inthis,weseektoinstillinournewmembersandtorenewinallourmembers,ourcorevaluesandatrueunderstandingofwhatitmeanstobeanElk.Keepinginmindwhoweare,whatwedo,andwhatweshare.

InApril,wehostedourEasterSundayBrunchandwewereexceptionallypleased200members,familyandfriendssharedthedaywithourGuestofHonor,theEasterBunny.Itwasafantasticday.ThekitchencrewservedupabeautifulassortmentofdeliciousfoodandthechildrenenjoyedanEasteregghuntontheterrace.Thankyoutoallthevolunteersthathelpedtomakethissuchawonderfulevent!

WealsohostedtheFootprinters’annualDispatchersDinner.WehadanimpressiveshowingofmembersfromourLodgeaswellasemergencyservicespersonnelfromaroundthecounty.As

F R O M T H E S T A T I O N O F F I D E L I T Y

San Rafael Elks Lodge #1108 ~ May 2019 P a g e | 2

SAN RAFAEL ELKS #1108 ~ BOOSTER MAY 2019

ExaltedRuler,andasaformerlawenforcementofficer,IfeelparticularlyprivilegedtohonorthewomenandmenthathelpusallinourCommunityintimeofneed.

Attheendofthismonth,wewillbegatheringMemorialDaymorningattheMarinCountyCivicCenterforapresentationtohonorthosewhohaveservedourcountry.IhopeyoucanjoinusforthefestivitiesandtojoininaswecarryourflagsintheparadedowntheAvenueoftheFlags.

Besuretojoinusformoregreatupcomingevents,including:- Friday,May3rd,our1stFridayMayBirthdayDinner&MilkChasersBand(Lastmonthwehad

almost80membersdininganddancing!)- Thursday,May9th,YouthAwardsDinner- Friday,May10th,CarCruz&BBQmannedbythefirefightersandpolice- Saturday,May11th,MayMadness;LivePerformancebyPrideandJoy- Sunday,May12th,Mother’sDayCeremonyandLuncheon- May31st,SummerKick-offPoolParty&BBQ,includingdiningontheTerrace- Friday,June7th,StateVicePresidentVisitationandDinnerPlusour1stFridayJuneBirthday

dinnerandband- Saturday,Jun22nd,TacoThrow-downontheTerraceandPoolOpentoElksandtheirGuests.- PleaseseeBooster,Calendar,andFlyersforfulldetails.

Andremembertojoinourcallsforvolunteerworksowemaycontinuetokeepdoingwhatwedosowellforbothourmembersandourcommunity.

Bestwishes,

EricHolmExaltedRuler

Secretary Update May 2019

BOOSTER HELP! I would love it if someone can print out the Booster when it’s ready for printing. Take it to Office Depot on East Francisco Blvd (we get a 75% Elk discount), have 75 copies printed. THEN fold and stamp 30 copies to send to our home bound members. And lastly, put the remaining 45 copies in the lobby of the lodge. Not hard, just takes a couple hours. Call if you can take on a super important volunteer job.

Dues for 2019-2020 remain the same as last year - $275 ($250 plus $25 for Grand Lodge and State per capita fees.) As in previous years, we accept cash, checks and credit card payments. You can easily pay on-line ELK1108.ORG/ Membership.



ARCHIVING! - this is an ongoing project that can be done at any time in the office. We need to cull, sort, file past years of financials, meeting minutes, and invoices. It is not urgent, but needs to be done at some point. So why not now! Call if you can help!

(415) 454 8835 or email: [email protected]

Elkdom, Youth & Our Community San Rafael Elks Lodge had the honor of receiving two awards from our community in April. We started off the month being named The Arc Marin’s Founding Community Partner for our support and involvement in Arc Marin’s programs. Arc Marin is an organization for adults with intellectual and developmental disabilities. Our Lodge then closed out April by receiving a Proclamation from the City of San Rafael in recognition of Our Lodge honoring America’s Junior Citizens with our Youth Week, among other Youth related observances. Exalted Ruler Eric Holm and San Rafael Lodge’s ARC Intern, Alexander McQuilken

The City of San Rafael’s Proclamation to San Rafael Elks Lodge #1108 for our Observance of Youth Week and our honoring America’s Junior Citizens



May 2019 - Candidate Pipeline: awaiting interviews, orientation and initiation! Eigil Qwist by George Kokalis Ryan Brown by Jen O’Mara William Vela by Leigha From Angela Domenico by John Hubenthal Matthew Pantazes by George Kokalis Jack Dougery by Jonathan Harb Lisa Parker by Karen Saura Jana Harris by Leigha From Amy Strousse by Leigha From Lois Tucker by Leigha From Traci Wolverton by Dennis McNell

