k bca 1 o e proteins - pepnet.com · 319order hotline 1-800-777-4779 502-266-8787 peptides...

319 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE

S PRODUCT CODe QTy PRICe

Chemokines

BCA 1 BCA-1 is a CXC chemokine that is highly expressed in thesecondary lymphoid organs, such as follicles of the spleen, lymph nodes, and Peyer’s patches. CXCL13 promotes the migration of B lymphocytes (compared to T cells and macrophages), by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt’s lymphoma receptor 1 (BLR1). BCA1 therefore functions in the homing of B lymphocytes to follicles. Human BCA-1 shares a 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt’s lymphoma cells, has now been shown to be the spe-cific receptor for BCA1. Among cells of the hematopoietic lineages, the expression of BLR-1, now designated CXCR-5, is restricted to B lymphocytes and a subpopulation of T helper memory cells.

BCA 1Recombinant Human BCA-1/ BLC (CXCL13); C-X-C motif chemokine 13, Small-inducible cytokine B13, B lymphocyte chemoattractant, CXC chemokine BLC, CXCL13, BCA-1, CXCL-13, B cell Attracting Chemokine-1, BLC, ANGIe, BLR1L, SCyB13, ANGIe2

CHM-348-20 °C

5 µg20 µg1 mg

50 130

2,700

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEV-LRKR SSSTLPVPVFKRKIPCXCL13 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain contain-ing 87 amino acids and having a molecular mass of 10.3 kDa.

BRAK (CXCL14) CXCL14 is involved in immunoregulatory and inflammatory processes. BRAK pro-tein is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. CXCL14 displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. CXCL14 is involved in the homeostasis of monocyte-derived macrophages.

BRAK HisRecombinant Human BRAK (CXCL14), His Tag; C-X-C motif chemokine 14, Small-inducible cytokine B14, Chemokine BRAK, Bolekine, NJAC, KS1, Kec, BMAC, MIP-2g, SCyB14, CXCL14, BRAK, MGC10687

CHM-239-20 °C

5 µg20 µg1 mg

50 130

3,000

MKHHHHHHAS SKCKCSRKGP KIRYSDVKKL EMKPKYPHCE EKMVIITTKS VSRYRGQEHC LHP-KLQSTKR FIKWYNAWNE KRRVYEECXCL14 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain contain-ing 88 amino acids and having a molecular mass of 10.66 kDa. The Human BRAK contains a 10 a.a. fusion His tag at N-Terminus.

320 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


BRAK Recombinant Human BRAK (CXCL14); C-X-C motif chemokine 14, Small-inducible cytokine B14, Chemokine BRAK, Bolekine, NJAC, KS1, Kec, BMAC, MIP-2g, SCyB14, CXCL14, MGC10687

CHM-001-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Ser-Lys-Cys-Lys-CysCXCL14 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain contain-ing 77 amino acids and having a molecular mass of 9.4kDa.

mBRAK Recombinant Mouse BRAK (CXCL14); C-X-C motif chemokine 14, B-cell and monocyte-activating chemokine, Chemokine BRAK, Kidney-expressed chemokine CXC, MIP-2G, Small-inducible cytokine B14, Cxcl14, Bmac, Kec, Ks1, Mip2g, Scyb14, BRAK, NJAC, AI414372, bolekine, MIP2γ, 1110031L23Rik, 1200006I23Rik

CHM-007-20 °C

5 µg20 µg1 mg

50 130

2,700

SKCKCSRKGP KIRYSDVKKL EMKPKYPHCE EKMVIVTTKS MSRYRGQEHC LHPKLQSTKR FIKWYN-AWNE KRRVYEECXCL14 Mouse Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain contain-ing 77 amino acids and having a molecular mass of 9.4kDa.

rBRAKRecombinant Rat BRAK (CXCL14); C-X-C motif chemokine 14, B-cell and monocyte-activating chemokine, Chemokine BRAK, Kidney-expressed chemokine CXC, MIP-2G, Small-inducible cytokine B14, Cxcl14, Bmac, Kec, Ks1, Mip2g, Scyb14, BRAK, NJAC, AI414372, bolekine, MIP2γ, 1110031L23Rik, 1200006I23Rik

CHM-021-20 °C

5 µg20 µg1 mg

50 130

2,700

SKCKCSRKGP KIRYSDVKKL EMKPKYPHCE EKMVIITTKS MSRYRGQEHC LHPKLQSTKR FIKWYN-AWNE KRRVYEECXCL14 Rat Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 77 amino acids and having a molecular mass of 9.4kDa.

Chemokine (C-C motif) Chemokine (C-C motif) ligand 6 (CCL6) is a small cytokine belonging to the CC che-mokine family that has only been identified in rodents.In mice, CCL6 is expressed in cells from neutrophil and macrophage lineages, and can be greatly induced under conditions suitable for myeloid cell differentiation. It is highly expressed in bone marrow cultures that have been stimulated with the cytokine GM-CSF. Some low levels of gene expression also occur in certain cell lines of myeloid origin (e.g. the immature myeloid cell lines DA3 and 32D cl3, and the macrophage cell line P388D) that can also be greatly induced in culture with GM-CSF. However, in activated T cell lines, expression of CCL6 is greatly reduced. CCL6 can also be induced in the mouse lung by the cytokine interleukin 13. Mouse CCL6 is located on chromosome 11. The cell surface receptor for CCL6 is believed to be the chemokine receptor CCR1.

321 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mC 10Recombinant Mouse C-10 (CCL6); Small inducible cytokine A6, CCL6, C10 protein, c10, MRP-1, Scya6, chemokine (C-C motif) ligand 6

CHM-307-20 °C

2 µg10 µg1 mg

50 130

2,700

GLIQEIEKED RRYNPPIIHQ GFQDTSSDCC FSYATQIPCK RFIYYFPTSG GCIKPGIIFI SRRGTQVCAD PSDRRVQRCL STLKQGPRSG NKVIAC-10 Mouse Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 95 amino acids and having a molecular mass of 10.7kDa.

rC 10Recombinant Rat C-10 (CCL6); Small inducible cytokine A6, CCL6, C10 protein, c10, MRP-1, Scya6, chemokine (C-C motif) ligand 6

CHM-268-20 °C

2 µg10 µg1 mg

50 130

2,700

GLIQDTVKED RPFNPTIIHQ GFQDSSDCCF SYASQIPCSR FIYYFPTSGG CTKPGIIFVT RKRKRVCANP SDQRVQTCIS TLKLGPRSGN SAIAC-10 Rat Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 94 amino acids and having a total molecular mass of 10.4kDa.

CCL16 Human CCL16, also called HCC-4, liver-expressed chemokine (LEC), and lymphocyte and monocyte chemoattractant (LMC), is a novel CC chemokine recognized by bioin-formatics. NCC-4 cDNA encodes a 120 amino acids along with a 23 amino acids signal peptide that is cleaved to generate 97 amino acid protein. HCC4 is vaguely related to other CC chemokines, showing less than 30% sequence identity. Among CC che-mokines, CCL-16 has the largest similarity to HCC-1. 2 potential polyadenylation sig-nals are present on the human HCC-4 gene, and as a result, 2 transcripts containing roughly 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly upregulated in the presence of IL-10. CCL16 shows chemotactic activity for lymphocytes and monocytes rather than to neutrophils. NCC-4 has potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. CCL16 demonstrates chemotactic activity for monocytes and thp-1 monocytes, rather than for resting lymphocytes and neutrophils. HCC-4 induces a calcium flux in thp-1 cells that desensitized prior to the expression of rantes.

CCL16Recombinant Human LeC/NCC-4 (CCL16); C-C motif chemokine 16, Small-inducible cytokine A16, IL-10-inducible chemokine, Chemokine LeC, Monotactin-1, Chemokine CC-4, Lymphocyte and monocyte chemoattractant, CCL-16, HCC-4, HCC4, NCC4, NCC-4, Liver expressed Chemokine, LMC, LCC-1, LCC1, MTN-1, MTN1, SCyL4, ckB12, SCyA16, LeC, ILINCK, MGC117051

CHM-237-20 °C

5 µg20 µg1 mg

50 130

2,700

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIK-DPNLPLLPTRNLSTVKIITAKNGQPQLLNSQCCL16 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa.

322 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


CCL3L1 CCL3L1 is a small cytokine that belongs to the CC chemokines. The CCL3L1 gene is one of several cytokine genes clustered on the q-arm of chromosome 17. CCL3L1 is involved in immunoregulatory and inflammatory processes. CCL3L1 binds to several chemokine receptors including CCBP2 and CCR5. CCR5 is a co-receptor for HIV, and binding of the CCL3L1 protein to CCR5 inhibits HIV entry.

CCL3L1 HisRecombinant Human LD78-β (CCL3L1), His Tag; C-C motif chemokine 3-like 1, G0/G1 switch regulatory protein 19-2, LD78-beta(1-70), PAT 464.2, Small-inducible cytokine A3-like 1, Tonsillar lymphocyte LD78 beta protein, CCL3L1, D17S1718, G0S19-2, SCyA3L1, LD78, 464.2, SCyA3L, LD78BeTA, MGC12815

CHM-251-20 °C

5 µg20 µg1 mg

50 130

2,700

MGSSHHHHHH SSGLVPRGSH MSLAADTPTA CCFSYTSRQI PQNFIADYFE TSSQCSKPSV IFLTKR-GRQV CADPSEEWVQ KYVSDLELSACCL3L1 Human Recombinant fused with a 22 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 90 amino acids (26-93 a.a.) and having a molecular mass of 10kDa.

Please prevent freeze-thaw cycles.

CCL3L1Recombinant Human LD78-β (CCL3L1); C-C motif chemokine 3-like 1, G0/G1 switch regulatory protein 19-2, LD78-beta(1-70), PAT 464.2, Small-inducible cytokine A3-like 1, Tonsillar lymphocyte LD78 β protein, CCL3L1, D17S1718, G0S19-2, SCyA3L1, LD78, 464.2, SCyA3L, LD78BeTA, MGC12815

CHM-263-20 °C

5 µg20 µg1 mg

50 130

2,700

APLAADTPTA CCFSYTSRQI PQNFIADYFE TSSQCSKPSV IFLTKRGRQV CADPSEEWVQ KYVS-DLELSACCL3L1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain contain-ing 70 amino acids and having a molecular mass of 7.7kDa.

CTACK CTACK is a chemotactic factor that attracts skin-associated memory T-lymphocytes. It is involved in mediating homing of lymphocytes to cutaneous sites and binds to CCR10.

CTACK HumanRecombinant Human CTACK (CCL27); ALP, CTACK, eSKINe, ILC, PeSKy, SCyA27, CCL27, C-C motif chemokine 27, Small-inducible cytokine A27, IL-11 R-α-locus chemokine, Skinkine, eSkine, Cutaneous T-cell-attracting chemokine

CHM-373-20 °C

5 µg20 µg1 mg

50 130

2,250

MFLLPPSTAC CTQLYRKPLS DKLLRKVIQV ELQEADGDCH LQAFVLHLAQ RSICIHPQNP SLSQWFE-HQE RKLHGTLPKL NFGMLRKMGCTACK Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain contain-ing 89 amino acids (25-112 a.a.) and having a molecular mass of 10.3kDa.