Valerie Stilson by Leigha From Mark Susnow by Leigha From Steven Rojas by Leigha From Kamille Caple by Katharine Whipple Robert Kline by Leigha From Joan Brown by Al Bernes Ross Dreyer by Leigha From Michael Caldwell by Andrea Power Victor Brito by Leigha From Paul Cingolani by Leigha From

April 2019 Membership Stats Beginning Membership 4/1/2019: Membership to Date 4/21/2019:

498 502

Increases

Initiated 6 Affiliated: 0 Reinstated: 0 Gain Subtotal: 8

Decreases Dropped: 0 Transferred Out: 1 Absolute Dimit: 0 Deaths: 0 Decrease Subtotal: 1 Delinquent Members as of 4/22/19 142 Past due members~ 28% of lodge

Applications on Hand Waiting to read at next lodge meeting: 2

In the hands of the investigating committee: 4

Ready for balloting: 4 Ready for Orientation: Ready for Initiation: 10 Ready for Affiliation 2 Ready for Reinstatement 0 Other 0 Total: 21

Life Members Life Members: 27 Honorary Life Members: 1 Total: 28 Life Percentage: 5.6%




1st Friday Free Birthday Dinner & Music by the Milk Chasers (our own Leslie Freed!)

#1108 Members with MAY Birthdays Please join us on May 3rd for a FREE birthday dinner

(adults $20, 12 & under $10)

Celebrate your birthday with family and friends at the Lodge!

Charles Flynn Jr Soren Nordstrom Kathleen Harwood Jennifer Spilly Neils Von Doepp Alicia Ferrando Judy Mayne Jon Swartz Eric Englebrecht Kathleen Harrison Dianne Morrison Eileen Knapp Karen Saura Suzanne Alfandari Meike Filipof Deborah Ainsworth Haden Ongaro Nathan Deeds James Glowner Ellie Myers John Sauter Peter Friedman

Susan Adler Lisa Dancer Alison St Sure Michael Loftin Marisa Beingessner Justin Warner Lincoln Wells Brenda Johnson Dennis McNell Jeffrey Ehlenbach Laurel Botsford Leslie Freed Audrey Neal Joseph Rusbarsky Renee Lee Scott Shanahan Robert Thiercof James Channon Greg Rorvik

Didwemissanyone?Pleaseletusknow–andjoinusonFriday,May3rd



Lodge Officers Exalted Ruler – Eric Holm Leading Knight – Doug Monti Loyal Knight – Vern Rogers Lecturing Knight –Jen O’Mara Esquire – Stewart Munson Chaplain – Itamar Bikszer Inner Guard – Jessica Canty Tiler – Virginia Davis Treasurer – Dean Aure Secretary –Monica McMillan Lodge Trustees 5 Yr Trustee – Ken Hauser 4 Yr Trustee –Mark Giosso, PER 3 Yr Trustee – Alan Quinton PER 2 Yr Trustee –George Kokalis 1 Yr Trustee –Dennis McNell PER Allensby Trust Chairman –Lorn Dreitzler Secretary –Ken Franceschi Treasurer –Don Gregory Trustee –Dan Dufficy Trustee –Tom Knopf Trustee –Steve Spicer Trustee –Dave Nelson Lodge Committee Chairs Accident Prevention: George Kokalis [email protected] Americanism/Essay Contest: Stewart Munson ([email protected]) Auditing & Accounting: Max Schrank ([email protected]) ELK/ Beer Booth: Joe Tato ([email protected] ) Bequests & Living Trusts: Bob Meier, PER ([email protected]) Booster/Newsletter: Jen O’Mara ([email protected])

Communications: Constanza Perry ([email protected]) Drug Awareness: Lynn Fox ([email protected]) & Laurel Botsford ([email protected]) Elks National Foundation: Vern Rogers ([email protected]) Environmental: Jen O’Mara ([email protected]) Flag Day: Mark Giosso, PER ([email protected]) Government Relations: Sydney Fairbairn ([email protected]) ENF Grants: Dennis McNell, PER ([email protected]) Hoop Shoot: OPEN House Committee: Doug Monti ([email protected]) Lodge Activities: Joe Tato and Greg Bernson and Itamar Bikszer ([email protected]) Membership & Investigation: Leigha From ([email protected]) Memorial Day: Stewart Munson [email protected] Music Series:Greg Bernson ([email protected]) and Brian Waterbury ([email protected]) Oriebntation: Bob Meier ([email protected]) PER Association: Bob Meier ([email protected])