323 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mCTACKRecombinant Mouse CTACK (CCL27); C-C motif chemokine 27, CC chemokine ILC, Cutaneous T-cell-attracting chemokine, CTACK, eSkine, IL-11 R-α-locus chemokine, ALP, mILC, Skinkine, Small-inducible cytokine A27, Ccl27, Ilc, Scya27

CHM-013-20 °C

5 µg20 µg1 mg

50 130

2,700

LPLPSSTSCC TQLYRQPLPS RLLRRIVHME LQEADGDCHL QAVVLHLARR SVCVHPQNRS LARWL-ERQGK RLQGTVPSLN LVLQKKMYSN PQQQNCTACK is a chemotactic factor that attracts skin-associated memory T-lymphocytes. CTACK is involved in mediating homing of lymphocytes to cutaneous sites. CTACK Binds to CCR10. CTACK Mouse Recom-binant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 95 amino acids and having a molecular mass of 10.9kDa.

CXCL16 (C-X-C Motif Chemokine 16)Mouse CXCL16 is a nonELR motif including CXC chemokine with a transmembrane domain. Mouse CXCL16 cDNA encodes a 246 a.a. precursor protein with a putative 26 a.a. residue signal peptide, an 88 a.a. residue chemokine domain, an 87 a.a. resi-due mucinlike spacer region, a 22 a.a. residue transmembrane domain, and a 23 a.a. residue cytoplasmic tail. CXCL16 induces a strong chemotactic response and calcium mobilization. Further-more, CXCL16 acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. Mouse CXCL16 is generated by dendritic cells in lymphoid organ T cell zones as well as by cells in the splenic red pulp both as membranebound and soluble forms. CXCR6/Bonzo (STRL33 and TYMSTR) is the receptor for CXCL16. CXCL16 is expressed in the spleen, lymph nodes, and Peyer patches. It is also expressed in non-lymphoid tis-sues such as lung, kidney, small intestine, and thymus, with weak expression in heart and liver and no expression in brain and purified B- and T-cells.CXCL16 deficiency is linked to breast cancer progression. In addition, CXCL16 is in-volved in immunological liver injury by regulating T lymphocyte infiltration in liver tissue. Furtheremore, CXCL16 has a distinctive role in the maintenance of cardiac allograft tolerance mediated by natural killer T cells. Moreover, CXCL16 has a significant role in not only the production of IFN-γ by NKT cells, but also promotion of Th1-inclined immune responses mediated by NKT cells.

mCXCL16Recombinant Mouse CXCL16; C-X-C motif chemokine 16, Small-inducible cytokine B16, Transmembrane chemokine CXCL16, Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein, SR-PSOX, Cxcl16, Srpsox, Zmynd15, AV290116, BB024863, 0910001K24Rik

CHM-363-20 °C

5 µg25 µg1 mg

50 130

2,700

NQGSVAGSCS CDRTISSGTQ IPQGTLDHIR KYLKAFHRCP FFIRFQLQSK SVCGGSQDQW VRELVD-CFER KECGTGHGKS FHHQKHLPCXCL16 Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain contain-ing 88 amino acids and having a molecular mass of 9.9kDa.

324 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


CXCL17 (C-X-C Motif Chemokine 17)Dendritic cell and monocyte chemokinelike protein (DMC/CXCL17/VEGF-correlated chemokine 1/VCC1), is a secreted molecule with a size and predicted 3-dimensional folding pattern similar to that of chemokines CXCL8/IL8 and CXCL14/BRAK. CXCL17 is constitutively generated by airway and intestinal epithelium. CXCL17 induces the chemotaxis of quiescent, but not LPS-activated peripheral blood monocytes and den-dritic cells, and it also binds these cells specifically. The expression of CXCL17 is increased in endothelial cells when they are induced to form tubes in vitro. CXCL17, CXCL1/GRO and CXCL8/IL8 which have roles in angiogenesis, show significantly cor-related expression with that of VEGF in primary lung, breast and esophageal tumors. Therefore, CXCL17 is suggested to have a role in tumor angiogenesis. The mature Rat CXCL17 shares 82%, 71% amino acid sequence identity with mouse, human CXCL17, respectively.

CXCL17Recombinant Human VeGF Co-regulated Chemokine 1; VeGF coregulated chemokine 1, C-X-C motif chemokine 17, Dendritic cell and monocyte chemokine-like protein, DMC, CXCL17, VCC1, Dcip1, VCC-1, UNQ473

CHM-019-20 °C

5 µg25 µg1 mg

50 130

2,700

SSLNPGVARG HRDRGQASRR WLQEGGQECE CKDWFLRAPR RKFMTVSGLP KKQCPCDHFK GNVKKTRHQR HHRKPNKHSR ACQQFLKQCQ LRSFALPLCXCL17 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain contain-ing 98 amino acids and having a molecular mass of 11.5kDa.

rCXCL17Recombinant Rat VeGF Co-regulated Chemokine 1; Protein Cxcl17, Cxcl17, RGD1304717, C-X-C motif chemokine 17, VeGF co-regulated chemokine 1, Vcc1, VCC-1

CHM-281-20 °C

5 µg25 µg1 mg

50 130

2,700

SPNQEVARHH GDQHQAPRRW LWEGGQECDC KDWSLRVSKR KTTAVLEPPR KQCPCDHVKG SEK-KNRRQKH HRKSQRPSRT CQQFLKRCQL ASFTLPLCXCL17 Rat Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 97 amino acids and having a molecular mass of 11.5kDa.

eNA 78Recombinant Human epithelial Neutrophil-Activating Protein 78 (CXCL5); Small inducible cytokine B5, CXCL5, epithelial-derived neutrophil-activating protein 78, Neutrophil-activating peptide eNA-78, eNA-78(1-78), chemokine (C-X-C motif) ligand 5, SCyB5

CHM-331-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be, Ala- Ala -Val-Leu-ArgEpithelial Neutrophil-Activating Protein 78 Human Recombinant produced in E.Coli is a single, non-glyco-sylated, polypeptide chain containing 74 amino acids and having a molecular mass of 8020 Dalton.

meNA 78Recombinant Mouse epithelial Neutrophil-Activating Protein 78 (CXCL5); C-X-C motif chemokine 5, Small-inducible cytokine B5, Cytokine LIX, Cxcl5, Scyb5, LIX, GCP-2, Scyb6, eNA-78, AMCF-II

CHM-365-20 °C

5 µg20 µg1 mg

50 130

2,700

APSSVIAATE LRCVCLTVTP KINPKLIANL EVIPAGPQCP TVEVIAKLKN QKEVCLDPEA PVIKKIIIQK ILGSDKKKAK RNALAVERTA SVQEpithelial Neutrophil-Activating Protein 78 Mouse Recombinant produced in E.Coli is a single, non-glyco-sylated, polypeptide chain containing 93 amino acids and having a molecular mass of 9.8kDa.

325 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


eNA 78 (8-78 a.a.)Recombinant Human epithelial Neutrophil-Activating Protein 78 (CXCL5), 8-78 a.a.; Small inducible cytokine B5, CXCL5, epithelial-derived neutrophil-activating protein 78, Neutrophil-activating peptide eNA-78, eNA-78(1-78), chemokine (C-X-C motif) ligand 5, SCyB5

CHM-265-20 °C

5 µg20 µg1 mg

50 130

2,700

LRELRCVCLQ TTQGVHPKMI SNLQVFAIGP QCSKVEVVAS LKNGKEICLD PEAPFLKKVI QKILDG-GNKE N.Epithelial Neutrophil-Activating Protein 78 Human Recombinant produced in E.Coli is a single, non-glyco-sylated, polypeptide chain containing 71 amino acids (8-78 a.a.) and having a molecular mass of 7.8kDa.

reNA 78Recombinant Rat epithelial Neutrophil-Activating Protein 78 (CXCL5); C-X-C motif chemokine 5, Small-inducible cytokine B5, Cytokine LIX, Cxcl5, Scyb5, LIX, GCP-2, Scyb6, eNA-78, AMCF-II

CHM-267-20 °C

5 µg20 µg1 mg

50 130

2,700

APFSAMVATE LRCVCLTLAP RINPKMIANL EVIPAGPHCP KVEVIAKLKN QKDNVCLDPQ APLIKKVIQK ILGSENKKTK RNALALVRSA STQEpithelial Neutrophil-Activating Protein 78 Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 93 amino acids and having a molecular mass of 10.0kDa.

eotaxin (CCLL11 (Chemokine (C-C motif) ligand 11))Chemokine (C-C motif) ligand 11 (CCL11) is a small cytokine belonging to the CC chemokine family that is also known as eotaxin. CCL11 selectively recruits eosinophils by inducing their chemotaxis, and therefore, is implicated in allergic responses. The effects of CCL11 are mediated by its binding to a G-protein-linked receptor known as a chemokine receptor. Chemokine receptors for which CCL11 is a ligand include CCR2, CCR3 and CCR5. The gene for human CCL11 (scya11) is encoded on three exons and is located on chromosome 17.

eotaxin HumanRecombinant Human eotaxin (CCL11); Small inducible cytokine A11, CCL11, eosinophil chemotactic protein, chemokine (C-C motif) ligand 11, SCyA11, MGC22554

CHM-256-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Gly-Pro-Ala-Ser-ValEotaxin Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 74 amino acids and having a molecular mass of 8345.9 Dalton.

eotaxin, HisRecombinant Human eotaxin (CCL11), His Tag; Small inducible cytokine A11, CCL11, eosinophil chemotactic protein, chemokine (C-C motif) ligand 11, SCyA11, MGC22554

CHM-344-20 °C

5 µg20 µg1 mg

50 130

2,000

MGSSHHHHHH SSGLVPRGSH MGPASVPTTC CFNLANRKIP LQRLESYRRI TSGKCPQKAV IFKT-KLAKDI CADPKKKWVQ DSMKYLDQKS PTPKPEotaxin His Tag Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 74 amino acids fragment (24-87) corresponding to the mature Eotaxin protein and having a molecular mass of 8345.9 Dalton with an amino-terminal hexahistidine tag.

326 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


meotaxinRecombinant Mouse eotaxin (CCL11); Small inducible cytokine A11, CCL11, eosinophil chemotactic protein, chemokine (C-C motif) ligand 11, SCyA11

CHM-308-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be His-Pro-Gly-Ser-IleEotaxin Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 74 amino acids and having a molecular mass of 8403.2 Dalton.

reotaxinRecombinant Rat eotaxin (CCL11); Small inducible cytokine A11, CCL11, eosinophil chemotactic protein, chemokine (C-C motif) ligand 11, SCyA11

CHM-260-20 °C

5 µg20 µg1 mg

50 130

2,700

HPGSIPTSCC FTMTSKKIPN TLLKSYKRIT NNRCTLKAIV FKTKLGKEICADPKKKWVQD ATKHLDQKLQ TPKPotaxin Rat Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 74 amino acids and having a molecular mass of 8.4kDa.

rmeotaxinRecombinant Rhesus Macaque eotaxin (CCL11); Small inducible cytokine A11, CCL11, eosinophil chemotactic protein, chemokine (C-C motif) ligand 11, SCyA11, MGC22554

CHM-022-20 °C

5 µg20 µg1 mg

50 130

2,700

GPDSVATTCC FTLTNKKIPL QRLESYRRII SGKCPQKAVI FKTKLAKDIC ADPKKKWVQD SMKYL-DRKSP TPKPRecombinant Eotaxin Rhesus Macaque produced in E.Coli cells is a non-glycosylated, homodimeric protein containing 74 amino acid chain and having a molecular mass of 8.4kDa.

eotaxin 2Recombinant Human eotaxin-2 (CCL24); C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, eosinophil chemotactic protein 2, eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCyA24, eotaxin2, CCL-24

CHM-238-20 °C

5 µg20 µg1 mg

50 130

2,700

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQK-KASPRARAVACCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa.

327 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


eotaxin-2 (CCL24)Eotaxin-2, also called MPIF2 andCkb6, is a novel CC chemokine produced by acti-vated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells ex-pressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Additionally, Eotaxin-2 inhibits the proliferation of multipo-tential hematopoietic progenitor cells. The mature protein, which includes C-terminal truncation, contains 78 amino acids (92 amino acids for the mouse homolog, without C-terminal truncation).CCL24 functions as a chemotactic chemokine for resting t-lymphocytes, and eosino-phils. CCL24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line and binds to CCR3.

meotaxin 2Recombinant Mouse eotaxin-2 (CCL24); C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, eosinophil chemotactic protein 2, Ckb-6, eotaxin-2, CCL24, MPIF2, MPIF-2, SCyA24, eotaxin2, CCL-24

CHM-368 -20 °C

5 µg20 µg1 mg

50 130

2,700

CCL24 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.3 kDa.

reotaxin 2Recombinant Rat eotaxin-2 (CCL24); C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, eosinophil chemotactic protein 2, Ckb-6, eotaxin-2, CCL24,MPIF2, MPIF-2, SCyA24, eotaxin2, CCL-24

CHM-282-20 °C

5 µg20 µg1 mg

50 130

2,700

VTIPSSCCVT FISKKIPVNR VISYQLANGS ICPKAGVIFI TKKGHKICTD PKLPWVQKHI KNLDAKRNQP SEGAKALGPK FVIQKLRGNS TKVCCL24 Rat Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.2kDa.

328 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


eotaxin-3 (CCL26)Eotaxin-3 (CCL26) is a small cytokine that belongs to the CC chemokine family also known as TARC (thymus and activation regulated chemokine). CCL26 is major eo-taxin produced and released by alveolar epithelial cells which is involved in autoregula-tion of CCR3 receptors and other eotaxins. E otaxin-3 is involved in immunoregula-tory and inflammatory processes. It specifically binds and stimulates chemotaxis in T cells and elicits its effects by interacting with the chemokine receptor CCR4. CCL26 exhibits chemotactic activity for normal peripheral blood eosinophils and basophils. Eotaxin-3 may play a part in the eosinophil accumulation in atopic diseases. Eotaxin-3 is overexpressed in eosinophilic esophagitis, and the expression level correlates with disease severity. Eotaxin-3 is expressed constitutively in thymus, but only briefly in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL26 is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7.

eotaxin 3 HumanRecombinant Human eotaxin-3 (CCL26); C-C motif chemokine 26, Small-inducible cytokine A26, eotaxin-3, Macrophage inflammatory protein 4-α, MIP-4-α, Thymic stroma chemokine-1, TSC-1, CC chemokine IMAC, CCL26, SCyA26, IMAC, MIP-4a, MGC126714, MIP-α

CHM-362-20 °C

10 µg50 µg1 mg

50 130

1,800

MTRGSDISKT CCFQYSHKPL PWTWVRSYEF TSNSCSQRAV IFTTKRGKKV CTHPRKKWVQ KYISLLK-TPK QLEotaxin-3 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain contain-ing 72 amino acids (24-94 a.a.) and having a total molecular mass of 8.5kDa

exodus 2 (CCL21)Chemokine (C-C motif) ligand 21 (CCL21) is a small cytokine belonging to the CC che-mokine family. This chemokine is also known as 6Ckine (because it has six conserved cysteine residues instead of the four cysteines typical to chemokines), exodus-2, and secondary lymphoid-tissue chemokine (SLC). CCL21 is expressed predominantly in the lymph nodes and, in contrast to other CC chemokines, is chemotactic for lympho-cytes. The gene for CCL21 is located on human chromosome 9. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7.

exodus 2 HumanRecombinant Human exodus-2 (CCL21); Small inducible cytokine A21, CCL21, Beta chemokine exodus-2, 6Ckine, Secondary lymphoid-tissue chemokine, SLC, chemokine (C-C motif) ligand 21, eCL, CKb9, TCA4, SCyA21, MGC34555

CHM-332-20 °C

5 µg20 µg1 mg

50 130

2,700

SDGGAQDCCL KYSQRKIPAK VVRSYRKQEP SLGCSIPAIL FLPRKRSQAE LCADPKELWV QQLMQHLDKT PSPQKPAQGC RKDRGASKTG KKGKGSKGCR KTERSQTPKG PExodus-2 Human Recombinant produced in E.Coli as a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12219 Dalton.

329 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mexodus 2Recombinant Mouse exodus-2 (CCL21); Small inducible cytokine A21, CCL21, Beta chemokine exodus-2, 6Ckine, Secondary lymphoid-tissue chemokine, SLC, chemokine (C-C motif) ligand 21, eCL, CKb9, TCA4, SCyA21, MGC3455

CHM-371-20 °C

5 µg20 µg1 mg

50 130

2,700

SDGGGQDCCL KYSQKKIPYS IVRGYRKQEP SLGCPIPAIL FLPRKHSKPE LCANPEEGWV QN-LMRRLDQP PAPGKQSPGC RKNRGTSKSG KKGKGSKGCK RTEQTQPSRGExodus-2 Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain contain-ing 110 amino acids and having a molecular mass of 12kDa.

FractalkineFractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutro-phils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22.mokine family. This chemokine is also known as 6Ckine (be-cause it has six conserved cysteine residues instead of the four cysteines typical to chemokines), exodus-2, and secondary lymphoid-tissue chemokine (SLC). CCL21 is expressed predominantly in the lymph nodes and, in contrast to other CC chemokines, is chemotactic for lymphocytes. The gene for CCL21 is located on human chromo-some 9. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7.

Fractalkine HumanRecombinant Human Fractalkine (CX3CL1); Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCyD1, ABCD-3, C3Xkine

CHM-235-20 °C

5 µg20 µg1 mg

50 130

2,700

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQA-AALTRNGFractalkine Human Recombinant- produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton.L.F. Yoong, et al., Journal of Neuroscience, 27, 21 (2007).

Fractalkine HisRecombinant Human Fractalkine (CX3CL1) His Tag; Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCyD1, ABCD-3, C3Xkine

CHM-360-20 °C

2 µg10 µg1 mg

50 130

4,800

MGSSHHHHHH SSGLVPRGSH MQHHGVTKCN ITCSKMTSKI PVALLIHYQQ NQASCGKRAI ILET-RQHRLF CADPKEQWVK DAMQHLDRQA AALTRNGFractalkine Human Recombinant fused with a 20 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 97 amino acids (25-100 a.a.) and having a molecular mass of 10.9kDa.

330 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


rFractalkineRecombinant Rat Fractalkine (CX3CL1); Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCyD1, ABCD-3, C3Xkine

CHM-005-20 °C

5 µg20 µg1 mg

50 130

2,700

QHLGMTKCNI TCHKMTSPIP VTLLIHYQLN QESCGKRAII LETRQHRHFC ADPKEKWVQD AMKHLD-HQTA ALTRNGFractalkine Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8.7kDa.

mFractalkineRecombinant Mouse Fractalkine (CX3CL1); Fractalkine, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, Neurotactin, Small-inducible cytokine D1, Cx3cl1, Cx3c, Fkn, Scyd1, CX3C, ABCD-3, AB030188, AI848747, D8Bwg0439e

CHM-017-20 °C

5 µg20 µg1 mg

50 130

2,700

QHLGMTKCEI MCGKMTSRIP VALLIRYQLN QESCGKRAIV LETTQHRRFC ADPKEKWVQD AMKHLD-HQAA ALTKNGFractalkine Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8.7kDa.

GRO αChemokine (C-X-C motif) ligand 1 (CXCL1) is a small cytokine belonging to the CXC chemokine family that was previously called GRO1 oncogene, Neutrophil-activating protein 3 (NAP-3) and melanoma growth stimulating activity, α (MSGA-a). It is se-creted by human melanoma cells, has mitogenic properties and is implicated in mela-noma pathogenesis. CXCL1 is expressed by macrophages, neutrophilsand epithelial cells, and has neutrophil chemoattractant activity. CXCL1 plays a role in spinal cord development by inhibiting the migration of oligodendrocyte precursors and is involved in the processes of angiogenesis, inflammation, wound healing, and tumorigenesis. This chemokine elicits its effects by signaling through the chemokine receptor CXCR2. The gene for CXCL1 is located on human chromosome 4 amongst genes for other CXC chemokines.

GRO αRecombinant Human GRO-α (CXCL1); Growth-regulated protein α, CXCL1, Melanoma growth stimulatory activity, MGSA, Neutrophil-activating protein 3, NAP-3, GRO-α (1-73), chemokine (C-X-C motif) ligand 1, GRO1, GROa, SCyB1, MGSA-a, MGSA α

CHM-329-20 °C

5 µg25 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Ala-Ser-Val-Ala-ThrGRO Α Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7811 Dalton.

331 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


GRO α, HisRecombinant Human GRO-α (CXCL1), His Tag; Growth-regulated protein α, CXCL1, Melanoma growth stimulatory activity, MGSA, Neutrophil-activating protein 3, NAP-3, GRO-α(1-73), chemokine (C-X-C motif) ligand 1, GRO1, GROa, SCyB1, MGSA-a, MGSA α

CHM-242-20 °C

10 µg50 µg1 mg

50 130

1,800

MGSSHHHHHH SSGLVPRGSH MASVATELRC QCLQTLQGIH PKNIQSVNVK SPGPHCAQTE VI-ATLKNGRK ACLNPASPIV KKIIEKMLNS DKSNCXCL1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 94 amino acids (35-107) and having a molecular mass of 10.1 kDa. The CXCL1 is fused to a 20 amino acid His-Tag at N-terminus.

mGRO1/KCRecombinant Mouse GRO/KC (CXCL1); Growth-regulated α protein, CXCL1, Platelet-derived growth factor-inducible protein KC, Secretory protein N51, KC, Fsp, N51, gro, Gro1, Mgsa, Scyb1, chemokine (C-X-C motif) ligand 1

CHM-335-20 °C

5 µg20 µg1 mg

50 130

2,700

RLATGAPIANELRCQ CLQTMAGIHL KNIQSLKVLP SGPHCTQTEV IATLKNGREA CLDPEAPLVQ KIVQKMLKGV PKKC Mouse Recombinant also known as N51 and GRO1 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of approximately 8 kDa.

mGRO1/KC, HisRecombinant Mouse GRO/KC (CXCL1), His Tag; Growth-regulated α protein, CXCL1, Platelet-derived growth factor-inducible protein KC, Secretory protein N51, KC, Fsp, N51, gro, Gro1, Mgsa, Scyb1, chemokine (C-X-C motif) ligand 1

CHM-002-20 °C

5 µg20 µg1 mg

50 130

3,600

MGSSHHHHHH SSGLVPRGSH MGSHMAPIAN ELRCQCLQTM AGIHLKNIQS LKVLPSGPHC TQTEVI-ATLK NGREACLDPE APLVQKIVQK MLKGVPKGRO1/KC Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain contain-ing 97 amino acids (25-96 a.a.) and having a molecular mass of 10.5kDa. GRO1 is fused to a 25 amino acid His-tag at N-terminus.

rGRO αRecombinant Rat GRO-α (CXCL1); Growth-regulated protein α, CXCL1, Melanoma growth stimulatory activity, MGSA, Neutrophil-activating protein 3, NAP-3, GRO-α(1-73), chemokine (C-X-C motif) ligand 1, GRO1, GROa, SCyB1, MGSA-a, MGSA α

CHM-375-20 °C

5 µg25 µg1 mg

50 130

2,700

APVANELRCQ CLQTVAGIHF KNIQSLKVMP PGPHCTQTEV IATLKNGREA CLDPEAPMVQ KIVQK-MLKGV PKCXCL1 Rat Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7.8 kDa.