Purple Pig (CHEMPI): Doug Monti ([email protected]) Public Relations: Katharine Whipple ([email protected]) Ritual Contest: Mark Giosso, PER ([email protected]) Scholarship: OPEN Scouting: Steve Trocki PER ([email protected]) Soccer Shoot: OPEN UX Chair: Melanie Lamoureux ([email protected]) Veterans: Peter Behr ([email protected]) Volunteers: OPEN Youth Activities: OPEN Lodge Information Website: www.elks1108.org Office: 415.453.1108 [email protected] Mailing Address: PO Box 150789 San Rafael, CA 94915 Outside Events: Sue Marsh [email protected] www.MapleLawnEvents.com (415) 295 5296 Trustee Meetings: 1st and 3rd Thursday at 6pm Lodge Meetings: 1st and 3rd Thursday at 7pm House Committee Meetings: 2nd and 4th Tuesday at 7pm Activity Committee Meetings: 3rd Tuesday, 5:30pm



Social Activities See Elks1108.org for updates Weekly in the Bar

Tuesday Taco Night Tacos or other light Latin Fare served every Tuesday $6 for 2 Tacos w/toppings & chips Wednesday Burger Night Cook to order Burgers & Fries Wednesday starting at 6:00 $7 burger/ $8 cheeseburger/ $10 double burger No RSVPs required. However if you're going to be a big group, please let us know so we can save you enough food. May Activities Thu, May 2 – LODGE MEETING - No Dinner, No Initiation Fri, May 3 – 1st Friday Dinner – Free to #1108 Members with May Birthdays PLUS Milk Chasers Band (Our own Leslie Freed) in the Drakes Bar Free to #1108 Members with May Birthdays; $20 adults; $10 kids 12 & under Serves at 6:30 7:30 Band Chef: Justin is bringing his Thai to the Lodge! *See flyer for details Please [email protected] by Thursday morning (we hit our limit last time!) Quadruple-Header Long Weekend at the Lodge

Thurs, May 9 - Youth Awards Dinner $20 Adults; $10 Kids 12 & Under (cont’)

6 pm Antipasto, Salad & Garlic Bread, Italian Sausage/Meat Balls, Sauté Kale, Pasta Pesto, Dessert tbd

Fri, May 10 – Police and Fire host their annual fundraiser – Second Chance Program

Sat, May 11 – May Madness 6 pm, $25 (See flyer for details)

Sun, May 12 – Mother’s Day Mothers are Free. (See flyer for details)

May 24- $20 Friday Night May is Lei Day Ukuleles in the Bar and Lei competition See Flyer Mon, May 27th, Memorial Day at the Civic Center 9 am

Fri, May 31 – Kicking off the Summer Pool Party & BBQ 5 pm: Pool & Terrace open to all Elks and their guests 6 pm: BBQ 6:30: Laura Seligsohn playing on the Terrace (see flyer for details)

Upcoming Saturday, June 7th – AVP Visit from Len and Judy Fisher Including dinner and music!

And 1st Friday Birthday Dinner (Free to #1108 members with a June Birthday) PLUS The Milk Chasers Band and Lodge member Leslie Freed

Sat, June 22nd Taco Throw-down at the pool & on the Terrace

San Rafael Elks #1108 May 2019 P a g e | 8

You never know, whose is going to show up! Until next month, see ya’all at the Lodge in Novato!

Out & About in Elkdom Always an American Adventure

WhatdoesanElkdoinherdowntime?Well,DfromNovatoElksLodge#2655goesOut&AboutinElkdomandAmerica!Sheoccasionallysharesheradventures.IfyouareinNovatostopinandsayhello.

D’s “ELK TRACKS” by D

March: San Francisco #3 TheendofMarch,ERTerry,Dee,LisaandIhadplannedadinnerattheHouseofPrimeRib.THOUGH,originallyonourcalendarandputtherebyBarbarawhosethoughtwastocelebrateRob’s50th,thisisplanthatdidn’tquiteworkout.However,inBarb’shonor,wedecidedtogoandtoasther.Unfortunately,Robcouldnotjoinus,sowetoastedhimtoo,forhisB-day!TerryhadneverbeenandalsohadneverbeentoSanFranciscoLodge#3.Irectifiedthat!Thatwasourstopbeforedinner.