332 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


GRO βRecombinant Human GRO-β/mIP-2 (CXCL2)Macrophage inflammatory protein 2-α, MIP2-α, CXCL2, Growth- regulated protein β, Gro-β, chemokine (C-X-C motif) ligand 2, GRO2, GROb, MIP2, MIP2A, SCyB2, MGSA-b, MIP-2a, CINC-2a, MGSA β

CHM-309-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Ala-Pro-Leu-Ala-ThrGRO-β Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7908 Dalton.

GRO β HisRecombinant Human GRO-β/mIP-2 (CXCL2) His; Macrophage inflammatory protein 2-α, MIP2-α, CXCL2, Growth- regulated protein β, Gro-β, chemokine (C-X-C motif) ligand 2, GRO2, GROb, MIP2, MIP2A, SCyB2, MGSA-b, MIP-2a, CINC-2a, MGSA β

CHM-356-20 °C

2 µg10 µg1 mg

50 130

2,700

MGSSHHHHHH SSGLVPRGSH MAPLATELRC QCLQTLQGIH LKNIQSVKVK SPGPHCAQTE VI-ATLKNGQK ACLNPASPMV KKIIEKMLKNGKSNGRO-β Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 94 amino acids and having a molecular mass of 10.1 kDa. The GRO-b is fused to 20 amino acid His Tag at N-terminus.

mGRO bRecombinant Mouse GRO-β/mIP-2 (CXCL2); Macrophage inflammatory protein 2-α, MIP2-α, CXCL2, Growth- regulated protein β, Gro-β, chemokine (C-X-C motif) ligand 2, GRO2, GROb, MIP2, MIP2A, SCyB2, MGSA-b, MIP-2a, CINC-2a, MGSA β

CHM-338-20 °C

5 µg20 µg1 mg

50 130

2,700

AVVASELRCQ CLKTLPRVDF KNIQSLSVTP PGPHCAQTEV IATLKGGQKV CLDPEAPLVQ KIIQKILNKG KANGRO-β Mouse Recombinant also caled mouse MIP-2 produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7849 Dalton.

rGRO βRecombinant Rat GRO-β/mIP-2 (CXCL2); Macrophage inflammatory protein 2-α, MIP2-α, CXCL2, Growth- regulated protein β, Gro-β, chemokine (C-X-C motif) ligand 2, GRO2, GROb, MIP2, MIP2A, SCyB2, MGSA-b, MIP-2a, CINC-2a, MGSA β, CINC-3

CHM-372-20 °C

5 µg20 µg1 mg

50 130

2,700

VVVASELRCQ CLTTLPRVDF KNIQSLTVTP PGPHCAQTEV IATLKDGHEV CLNPEAPLVQ RIVQKILNKG KANGRO-β Rat Recombinant also called Rat MIP-2 produced in E.Coli is a single, non-glycosylated, polypep-tide chain containing 73 amino acids and having a molecular mass of 7923 Dalton.

333 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


Viral MIP-2 is closely related to MIP-1α, show amino acid sequence similarity of about 41%. At the amino acid sequence level, Viral MIP-1 and Viral MIP-2 share 48% similar-ity. Viral MIP-1 and Viral MIP-2 are more closely linked to one another phylogenetically than to other human chemokines, signifying that they have gene duplication within the virus rather than by two independent gene aquisitions. Viral MIP-2 binds to the CCR3 chemokine receptor through which eotaxin and other β chemokines activate eosino-phils. Viral MIP-2 activates and chemoattract human eosinphils.

vmIP2Recombinant Viral Macrophage inflammatory Protein-2; MIP-2 Viral, Viral MIP-2, MIP2 Viral, Viral MIP2, Viral Macrophage inflammatory Protein-2

CHM-376-20 °C

10 µg50 µg1 mg

50 130

1,350

LGASWHRPDK CCLGYQKRPL PQVLLSSWYP TSQLCSKPGV IFLTKRGRQVCADKSKDWVK KLMQQLPVTAMIP-2 Viral Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of 7.9 kDa.

GRO gRecombinant Human GRO-γ (CXCL3); Macrophage inflammatory protein 2-β, MIP2-β, CXCL3, Growth-regulated protein γ, GRO-γ, GRO-γ(1-73), GRO3, GROg, MIP2B, SCyB3, MIP-2b, CINC-2b, MGSA γ

CHM-310-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Ala-Ser-Val-Val-ThrGRO-Γ Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7902 Dalton.

GRO γ HisRecombinant Human GRO-γ (CXCL3), His Tag; Macrophage inflammatory protein 2-β, MIP2-β, CXCL3, Growth-regulated protein γ, GRO-γ, GRO-γ(1-73), GRO3, GROg, MIP2B, SCyB3, MIP-2b, CINC-2b, MGSA γ

CHM-244-20 °C

2 µg10 µg1 mg

50 130

5,200

MGSSHHHHHH SSGLVPRGSH MASVVTELRC QCLQTLQGIH LKNIQSVNVR SPGPHCAQTE VI-ATLKNGKK ACLNPASPMV QKIIEKILNKGSTNGRO-Γ Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 94 amino acids (35-107) and having a molecular mass of 7902 Dalton. The GRO-g is fused to 20 amino acid His-Tag at N-Terminus.

mGRO γRecombinant Mouse GRO-γ (CXCL3); C-X-C motif chemokine 3, Dendritic cell inflammatory protein 1, Cxcl3, Dcip1, Gm1960

CHM-255-20 °C

2 µg10 µg1 mg

50 130

2,700

SELRCQCLNT LPRVDFETIQ SLTVTPPGPH CTQTEVIATL KDGQEVCLNP QGPRLQIIIK KILKSGKSSGRO-γ Mouse Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular mass of 7.7kDa.

mGRO γ HisRecombinant Mouse GRO-γ (CXCL3), His Tag; C-X-C motif chemokine 3, Dendritic cell inflammatory protein 1, Cxcl3, Dcip1, Gm1960, GRO-g

CHM-283-20 °C

2 µg10 µg1 mg

50 130

2,700

MGSSHHHHHH SSGLVPRGSH MGSHMAVVAS ELRCQCLNTL PRVDFETIQS LTVTPPGPHC TQTEVI-ATLK DGQEVCLNPQ GPRLQIIIKK ILKSGKSSGRO-γ Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 98 amino acids (28-100 a.a.) and having a molecular mass of 10.6kDa. CXCL3 is fused to a 25 amino acid His-tag at N-terminus.

334 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


rGRO γ/CINC-2aRecombinant Rat GRO-γ (CXCL3), CINC-2 α; Cytokine-induced neutrophil chemoattractant 2, CINC2, CINC-2, Macrophage inflammatory protein 2-α

CHM-258-20 °C

2 µg10 µg1 mg

50 130

2,700

RELRCQCLKT LPRVDFENIQ SLTVTPPGPH CTQTEVIATL KDGQEVCLNP QAPRLQKIIQ KLLKSDKSSGRO-g Rat Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular mass of 7.8kDa.


rGRO γ/CINC-2bRecombinant Rat GRO-γ (CXCL3), CINC-2 β; Macrophage inflammatory protein 2-β, MIP2-β, CXCL3, Growth-regulated protein γ, GRO-γ, GRO-γ (1-73), GRO3, GROg, MIP2B, SCYB3, MIP-2b, CINC-2b, MGSA γ

CHM-273-20 °C

2 µg10 µg1 mg

50 130

2,700

RELRCQCLKT LPRVDFENIQ SLTVTPPGPH CTQTEVIATL KDGQEVCLNP QAPRLQKIIQ KLLKSPSLGRO-γ Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a total molecular mass of 7.8kDa.

HCC 1Recombinant Human HCC-1 (CCL14); Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, Sy14, HCC-1, HCC-3, SCyL2, SCyA14

CHM-311-20 °C

2 µg10 µg1 mg

50 130

2,700

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKENHCC-1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton.

HCC 1 (66 a.a.)Recombinant Human HCC-1 (CCL14) (66 a.a.); Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, Sy14, HCC-1, HCC-3, SCyL2, SCyA14

CHM-006-20 °C

2 µg10 µg1 mg

50 130

2,700

GPYHPSECCF TYTTYKIPRQ RIMDYYETNS QCSKPGIVFI TKRGHSVCTN PSDKWVQDYI KDMKENHCC-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 66 amino acids and having a molecular mass of 7.8kDa.

HCC 1 HisRecombinant Human HCC-1 (CCL14) His Tag; Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, Sy14, HCC-1, HCC-3, SCyL2, SCyA14

CHM-253-20 °C

2 µg10 µg1 mg

50 130

2,700

MGSSHHHHHH SSGLVPRGSH MTKTESSSRG PYHPSECCFT YTTYKIPRQR IMDYYETNSQ CSKP-GIVFIT KRGHSVCTNP SDKWVQDYIK DMKENHCC-1 Human Recombinant fused with a 21 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 95 amino acids (20-93 a.a.) and having a molecular mass of 10.9kDa.

335 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


I 309Recombinant Human I-309 (CCL1); Small inducible cytokine A1, CCL1, T lymphocyte-secreted protein I-309, chemokine (C-C motif) ligand 1, P500, SISe, TCA3, I-309, SCyA1

CHM-312-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Ser-Lys-Ser-Met-GlnI-309 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 74 amino acids and having a molecular mass of 8504 Dalton.

I 309 HisRecombinant Human I-309 (CCL1) His Tag; Small inducible cytokine A1, CCL1, T lymphocyte-secreted protein I-309, chemokine (C-C motif) ligand 1, P500, SISe, TCA3, I-309, SCyA1

CHM-254-20 °C

2 µg10 µg1 mg

50 130

5,200

MGSSHHHHHH SSGLVPRGSH MKSMQVPFSR CCFSFAEQEI PLRAILCYRN TSSICSNEGL IFKLKRG-KEA CALDTVGWVQ RHRKMLRHCP SKRKI-309 Human Recombinant fused with a 21 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 94 amino acids (24-96 a.a.) and having a molecular mass of 10.8kDa.


IL-8 (Interleukin-8)Interleukin-8 (IL-8) is a chemokine produced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles, the Weibel-Palade bodies. When first encountering an antigen, the primary cells to encounter it are the macrophages who phagocytose the particle. Upon processing, they release chemokines to signal other immune cells to come in to the site of inflammation. IL-8 is one such chemokine. It serves as a chemical signal that attracts neutrophils at the site of inflammation, and therefore is also known as Neutrophil Chemotactic Factor.

IL 8 (1-72)Recombinant Human Interleukin-8 (1-72) (CXCL8); IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, emoctakin, K60, NAF, LeCT, LUCT, 3-10C, LyNAP, SCyB8, TSG-1, AMCF-I, b-eNAP

CHM-231-20 °C

5 µg25 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Ser-Ala-Lys-Glu-LeuInterleukin-8 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 72 amino acids and having a molecular mass of 8452 Dalton.

336 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


pIL 8Recombinant Porcine Interleukin-8 (1-72) (CXCL8); IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, emoctakin, K60, NAF, LeCT, LUCT, 3-10C, LyNAP, SCyB8, TSG-1, AMCF-I, b-eNAP, Alveolar macrophage chemotactic factor I

CHM-340-20 °C

5 µg20 µg1 mg

50 130

2,700

ARVSAELRCQ CINTHSTPFH PKFIKELRVI ESGPHCENSE IIVKLVNGKE VCLDPKEKWV QKVVQIFLKR TEKQQQQQInterleukin-8 Porcine Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 9.1kDa.

IL 8 (1-77)Recombinant Human Interleukin-8 (1-77) (CXCL8); IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, emoctakin, K60, NAF, LeCT, LUCT, 3-10C, LyNAP, SCyB8, TSG-1, AMCF-I, b-eNAP

CHM-327-20 °C

5 µg25 µg1 mg

50 130

2,700

AVLPRSAKEL RCQCIKTYSK PFHPKFIKEL RVIESGPHCA NTEIIVKLSD GRELCLDPKE NWVQRVVEKF LKRAENSInterleukin-8 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 77 amino acids and having a molecular mass of 8904 Dalton.

IL 8 PichiaRecombinant Human Interleukin-8 (1-77) (CXCL8) Pichia; IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, emoctakin, K60, NAF, LeCT, LUCT, 3-10C, LyNAP, SCyB8, TSG-1, AMCF-I, b-eNAP

CHM-349-20 °C

5 µg25 µg1 mg

50 130

2,700

Interleukin-8 Human Recombinant produced in Yeast is a single, glycosylated polypeptide chain containing 79 amino acids and having a molecular mass of 9 kDa.

IL 8 (1-77), HisRecombinant Human Interleukin-8 (1-77) (CXCL8), His Tag; IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, emoctakin, K60, NAF, LeCT, LUCT, 3-10C, LyNAP, SCyB8, TSG-1, AMCF-I, b-eNAP

CHM-345-20 °C

10 µg50 µg1 mg

50 130

2,200

Interleukin-8 Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 77 amino acids fragment (23-99) and having a total molecular mass of 13.7kDa with an amino-terminal hexahistidine tag.

337 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


rIL 8Recombinant Rabbit Interleukin-8; IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, emoctakin, K60, NAF, LeCT, LUCT, 3-10C, LyNAP, SCyB8, TSG-1, AMCF-I, b-eNAP

CHM-261-20 °C

5 µg20 µg1 mg

50 130

3,600

AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVVQIFLKRAEQQESIL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids - a.a. 23-101). The IL-8 is expressed in E.Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa.


rmIL8Recombinant Rhesus Macaque Interleukin-8; IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, emoctakin, K60, NAF, LeCT, LUCT, 3-10C, LyNAP, SCyB8, TSG-1, AMCF-I, b-eNAP

CHM-004-20 °C

5 µg25 µg1 mg

50 130

2,700

AVLPRSAKEL RCECIKTYSK PFHPKFIKEL RVIESGPHCA NTEIIVKLSD GRELCLDPKE PWVQRVVEKF VKRAENQNPIL 8 Rhesus Macaque Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 79 amino acids and having a molecular mass of 9.1kDa.


k9IL8Recombinant Canine Interleukin-8; Interleukin-8, IL-8, C-X-C motif chemokine 8, IL8, CXCL8

CHM-009-20 °C

5 µg20 µg1 mg

50 130

2,700

AVLSRVSSEL RCQCIKTHST PFHPKYIKEL RVIDSGPHCE NSEIIVKLFN GNEVCLDPKE KWVQKVVQIF LKKAEKQDPInterleukin-8 Canine Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 79 amino acids and having a molecular mass of 9.1kDa.

338 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


IL 10 (Interleukin-10)Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family that is also known as 10 kDa interferon-γ-induced protein (?-IP10 or IP-10). CXCL10 is secreted by several cell types in response to IFN-?. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attrib-uted to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone mar-row colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.

IP 10Recombinant Human IP-10 (CXCL10); Small inducible cytokine B10, CXCL10, 10 kDa interferon-γ-induced protein, γ-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCyB10, gIP-10

CHM-330-20 °C

5 µg25 µg1 mg

50 130

2,700

IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8516 Dalton.

IP 10 HisRecombinant Human IP-10 (CXCL10), His Tag; Small inducible cytokine B10, CXCL10, 10 kDa interferon-γ-induced protein, γ-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCyB10, gIP-10

CHM-346-20 °C

5 µg25 µg1 mg

50 130

2,600

IP-10 His Tag Human Recombinant ?produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 77 amino acids fragment (22-98) and having a total molecular mass of 8.5 kDa with an amino-terminal hexahistidine tag.

mIP 10Recombinant Mouse IP-10 (CXCL10); Small inducible cytokine B10, CXCL10, 10 kDa interferon-γ-induced protein, γ-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCyB10, gIP-10

CHM-336-20 °C

5 µg25 µg1 mg

50 130

2,700

IPLARTVRCN CIHIDDGPVR MRAIGKLEII PASLSCPRVE IIATMKKNDE QRCLNPESKT IKNLMKAFSQ KRSKRAPIP-10 Mouse Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8701 Dalton.

rIP 10Recombinant Rat IP-10 (CXCL10); C-X-C motif chemokine 10, 10 kDa interferon γ-induced protein, γ-IP10, IP-10, Interferon-inducible protein 10, Protein Mob-1, Small-inducible cytokine B10, Cxcl10, Inp10, Mob1, Scyb10

CHM-264-20 °C

5 µg25 µg1 mg

50 130

2,700

IPLARTVRCT CIDFHEQPLR PRAIGKLEII PASLSCPHVE IIATMKKNNE KRCLNPESEA IKSLLKAVSQ RRSKRAPIP-10 Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa.

339 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


rmIP10Recombinant Rhesus Macaque IP-10 (CXCL10); C-X-C motif chemokine 10, 10 kDa interferon γ-induced protein, γ-IP10, IP-10, Small-inducible cytokine B10, CXCL10, SCyB10

CHM-010-20 °C

5 µg25 µg1 mg

50 130

2,700

IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSPIP-10 Rhesus macaque Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.7kDa.

I TACRecombinant Human I-TAC (CXCL11); Small inducible cytokine B11, CXCL11, Interferon-inducible T-cell α chemoattractant, I-TAC, Interferon-γ-inducible protein 9, IP-9, H174, Beta-R1, chemokine (C-X-C motif) ligand 11, IP9, b-R1, SCyB11, SCyB9B, MGC102770

CHM-334-20 °C

5 µg20 µg1 mg

50 130

2,700

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNFI-TAC Human Recombinant (Interferon-inducible T-cell α chemoattractant) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 8300 Dalton.

I TAC, HisRecombinant Human I-TAC (CXCL11), His Tag; Small inducible cytokine B11, CXCL11, Interferon-inducible T-cell α chemoattractant, I-TAC, Interferon-γ-inducible protein 9, IP-9, H174, β-R1, chemokine (C-X-C motif) ligand 11, IP9, b-R1, SCyB11, SCyB9B, MGC102770

CHM-232-20 °C

5 µg20 µg1 mg

50 130

2,700

MGSSHHHHHH SSGLVPRGSH MFPMFKRGRC LCIGPGVKAV KVADIEKASI MYPSNNCDKI EVI-ITLKENK GQRCLNPKSK QARLIIKKVE RKNFI-TAC (CXCL11) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 94 amino acids (22-94) and having a molecular mass of 10.6kDa. I-TAC is fused to a 21 amino acid His-tag at N-terminus.

LAG-1 HisCCL4L1 (C-C motif chemokine 4-like) is a member of to intercrine beta (chemokine CC) family. The CCL4L1 protein is similar to CCL4 which inhibits HIV replication in peripheral blood monocytes which express CCR5.

LAG-1 HisRecombinant Human LAG-1 (CCL4L1), His Tag; C-C motif chemokine 4-like, Lymphocyte activation gene 1 protein, LAG-1, Macrophage inflammatory protein 1-β, MIP-1-β, Monocyte adherence-induced protein 5-α, Small-inducible cytokine A4-like, CCL4L1, CCL4L, LAG1, SCyA4L1, CCL4L2, SCyA4L2, AT744.2

CHM-272-20 °C

5 µg20 µg1 mg

50 130

2,700

MGSSHHHHHH SSGLVPRGSH MGSHMAPMGS DPPTACCFSY TARKLPRNFV VDYYETSSLC SQPAV-VFQTK RGKQVCADPS ESWVQEYVYD LELNLAG-1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 94 amino acids (24-92 a.a.) and having a molecular mass of 10.5kDa (Molecular weight on SDS-PAGE will appear higher). LAG-1 is fused to a 25 amino acid His-tag at N-terminus.

340 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


LAG-1 HumanRecombinant Human LAG-1 (CCL4L1); C-C motif chemokine 4-like, Lymphocyte activation gene 1 protein, LAG-1, Macrophage inflammatory protein 1-β, MIP-1-beta, Monocyte adherence-induced protein 5-α, Small-inducible cytokine A4-like, CCL4L1, CCL4L, LAG1, SCyA4L1, CCL4L2, SCyA4L2, AT744.2

CHM-018-20 °C

5 µg20 µg1 mg

50 130

2,700

APMGSDPPTA CCFSYTARKL PRNFVVDYYE TSSLCSQPAV VFQTKRGKQV CADPSESWVQ EYVY-DLELNLAG-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 69 amino acids and having a molecular mass of 7.8kDa.

LymphotactinChemokine (C motif) ligand (XCL1) is a small cytokine belonging to the XC chemokine family that is also known as lymphotactin. It is found in high levels in spleen, thymus, in-testine and peripheral blood leukocytes, and at lower levels in lung, prostate gland and ovary. Cellular sources for XCL1 include activated thymic and peripheral blood CD8+ T cells. T his chemokine attracts T cells. In humans, XCL1 is closely related to another chemokine called XCL2, whose geneis found at the same locus on chromosome 1. XCL1 induces it chemotactic function by binding to a chemokine receptor called XCR1.

Lymphotactin HumanRecombinant Human Lymphotactin (XCL1); XCL1, Cytokine SCM-1, ATAC, Lymphotaxin, SCM-1-α, Small inducible cytokine C1, XC chemokine ligand 1, LTN, LPTN, SCM1, SCM-1, SCyC1, SCM-1a

CHM-314-20 °C

3x2 µg2x10 µg

1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Gln-Ser-Glu-Val-SerLymphotactin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10007 Dalton.

Lymphotactin HisRecombinant Human Lymphotactin (XCL1) His Tag; XCL1, Cytokine SCM-1, ATAC, Lymphotaxin, SCM-1-α, Small inducible cytokine C1, XC chemokine ligand 1, LTN, LPTN, SCM1, SCM-1, SCyC1, SCM-1a

CHM-357-20 °C

2 µg10 µg1 mg

50 130

5,200

MGSSHHHHHH SSGLVPRGSH MVGSEVSDKR TCVSLTTQRL PVSRIKTYTI TEGSLRAVIF ITKRGLKV-CA DPQATWVRDV VRSMDRKSNTRNNMIQTKPT GTQQSTNTAV TLTGXCL1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 114 amino acids (22-114 a.a.) and having a molecular mass of 12.5 kDa. The XCL1 is fused to a 20 amino acid His Tag at N-terminus.

341 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MCP 1Chemokine (C-C motif) ligand 2 (CCL2) is a small cytokine belonging to the CC che-mokine family that is also known as monocyte chemotactic protein-1 (MCP-1). It is found at the site of tooth eruption and bone degradation. CCL2 recruits immune cells, such as monocytes, to sites of tissue injury and infection. This chemokine is produced as a protein precursor containing signal peptide of 23 amino acidsand a mature pep-tide of 76 amino acids. It is a monomeric polypeptide, with a molecular weight of ap-proximately 13kDa. As with many other CC chemokines, CCL2 is located on chromo-some 17 in humans. The cell surface receptors that bind CCL2 are CCR2 and CCR5..