ThenIwasofftovisitafriendinHalfMoonBay.OneofmyfavoriteplacesonthecoasttositandgazeoutthePacificOcean,enjoyingaglassofwine,isMossBeachDistillery.Wellasanygoodbartenderwhoknowsherregulars,IknewthatMikeYerbylivedthereformanyyearsjustuptheblock,textedhimfortheaddressand“kodakmoment”!

April:Reno#597

Lisa&IonceagainweregoinguptomyannualJeepclub’s“MustangRun”fromRenotoVirginiaCity.OnFridaynightweofcoursewenttoRenoLodge#597forourannualvisit.TheLodgealwayshassomuchgoingon.Oneoftheup-comingeventsIspottedtheirboardwasforthe“JollyCorks”winetastingDinner,scheduledforApril20th.

Thehistoryforthiseventisfascinating.BeforeestablishingBPOEin1868;agroupof16entertainerscalledthemselvesthe“JollyCorks”.ThenamederivedfromabartrickintroducedbyCharlesA.S.VivianinordertocontinuetheirsocialgatheringsonSunday’sinNewYorkwhoatthattime,hadbluelawsthatpreventedtheopeningofpublictaverns.(Thekeyword;public;youcanseewherethiswasgoing).Withoutanyformorrulesatthattimetheyhadoneexceptionandthatwastheadoptionofatoasttomembersofthegroupnotinattendance.Thiswasthegenesisoftheeleveno’clocktoast.

MoreRenoLodge&Paradise#2026:OnSaturdaywasourjeeprunandafterseeinglotsofWildMustangsonthetrails,weendedupinVirginiaCityatTheRedDogSaloon!ThattownshouldreallyhaveaLodge!HeadingbacktoRenowedecidedtovisitRenoLodgeagainandamsogladwedid.BesidesmeetingsometravelingElksfromColorado,wefoundourselvesmeetingJimandBeckySaxton.JimisthesecondtermERfromnon-otherthanParadiseLodge#2026;Paradise.



Elkdom & Veteran’s – Memorial Day Memorial Day, which celebrates those who died in the service of our country, is on May 27th. The first reported Memorial Day occurred in 1865 when a group of former slaves who had served in the Union army gathered to bury recently deceased Union soldiers, and put flowers on their graves. Since that time, Memorial Day has been celebrated irregularly as to date, and was finally fixed as the last Monday in May.

Memorial Day today: We request Elks to help out at the Memorial Day ceremony held at the Civic Center on May 27th by escorting veterans to the service which starts at 9:00 at the Marin County Civic Center. Those who want to help should be there by 8:15 to 8:30. As this is my first time as Veterans Chairman for this event, I am still learning what, if anything, else we can or should do. I am hoping Ray and Stewart, as well as veterans, to assist me in learning more.

Best Regards,

Peter Behr Veteran’s Chairman Elkdom & Youth Our San Rafael Elks 2018-19 Americanism Essay winner has gone on to become a CHEA Medalist! We are honored to announce that Delilah Guzman took 3rd place in the CHEA competition with her writing on the Theme: “What makes you proud of America?”

We are very proud of Delilah, who is from Ms. Chris class, Ross Middle School. We look forward to seeing Delilah at the Lodge’s Youth Awards Dinner on May 9th. We hope to see you there, too! Elkdom, Youth & Scholarships From Our PER Association: May Madness Update WeareapproachingtheMay11datefortheLodgeMaymadnessAfterParty.ThiseventisfollowingtheSanRafaelCityMayMadnessCarShow,ItwillbeheldontheTerracewithawesomeperformersPride&Joyastheentertainment.Therewillbefoodandbeveragesavailableandagoodtimewillbehadbyall.ThiseventraisesscholarshipfundsforstudentsinSanRafaelwherewesupportdeservingstudents.ThisyearwewillbehelpingSanRafaelPolicewithCampChance,aprogramforatrisk/underservedmiddleschoolyouthkidsthatgivesthemanopportunitytoexperienceoutdooradventuresatWalkerCreek.

Everyonehadawonderfultimelastyearandweexpectthisyeartobeevenbetter.TheMayMadnessAfterPartyisopentothepublicaswell,Buyyourticketsnowandattendthisgreatevent!

TheMayMadnessAfterPartykicksoffat6:pmonMay11.Costis25.00fortickets.TheyareavailableonEventBritebygoingtoourLodge’swebsiteElks1108.org.TicketswillalsobeavailableattheLodge.



1st Friday Dinner at the Lodge

Free for #1108 Members with May Birthdays Friday, May 3rd

Dinner served at 6:30 Milk Chasers (& Member Leslie Freed) Band in the Drake Bar

7:30

We are continuing with our year of 1st Friday Free

Birthday Dinners for #1108 members with a birthday falling in that month

Please join the Lodge this Friday, May 3rd for our Lodge’s third month of 1st Friday Dinners where we offer a free dinner for #1108 members whose birthday fall in that month. Please rsvp – last month we hit our limit! Following dinner, our member Leslie Freed and the Milk Chasers Band will be playing in the Drake Bar.

C’mon down and enjoy the New Elk year with your Elk friends and their families!

Friday’s Menu

Kale salad Pad Thai

Tom Kha Gai (coconut milk soup) Pad Kee Mao (drunken noodles)

A choice of Protein: Marinated Chicken Thighs, Pork Loin Medallions

Dessert tbd

$20 Adults; $12 Children 12 and under

Your chef for the day: Justin Kaufman

RSVP’s appreciated by Thursday morning (last time we sold out): [email protected] Open to Elks and their guests. Elks must pay for their guests.



Elk Ceremony and Lunch 11 am – 1 pm

In honor of all Mothers, the 2019 Officers will be cooking and

serving lunch.

The officers will be performing the traditional Elks Mother’s Day Ceremony

MENU:

x Chicken Piccata OR Grilled Salmon x Mushroom Risotto x Grilled Vegetables x Melon Fruit Salad x Bread Basket x Dessert x Sparkling Drink for Moms

Free for Moms/ $20 Adults/ $10 Kids (12 and under)

Please RSVP at [email protected]



Friday, May 24th

6:30 – 9:00 pm

May Day & Lei’s at the Lodge

Friday, May 24th 6:30 – 9:00

“Hawaiian-ish” Dinner - Lei Competition

Kitchen Crew led by Joe Tato

Additional Lei workshops in April and May – dates TBD In Hawaii, May 1st, is designated as Lei Day. Originated on May 1st, 1927 by Don Blanding, a reporter for Honolulu Star Bulletin newspaper. He established Lei Day as a day when everyone would wear a lei and give a lei to their friends and loved ones. It is a day to express love, appreciation, and friendship.

Today, May 1st is still celebrated throughout the islands. There is pageantry, hula dancing and music throughout the day, plus a very large lei contest held at the Waikiki Shell with prizes awarded for leis of many categories—the red lei, blue lei, orange lei, purple lei, yellow lei, most Hawaiian, most beautiful, best dry flower lei, etc.

Here in San Rafael, California, a small group of Elk women are initiating a modified May Day celebration and lei contest for members and guests. We are planning to have 3 categories, and have leis displayed in the entry way of the San Rafael Elk mansion on May 24th, 2019 starting from 5 pm-9 pm. *Prizes to be offered after dinner- 8:00 pm.

FOR APPLICATIONS TO ENTER lei contest, email [email protected] Call 415.717.5872

Two workshops on lei making will be scheduled for a nominal fee around $20, to cover some material costs and instructor- may vary depending on what materials are used and if you bring your own greenery and flowers. Workshops dates will be one in April, and one in May. Dates to be determined.

Entry forms with criteria for leis to be submitted for entering contest to be provided by last week in April. Cost to enter leis will be $8.00.

Save the date Friday May 24th at San Rafael Elks -6:30-9:00 pm

Dinner to be served at Elks with Joe Tato preparing “Hawaiian-like” food accompanied with Hawaiian music and hula dancing.

For more information email: [email protected] Subject: Lei Contest

For dinner reservations, please RSVP at [email protected] by May 14th.

Elks and guests of members invited. Elks must pay for their guests.



Marin County United Veterans Council cordially invites you to attend

MEMORIAL DAY Honoring America’s Fallen Soldiers

Thanks also to the Marin County Board of Supervisors,

American Legion Auxiliary San Anselmo #179, Garbarino WWII Museum, Green Mountain Coffee

& San Rafael Elks #1108

GG Transit: Call 511 � Paratransit: 415-454-0964 facebook.com/pg/Marin-County-United-Veterans-Council-545207455587054

Monday, May 27th Marin Co. Veterans Memorial Auditorium

Civic Center � San Rafael 10 am: Patriotic Music by the Sewer Band 10:30 am: Welcome & Program 11:30 am: Laying of Wreaths at War Memorials

Free Coffee & Donuts Reception (Lobby)

FREE�EVERYONE WELCOME�FAMILY FRIENDLY�ACCESSIBLE



Kicking Off the Summer Poolside BBQ & Party

Friday, May 31st 5 pm – until?