MCP 1Recombinant Human Monocyte Chemotactic Protein-1/mCAF (CCL2); Small inducible cytokine A2, CCL2, Monocyte chemotactic protein 1, MCP-1, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, MCAF, Monocyte secretory protein Je, HC11, chemokine (C-C motif) ligand 2, MCP1, SCyA2, GDCF-2, SMC-CF, HSMCR30, MGC9434, GDCF-2 HC11

CHM-271-20 °C

5 µg20 µg1 mg

50 130

2,700

QPDAINAPVT CCYNFTNRKI SVQRLASYRR ITSSKCPKEA VIFKTIVAKE ICADPKQKWV QDSMDHLD-KQ TQTPKTMonocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activat-ing Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa.

MCP 1 HisRecombinant Human Monocyte Chemotactic Protein-1/mCAF (CCL2), His Tag; Small inducible cytokine A2, CCL2, Monocyte chemotactic protein 1, MCP-1, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, MCAF, Monocyte secretory protein Je, HC11, chemokine (C-C motif) ligand 2, MCP1, SCyA2, GDCF-2, SMC-CF, HSMCR30, MGC9434, GDCF-2 HC11

CHM-246-20 °C

10 µg50 µg1 mg

50 130

1,800

MGSSHHHHHH SSGLVPRGSH MQPDAINAPV TCCYNFTNRK ISVQRLASYR RITSSKCPKE AVIFKTI-VAK EICADPKQKW VQDSMDHLDK QTQTPKTMCP-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 97 amino acids (24-99) and having a molecular mass of 10.9 kDa. The MCP-1 is fused to 20 amino acids His-Tag at N-terminus.

mMCP 1Recombinant Mouse Monocyte Chemotactic Protein-1 (CCL2); Small inducible cytokine A2, CCL2, Monocyte chemotactic protein 1, MCP-1, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, MCAF, Monocyte secretory protein Je, HC11, chemokine (C-C motif) ligand 2, MCP1, SCyA2, GDCF-2, SMC-CF, HSMCR30, MGC9434, GDCF-2 HC11, Platelet-derived growth factor-inducible protein Je

CHM-313-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Gln-Pro-Asp-Ala-VaMonocyte Chemotactic Protein-1 Mouse Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 125 amino acids and having a molecular mass of 14 kDa.

342 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mMCP 1 HisRecombinant Mouse Monocyte Chemotactic Protein-1 (CCL2) His Tag; Small inducible cytokine A2, CCL2, Monocyte chemotactic protein 1, MCP-1, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, MCAF, Monocyte secretory protein Je, HC11, chemokine (C-C motif) ligand 2, MCP1, SCyA2, GDCF-2, SMC-CF, HSMCR30, MGC9434, GDCF-2 HC11

CHM-014-20 °C

5 µg20 µg1 mg

50 130

4,500

GSSHHHHHH SSGLVPRGSH MQPDAVNAPL TCCYSFTSKM IPMSRLESYK RITSSRCPKE AVVFVT-KLKR EVCADPKKEW VQTYIKNLDR NQMRSEPTTL FKTASALRSS APLNVKLTRK SEANASTTFS TTTSSTSVGV TSVTVNMCP-1 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 146 amino acids (24-148 a.a) and having a molecular mass of 16kDa. MCP-1 is fused to a 21 amino acid His-tag at N-terminus.

rMCP 1Recombinant Rat Monocyte Chemotactic Protein-1 (CCL2); Small inducible cytokine A2, CCL2, Monocyte chemotactic protein 1, MCP-1, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, MCAF, Monocyte secretory protein Je, HC11, chemokine (C-C motif) ligand 2, MCP1, SCyA2, GDCF-2, SMC-CF, HSMCR30, MGC9434, GDCF-2 HC11, Immediate-early serum-responsive Je protein

CHM-315-20 °C

2 µg10 µg1 mg

50 130

2,700

QPDAVNAPLT CCYSFTGKMI PMSRLENYKR ITSSRCPKEA VVFVTKLKRE ICADPNKEWV QKY-IRKLDQN QVRSETTVFY KIASTLRTSA PLNVNLTHKS EANASTLFST TTSSTSVEVT SMTEMonocyte Chemotactic Protein-1 Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 125 amino acids and having a molecular mass of 14.1 kDa.

MCP 2 (CCL8)Chemokine (C-C motif) ligand 8 (CCL8) is a small cytokine belonging to the CC che-mokine family that was once called monocyte chemotactic protein-2 (MCP-2). The CCL8 protein is produced as a precursor containing 109 amino acids, which is cleaved to produce mature CCL8 containing 75 amino acids. The gene for CCL8 is encoded by 3 exons and is located within a large cluster of CC chemokines on chromosome 17q11.2 in humans. MCP-2 is chemotactic for and activates a many different immune cells, including mast cells, eosinophils and basophils, (that are implicated in allergic responses), and monocytes, T cells, and NK cells that are involved in the inflammatory response. CCL8 elicits its effects by binding to several different cell surface receptors called chemokine receptors. These receptors include CCR1, CCR2B and CCR5.

MCP 2Recombinant Human Monocyte Chemotactic Protein-2 (CCL8); Small inducible cytokine A8, CCL8, Monocyte chemotactic protein 2, MCP-2, Monocyte chemoattractant protein 2, HC14, chemokine (C-C motif) ligand 8, MCP2, SCyA8, SCyA10

CHM-316-20 °C

2 µg10 µg1 mg

25 70

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Gln-Pro-Asp-Ser-ValMonocyte Chemotactic Protein-2 Human Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 76 amino acids and having a molecular mass of 8904 Dalton.

343 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mMCP-2Recombinant Mouse Monocyte Chemotactic Protein-2 (CCL8); Small inducible cytokine A8, CCL8, Monocyte chemotactic protein 2, MCP-2, Monocyte chemoattractant protein 2, HC14, chemokine (C-C motif) ligand 8, MCP2, SCyA8, SCyA10, AB023418, 1810063B20Rik

CHM-355-20 °C

2 µg10 µg1 mg

50 130

2,700

GPDKAPVTCC FHVLKLKIPL RVLKSYERIN NIQCPMEAVV FQTKQGMSLC VDPTQKWVSE YMEI-LDQKSQ ILQPMonocyte Chemotactic Protein-2 Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 74 amino acids and having a molecular mass of 8507 Dalton.

MCP 3 (CCL8)Chemokine (C-C motif) ligand 7 (CCL7) is a small cytokine known as a chemokine that was previously called monocyte-specific chemokine 3 (MCP3). Due to CCL7 pos-sessing two adjacent N-terminal cysteine residues in its mature protein, it is classified among the subfamily of chemokines known as CC chemokines. CCL7 specifically attracts monocytes, and regulates macrophage function. It is produced by certain tu-mor cell lines and by macrophages. This chemokine is located on chromosome 17 in humans, in a large cluster containing many other CC chemokines and is most closely related to CCL2(previously called MCP1).

MCP 3Recombinant Human Monocyte Chemotactic Protein-3 (CCL7); Small inducible cytokine A7, CCL7, Monocyte chemotactic protein 3, MCP-3, Monocyte chemoattractant protein 3, NC28, chemokine (C-C motif) ligand 7, FIC, MARC, MCP3, SCyA6, SCyA7, MGC138463, MGC138465

CHM-317-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Gln-Pro-Val-Gly-IleMonocyte Chemotactic Protein-3 Human Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 76 amino acids and having a molecular mass of 9011 Dalton.

mMCP 3Recombinant Mouse Monocyte Chemotactic Protein-3 (CCL7); Small inducible cytokine A7, CCL7, Monocyte chemotactic protein 3, MCP-3, Monocyte chemoattractant protein 3, NC28, chemokine (C-C motif) ligand 7, FIC, MARC, MCP3, SCyA6, SCyA7, MGC138463, MGC138465

CHM-318-20 °C

2 µg10 µg1 mg

50 130

2,700

QPDGPNASTC CYVKKQKIPK RNLKSYRRIT SSRCPWEAVI FKTKKGMEVC AEAHQKWVEE AIAYLD-MKTP TPKPMonocyte Chemotactic Protein-3 Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 74 amino acids and having a molecular mass of 8510 Dalton.

344 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


rMCP 3Recombinant Rat Monocyte Chemotactic Protein-3 (CCL7); C-C motif chemokine 7, Monocyte chemoattractant protein 3, Monocyte chemotactic protein 3, MCP-3, Small-inducible cytokine A7, Ccl7, Mcp3, Scya7

CHM-280-20 °C

2 µg10 µg1 mg

50 130

2,700

QPDGTNSSTC CYVKKQKIPK RNLKSYRKIT SSRCPWEAVI FKTKKGMEVC AEAHQKWVEE AIAYLD-MKTS TPKPMCP-3 Rat Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 74 amino acids and having a molecular mass of 8.5kDa.

MCP 4 (CCL13)Chemokine (C-C motif) ligand 13 (CCL13 / MCP-4) is a small cytokine belonging to the CC chemokine family. The MCP-4 gene is located on human chromosome 17 within a large cluster of other CC chemokines. MCP-4 induces chemotaxis in monocytes, eosinophils, T lymphocytes, and basophils by binding cell surface G-protein linked che-mokine receptors such as CCR2, CCR3 and CCR5. Activity of the MCP-4 chemokine has been implicated in allergic reactions such as asthma. MCP-4 can be induced by the inflammatory cytokines interleukin-1 and TNF-a.

MCP 4Recombinant Human Monocyte Chemotactic Protein-4 (CCL13); Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-β-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCyL1, SCyA13, MGC17134

CHM-319-20 °C

2 µg10 µg1 mg

25 70

2,700

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHL-GRKAHTLKTMonocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 75 amino acids and having a molecular mass of 8.6 kDa.

MCP 4, HisRecombinant Human Monocyte Chemotactic Protein-4 (CCL13), His Tag; CKb10, MCP-4, NCC-1, NCC1, SCyA1, SCyL1, CK-β-10, Small-inducible cytokine A13

CHM-275-20 °C

1 µg5 µg

50 µg

50 130

1,200

MGSSHHHHHH SSGLVPRGSH MQPDALNVPS TCCFTFSSKK ISLQRLKSYV ITTSRCPQKA VIFRT-KLGKE ICADPKEKWV QNYMKHLGRK.AHTLKTMCP4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 96 amino acids (24-98) and having a molecular mass of 10.8 kDa. The MCP-4 is fused to 21 amino acids His-Tag at N-terminus.

345 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MCP 5 (CCL12)MCP-5 (CCL12) is a cloned mouse CC chemokine most closely related to human MCP1 (66% amino acid sequence identity in the mature protein). MCP5 is expressed constitutively in the thymus and the lymph nodes. Under inflammatory conditions, moreover CCL12 expression is induced in activated macrophages and mast cells. The mouse MCP1 gene is mapped to the CC chemokine cluster on chromosome 11. Re-combinant CCL12 is a potent chemoattractant for monocytes and lymphocytes but not neutrophils. At high concentrations, MCP-5 also chemoattracts eosinophils. CCL12 is a functional ligand for CCR2

MCP 5Recombinant Mouse Monocyte Chemotactic Protein-5 (CCL12); C-C motif chemokine 12, MCP-1-related chemokine, Monocyte chemoattractant protein 5, Monocyte chemotactic protein 5, MCP-5, Small-inducible cytokine A12, Ccl12, Mcp5, Scya12

CHM-266-20 °C

5 µg20 µg1 mg

50 130

2,700

GPDAVSTPVT CCYNVVKQKI HVRKLKSYRR ITSSQCPREA VIFRTILDKE ICADPKEKWV KNSINHLDKT SQTFILEPSC LGMCP-5 Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 82 amino acids and having a molecular mass of 9.3kDa.

346 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MDC (CCL22)MDC (CCL22) is a small cytokine that belongs to the CC chemokine family. CCL22 is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. MDC shows chemotactic activity for natural killer cells, chronically activated T lympho-cytes, monocytes and dendritic cells. On the other hand, MDC shows a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. MDC may also have a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lympho-cyte physiology. MDC interacts with cell surface chemokine receptors CCR4. CCL22 is vastly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. CCL22 is also found in the lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression of CCL22 can be seen in the lung and the spleen and very weak expression in the small intestine. In the lymph node CCL22 is expressed in a mature subset of Langerhans' cells (CD1a+ and CD83+). Furthermore, CCL22 is expressed in atopic dermatitis, allergic contact dermatitis skin, and psoriasis, in both the epidermis and dermis. In addition, MDC has a role in hin-dering progression of lung cancer. Moreover, significantly higher CCL22 expression is linked to gastric cancer.MCP1 (66% amino acid sequence identity in the mature protein). MCP5 is expressed constitutively in the thymus and the lymph nodes. Under inflammatory conditions, moreover CCL12 expression is induced in activated mac-rophages and mast cells. The mouse MCP1 gene is mapped to the CC chemokine cluster on chromosome 11. Recombinant CCL12 is a potent chemoattractant for monocytes and lymphocytes but not neutrophils. At high concentrations, MCP-5 also chemoattracts eosinophils. CCL12 is a functional ligand for CCR2

MDC HumanRecombinant Human Macrophage-Derived Chemokine (CCL22); C-C motif chemokine 22, Small-inducible cytokine A22, Macrophage-derived chemokine, MDC(1-69), Stimulated T-cell chemotactic protein 1, CC chemokine STCP-1, CCL22, MDC, SCyA22, ABCD-1, DC/B-CK, MGC34554, A-152e5.1

CHM-250-20 °C

5 µg20 µg1 mg

50 130

2,700

GPYGANMEDS VCCRDYVRYR LPLRVVKHFY WTSDSCPRPG VVLLTFRDKE ICADPRVPWV KMILNKLSQMDC Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 69 amino acids and having a molecular mass of 8.1 kDa.

MDC HisRecombinant Human Macrophage-Derived Chemokine (CCL22) His Tag; C-C motif chemokine 22, Small-inducible cytokine A22, Macrophage-derived chemokine, MDC(1-69), Stimulated T-cell chemotactic protein 1, CC chemokine STCP-1, CCL22, MDC, SCyA22, ABCD-1, DC/B-CK, MGC34554, A-152e5.1

CHM-367-20 °C

5 µg20 µg1 mg

50 130

1,800

MGSSHHHHHH SSGLVPRGSH MGPYGANMED SVCCRDYVRY RLPLRVVKHF YWTSDSCPRP GV-VLLTFRDK EICADPRVPW VKMILNKLSQMDC Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 90 amino acids (25-93 a.a.) and having a molecular mass of 10.3 kDa. The MDC is fused to 20 amino acid His-Tag at N-terminus

347 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mMDC Recombinant Mouse Macrophage-Derived Chemokine (CCL22); C-C motif chemokine 22, Small-inducible cytokine A22, Macrophage-derived chemokine, MDC(1-69), Stimulated T-cell chemotactic protein 1, CC chemokine STCP-1, CCL22, MDC, SCyA22, ABCD-1, DC/B-CK, MGC34554, A-152e5.1, CC chemokine ABCD-1, Activated B and dendritic cell-derived, DCBCK

CHM-370-20 °C

5 µg20 µg1 mg

50 130

2,700

GPYGANVEDS ICCQDYIRHP LPSRLVKEFF WTSKSCRKPG VVLITVKNRD ICADPRQVWV KKLLHKLSCCL22 Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 68 amino acids and having a molecular mass of 7.8kDa. The Mouse CCL22 is purified by proprietary chromatographic techniques.

rMDC Recombinant Rat Macrophage-Derived Chemokine (CCL22); C-C motif chemokine 22, Small-inducible cytokine A22, Macrophage-derived chemokine, MDC(1-69), Stimulated T-cell chemotactic protein 1, CC chemokine STCP-1, CCL22, MDC, SCyA22, ABCD-1, DC/B-CK, MGC34554, A-152e5.1, CC chemokine ABCD-1, Activated B and dendritic cell-derived, DCBCK

CHM-279-20 °C

5 µg20 µg1 mg

50 130

2,700

GPYGANVEDS ICCQDYIRHP LPPRFVKEFY WTSKSCRKPG VVLITIKNRD ICADPRMLWV KKILHKLACCL22 Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 68 amino acids and having a molecular mass of 7.9kDa.

MeC (CCL28)CCL28 is part of the subfamily of small cytokine CC genes. CCL28 shows chemotactic activity for resting CD4 or CD8 T cells and eosinophils. CCL28 binds to chemokine receptors CCR3 and CCR10. CCL28 is involved in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. CCL28 mediates mucosal immu-nity in HIV exposure and infection. CCL28 is involved in the pathogenesis of inflam-matory skin diseases. Human CCL28 cDNA encodes a 127 amino acid residue precursor protein with a pu-tative 22 amino acid residue signal peptide that is cleaved to produce the 105 amino acid residue mature protein. Human and mouse CCL28 are highly conserved, sharing 83% amino acid identity in their mature regions. CCL28 shares the most homology with CCL27/CTACK. Human and mouse CCL28 RNA expression was found to be highest in normal and pathologic colon with the protein being expressed by epithelial cells. Hu-man CCL28 RNA was also present in normal and asthmatic lung tissues.

MeCRecombinant Human Mucosae-Associated epithelial Chemokine (CCL28); MeC, CCK1, SCyA28, MGC71902, CCL28, C-C motif chemokine 28, Small-inducible cytokine A28, Mucosae-associated epithelial chemokine, Protein CCK1

CHM-353-20 °C

5 µg20 µg1 mg

50 130

2,700

SEAILPIASS CCTEVSHHIS RRLLERVNMC RIQRADGDCD LAAVILHVKR RRICVSPHNH TVKQWM-KVQA AKKNGKGNVC HRKKHHGKRN SNRAHQGKHE TYGHKTPYCCL28 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 108 amino acids and having a molecular mass of 12.3 kDa.

348 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MeC HisRecombinant Human Mucosae-Associated epithelial Chemokine (CCL28) His Tag; MeC, CCK1, SCyA28, MGC71902, CCL28, C-C motif chemokine 28, Small-inducible cytokine A28, Mucosae-associated epithelial chemokine, Protein CCK1

CHM-366-20 °C

5 µg20 µg1 mg

50 130

3,600

MGSSHHHHHH SSGLVPRGSH MILPIASSCC TEVSHHISRR LLERVNMCRI QRADGDCDLA AVILH-VKRRR ICVSPHNHTV KQWMKVQAAK KNGKGNVCHR KKHHGKRNSN RAHQGKHETY GHKTPYCCL28 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 126 amino acids (23-127 a.a.) and having a molecular mass of 14.3 kDa. The CCL28 is fused to 20 amino acid His-Tag at N-terminus.

mMeCRecombinant Mouse Mucosae-Associated epithelial Chemokine (CCL28); MeC, CCK1, SCyA28, MGC71902, CCL28, C-C motif chemokine 28, Small-inducible cytokine A28, Mucosae-associated epithelial chemokine, Protein CCK

CHM-369-20 °C

5 µg20 µg1 mg

50 130

2,700

SEAILPMASS CCTEVSHHVS GRLLERVSSC SIQRADGDCD LAAVILHVKR RRICISPHNR TLKQWM-RASE VKKNGRENVC SGKKQPSRKD RKGHTTRKHR TRGTHRHEASCCL28 Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.6 kDa.

rMeCRecombinant Rat Mucosae-Associated epithelial Chemokine (CCL28); MeC, CCK1, SCyA28, MGC71902, CCL28, C-C motif chemokine 28, Small-inducible cytokine A28, Mucosae-associated epithelial chemokine, Protein CCK1

CHM-278-20 °C

5 µg20 µg1 mg

50 130

2,700

SEAILPIASS CCTEVSHHIP RRLLERVNSC SIQRADGDCD LAAVILHVKR RRICVSPHNP TLKRWM-SASE MKNGKENLCP RKKQDSGKDR KGHTPRKHGK HGTRRIHGTH DHEAPRMEC Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 116 amino acids and having a molecular mass of 13.1kDa.

MIG (CXCL9)Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by γ interferon (MIG). It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the che-mokine receptor CXCR3.

MIGRecombinant Human MIG (CXCL9); Small inducible cytokine B9, CXCL9, Γ interferon-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCyB9, crg-10, monokine induced by γ-interferon

CHM-333-20 °C

5 µg20 µg1 mg

50 130

2,700

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIK-KWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTMIG (monokine induced by γ-interferon ) Human Recombinant produced in E.Coli is a single, non-glycosyl-ated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton.

349 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MIG HisRecombinant Human MIG (CXCL9) His Tag; C-X-C motif chemokine 9, CMK, crg-10, Humig, MIG, SCyB9, γ-interferon-induced monokine, Monokine induced by interferon-γ, HuMIG, Small-inducible cytokine B9, CXCL9

CHM-016-20 °C

5 µg20 µg1 mg

50 130

3,600

MGSSHHHHHH SSGLVPRGSH MGSTPVVRKG RCSCISTNQG TIHLQSLKDL KQFAPSPSCE KIEI-IATLKN GVQTCLNPDS ADVKELIKKW EKQVSQKKKQ KNGKKHQKKK VLKVRKSQRS RQKKTTMIG Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 126 amino acids (23-125 a.a.) and having a molecular mass of 14kDa. MIG is fused to a 23 amino acid His-tag at N-terminus.

rmMIGRecombinant Mouse MIG (CXCL9); Small inducible cytokine B9, CXCL9, γ interferon-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCyB9, crg-10, M119, monokine induced by γ-interferon

CHM-337-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be, Thr-Leu-Val-Ile-Arg.MIG (monokine induced by γ-interferon ) Mouse Recombinant produced in E.Coli is a single, non-glycosyl-ated, polypeptide chain containing 105 amino acids and having a molecular mass of 12208 Dalton.

MIP (Macrophage Inflammatory Protein)Macrophage Inflammatory Proteins (MIP) belong to the family of chemotactic cyto-kines known as chemokines. In humans, there are two major forms, MIP-1a and MIP-1b that are now officially named CCL3 and CCL4 respectively. Both are major factors produced by macrophages after they are stimulated with bacterial endotoxins. They activate human granulocytes (neutrophils, eosinophilsand basophils) which can lead to acute neutrophilic inflammation. They also induce the synthesis and release of other pro-inflammatory cytokines such as interleukin 1 (IL-1), IL-6 and TNF-a from fibroblasts and macrophages. The genes for CCL3 and CCL4 are both located on human chromosome 17.