Please join the Lodge in Kicking Off the Summer Pool Party & Poolside BBQ

& The Maple Lawn Terrace is open for dining, quiet music & bar service

Pool Party

Lodge is Providing A Beach-y evening with Wild Lights Fantastic

& Beach-y Music!

Bar At the Pool - special beach cocktails

& we’re serving on the Terrace

BBQ Grilling, grilling and grilling

Jen & friends will be working BBQ magic! Jerk-y Chicken or BBQ Pork Loin

Salad 3-ways, Rosemary Bread, dessert

5:00 Pool & Terrace open to all Elks and free pool access for their guests

Bars open

6:30ish BBQ in full swing

Quiet Music on Terrace

8:00ish Raffle

~ 8:30ish At 9:00 pm, the Lodge is respectfully restricting the rest of the evening to adults only

BBQ Dinner: Adults: $20 Children: $10 Burgers or chicken apple sausage

Vegetarian option available

RSVPs appreciated at [email protected]

Open to all Elks and their guests. Elks must pay for their guests.



San Rafael Elks 6-12-19

To learn more about our new brand,

please visit us at vitalant.org/ourbrand

“I wish I could tell my

donor how grateful I am

for your selfless act. You

may have wondered

what became of your

donation. Well, it saved

my life.”

Ann - Blood Recipient

San Rafael Elks

Lodge #1108

BLOOD DRIVE

WEDNESDAY, JUNE 12

2:00 PM - 7:00 PM

Carriage House

1312 Mission Avenue

San Rafael, CA 94901

To make an appointment, visit vitalant.org and click donate.

Use your unique sponsor code: ELKS-SR or call Alicia Ferrando

at (415) 699-0813.

Appointments recommended, Donors receive a free dinner

that evening!

Due to Father’s Day, there won’t be a Sunday drive this month.

Make the most of

the moment



Out & About in Elkdom Please join San Rafael Elks Lodge as we travel up to Eureka Lodge

this August 16th-17th *RV’ers – there are great spots to reserve!

Early Bird Tickets by June 19th & get a chance at the Early Bird

Prize of $500 cash!

Grand Prize $15001st Place $7502nd & 3rd Place $2004th -7th Place $1508th – 15th Place $100

36th Annual 2019 BPOE

Elks Northwest District Jamboree August 16-17th at the Eureka Lodge

445 Herrick Ave, Eureka

Enjoy a weekend filled with friendship, being together and raising money for programs and charity!



May Calendar 2019

28 April

Private Event

29 April 30 April Taco Tuesday 5-

7 pm *****

DARTS & Billiards

1 May Girl Scouts –

6:30 pm *****

$7 Burgers *****

Cub Scouts – 7 pm

2 May Private Event

***** Trustee Meeting

6 pm *****

Dinner@ 6 pm Lodge Meeting NO Initiation

3 May $20 FND Dinner

*First Friday – Free Dinner for #1108

Elks w/May Birthday

***** 7:30: Milk Chasers

Band In the Bar *****

Ritual – @Ukiah Elks Lodge

4 May Ritual – @Ukiah

Elks Lodge *****

Private Event

5

6 7 Taco Tuesday 5-

7 pm *****

DARTS & Billiards

8 6:30 pm

***** $7 Burgers

***** Cub Scouts –

7 pm

9

Youth Awards Night 6 pm

10

Fireman/Police BBQ Fundraiser

11

May Madness Terrace

6 pm

12 Mother’s Day Ceremony & Lunch 11 am

13 14 Taco Tuesday 5-

7 pm *****

DARTS & Billiards

15 6:30 pm

***** $7 Burgers


7 pm

16 Trustee Meeting

6 pm *****

Dinner@ 6 pm Lodge Meeting

17

FRIDAY NIGHT DINNER

18

Private Event

19

Private Event

20 21 Taco Tuesday 5-

7 pm *****

DARTS & Billiards

22 6:30 pm

***** $7 Burgers


7 pm

23

Marin History Lecture

24

May Lei Day U F OHANA 6:30-9:00 pm

25

Private Event

26

Private Event

27 Lodge Closed for Memorial

Day

28 Taco Tuesday 5-

7 pm *****

DARTS & Billiards

29 6:30 pm

***** $7 Burgers


7 pm

30 31

Summer Kick-Off Pool Party & BBQ Live Music on the

Terrace

June 1

Private Event

may booster - 2019

Documents