MIP 1αRecombinant Human Macrophage Inflammatory Protein-1 α (CCL3); Small inducible cytokine A3, CCL3, Macrophage inflammatory protein 1-α, MIP-1-α, Tonsillar lymphocyte LD78 α protein, G0/G1 switch regulatory protein 19-1, G0S19-1 protein, SIS-β, PAT 464.1, chemokine (C-C motif) ligand 3, MIP1A, SCYA3, G0S19-1, LD78Α

CHM-233-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be, Ala-Ser-Leu-Ala-AlaMacrophage Inflammatory Protein-1 α Human Recombinant produced in E.Coli is a single, non-glycosylat-ed, polypeptide chain containing 70 amino acids and having a molecular mass of 7820 Dalton.

350 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MIP 1a, HisRecombinant Human Macrophage Inflammatory Protein-1 α (CCL3), His Tag; Small inducible cytokine A3, CCL3, Macrophage inflammatory protein 1-α, MIP-1-α, Tonsillar lymphocyte LD78 α protein, G0/G1 switch regulatory protein 19-1, G0S19-1 protein, SIS-β, PAT 464.1, chemokine (C-C motif) ligand 3, MIP1A, SCYA3, G0S19-1, LD78Α

CHM-347-20 °C

2 µg10 µg1 mg

50 130

2,600

Macrophage Inflammatory Protein-1 α His Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a molecular mass of 7820 Dalton with an amino-terminal hexahistidine tag.

mMIP 1aRecombinant Mouse Macrophage Inflammatory Protein-1 α (CCL3); Small inducible cytokine A3, CCL3, Macrophage inflammatory protein 1-α, MIP-1-α, Tonsillar lymphocyte LD78 α protein, G0/G1 switch regulatory protein 19-1, G0S19-1 protein, SIS-β, PAT 464.1, chemokine (C-C motif) ligand 3, MIP1A, SCyA3, G0S19-1, LD78α, Ty-5, SIS-α, Heparin-binding chemotaxis protein, L2G25B

CHM-320-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be, Ala-Pro-Tyr-Gly-AlaMacrophage Inflammatory Protein-1 α Mouse Recombinant produced in E.Coli is a single, non-glycosylat-ed, polypeptide chain containing 69 amino acids and having a molecular mass of 7820 Dalton.

rMIP 1aRecombinant Rat Macrophage Inflammatory Protein-1 α (CCL3); Small inducible cytokine A3, CCL3, Macrophage inflammatory protein 1-α, MIP-1-α, Tonsillar lymphocyte LD78 α protein, G0/G1 switch regulatory protein 19-1, G0S19-1 protein, SIS-β, PAT 464.1, chemokine (C-C motif) ligand 3, MIP1A, SCyA3, G0S19-1, LD78α

CHM-343-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be, Ala-Pro-Tyr-Gly-AlaMacrophage Inflammatory Protein-1 α Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular mass of 7853 Dalton.

mMIP 1a, HisRecombinant Mouse Macrophage Inflammatory Protein-1 α (CCL3), His Tag; Small inducible cytokine A3, CCL3, Macrophage inflammatory protein 1-α, MIP-1-α, Tonsillar lymphocyte LD78 α protein, G0/G1 switch regulatory protein 19-1, G0S19-1 protein, SIS-β, PAT 464.1, chemokine (C-C motif) ligand 3, MIP1A, SCyA3, G0S19-1, LD78α, Ty-5, SIS-α, Heparin-binding chemotaxis protein, L2G25B

CHM-008-20 °C

2 µg10 µg1 mg

50 130

5,200

MGSSHHHHHH SSGLVPRGSH MGSMAPYGAD TPTACCFSYS RKIPRQFIVD YFETSSLCSQ PGVIFLT-KRN RQICADSKET WVQEYITDLE LNAMIP-1a Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 93 amino acids (24-92 a.a.) and having a molecular mass of 10.4kDa. MIP-1a is fused to a 24 amino acid His-tag at N-terminus.

351 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MIP 1βRecombinant Human Macrophage Inflammatory Protein-1 β (CCL4); Small inducible cytokine A4, CCL4, Macrophage inflammatory protein 1-β, MIP-1- β, MIP-1-β(1-69), T-cell activation protein 2, ACT-2, PAT 744, H400, SIS-γ, Lymphocyte activation gene 1 protein, LAG-1, HC21, G-26 T-lymphocyte-secreted protein, chemokine (C-C motif) ligand 4, ACT2, G-26, LAG1, MIP1B, SCyA4, AT744.1, MGC104418, MGC126025, MGC126026

CHM-276-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be, Ala-Pro-Met-Gly-SerMacrophage Inflammatory Protein-1 beta Human Recombinant produced in E.Coli is a single, non-glyco-sylated, polypeptide chain containing 69 amino acids and having a molecular mass of 7620 Dalton.R. Colobran, M. Jua, Inmunologia, 26, 1 (2007).

mMIP 1βRecombinant Mouse Macrophage Inflammatory Protein-1 β (CCL4); Small inducible cytokine A4, CCL4, Macrophage inflammatory protein 1-β, MIP-1- β, MIP-1-beta(1-69), T-cell activation protein 2, ACT-2, PAT 744, H400, SIS-γ, Lymphocyte activation gene 1 protein, LAG-1, HC21, G-26 T-lymphocyte-secreted protein, chemokine (C-C motif) ligand 4, ACT2, G-26, LAG1, MIP1B, SCyA2, SCyA4, AT744.1, MGC104418, MGC126025, MGC126026

CHM-321-20 °C

2 µg10 µg1 mg

50 130

2,700

APYGADTPTA CCFSYSRKIP RQFIVDYFET SSLCSQPGVI FLTKRNRQIC ADSKETWVQE YITDLELNAMacrophage Inflammatory Protein-1 beta Mouse Recombinant produced in E.Coli is a single, non-glycosyl-ated, polypeptide chain containing 69 amino acids and having a molecular mass of 7808 Dalton.

rMIP 1βRecombinant Rat Macrophage Inflammatory Protein-1 β (CCL4); C-C motif chemokine 4, Macrophage inflammatory protein 1-β, MIP-1-β, Small-inducible cytokine A4, Ccl4, Mip1b, Scya4

CHM-003-20 °C

5 µg20 µg1 mg

50 130

2,700

APIGSDPPTS CCFSYTSRKI HRNFVMDYYE TSSLCSQPAV VFLTKKGRQI CADPSEPWVN EYVNDLELNMIP-1b Rat Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 69 amino acids and having a molecular mass of 7.8 kDa.

mMIP-1γ (Macrophage Inflammatory Protein γ (CCL5))Mouse MIP-1 γ is 75% identical in its amino acid compostion as compared to the rat specie. MIP-1 γ is a CC chemokine localized in murine blood and a widespread range of murine tissues, without having an identified human homolog. MIP-1 γ signals through the CCR1 receptor. MIP-1 γ chemoattracts neutrophils and also inhibits colony formation of bone marrow myeloid immature progenitors. MIP-1 γ has six cysteines including the four highly conserved cysteine residues present in CC chemokines.

352 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mMIP-1γRecombinant Mouse Macrophage Inflammatory Protein-1 γ (CCL9); CCL9/10, MRP2, CCF18

CHM-257-20 °C

5 µg20 µg1 mg

50 130

2,700

QITHATETKE VQSSLKAQQG LEIEMFHMGF QDSSDCCLSY NSRIQCSRFI GYFPTSGGCT RPGI-IFISKR GFQVCANPSD RRVQRCIERL EQNSQPRTYK QMIP-1 γ Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 101 amino acids and having a molecular mass of 11.6 kDa.

mMIP-1γ (Macrophage Inflammatory Protein γ (CCL5))CCL23 (MIP-3) is a ligand for the CCR1chemokine receptor. CCL23 is one of several cytokine genes clustered on the q-arm of chromosome 17, in a locus containing sev-eral other CC chemokines. MIP-3 chemoattracts monocytes, resting T-lymphocytes and neutrophils, but not activated lymphocytes. Furthermore, it was shown that MIP-3 inhibits colony formation of bone marrow myeloid immature progenitors. MIP-3 is mainly expressed in lung and liver tissue, but can be also found in bone marrow and placenta, as well as in some cell lines of myeloid origin. Alternative splicing of the CCL23 gene produces 2 mRNAs which encode a short (CKβ8) and a long (CKβ81) isoform of the MIP-3. CKβ8 cDNA encodes a 120 amino acid residue precursor protein with a putative 21 a.a. residue signal peptide which is cleaved to generate a 99 a.a. residue mature CKβ8 (a.a. 22-120). Further N-terminal processing of the 99 a.a. residue variant can produce a 75 a.a. residue CKβ8 (a.a. 46-120) which is considerably more active than the 99 a.a. residue variant.MIP-3 may be involved in the malignant progression of certain human cancer cells which overexpress ErbB2 through the transactivation of ErbB2 tyrosine kinase. MIP-3 may also be involved in angiogenesis via upregulation of matrix metalloproteinase MMP-2 expression.

MIP 3 HumanRecombinant Human Macrophage Inflammatory Protein-3 (CCL23); C-C motif chemokine 23, Small-inducible cytokine A23, Macrophage inflammatory protein 3, Myeloid progenitor inhibitory factor 1, CK-β-8, MIP-3, MPIF-1, CKB-8, CCL23, MIP3, MPIF1, SCyA23, CKb8, Ckb-8-1

CHM-358-20 °C

5 µg20 µg1 mg

50 130

2,700

RVTKDAETEF MMSKLPLENP VLLDRFHATS ADCCISYTPR SIPCSLLESYFETNSECSKP GVIFLTKKGR RFCANPSDKQ VQVCMRMLKL DTRIKTRKNMIP-3 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 99 amino acids and having a molecular mass of 11.3kDa.

353 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MIP 3β (CCL19)Chemokine (C-C motif) ligand 19 (CCL19) is a small cytokine belonging to the CC che-mokine family that is also known as EBI1 ligand chemokine (ELC) and macrophage inflammatory protein-3-β (MIP-3-β). CCL19 is expressed abundantly in thymus and lymph nodes, with moderate levels in trachea and colon and low levels in stomach, small intestine, lung, kidney and spleen. The gene for CCL19 is located on human chromosome 9. This chemokine elicits its effects on its target cells by binding to the chemokine receptor chemokine receptor CCR7. It attracts certain cells of the immune system, including dendritic cells and antigen-engaged B cells.

MIP 3βRecombinant Human Macrophage Inflammatory Protein-3 β (CCL19); Small inducible cytokine A19, CCL19, Macrophage inflammatory protein 3 β, MIP-3- β, eBI1-ligand chemokine, eLC, β chemokine exodus-3, CK β-11, chemokine (C-C motif) ligand 19, CKb11, MIP3B, MIP-3b, SCyA19, MGC34433

CHM-287-20 °C

5 µg20 µg1 mg

50 130

2,700

GTNDAEDCCL SVTQKPIPGY IVRNFHYLLI KDGCRVPAVV FTTLRGRQLC APPDQPWVER IIQR-LQRTSA KMKRRSSMacrophage Inflammatory Protein-3 β Human Recombinant produced in E.Coli is a single, non-glycosylat-ed, polypeptide chain containing 77 amino acids and having a molecular mass of 8.8kDa.

MIP 3, T7Recombinant Human Macrophage Inflammatory Protein-3 (CCL23), T7 Tag; Small inducible cytokine A19, CCL19, Macrophage inflammatory protein 3 β, MIP-3- β, eBI1-ligand chemokine, eLC, β chemokine exodus-3, CK β-11, chemokine (C-C motif) ligand 19, CKb11, MIP3B, MIP-3b, SCyA19, MGC34433

CHM-374-20 °C

5 µg20 µg1 mg

50 130

2,250

MASMTGGQQM GRGSHMGTND AEDCCLSVTQ KPIPGYIVRN FHYLLIKDGC RVPAVVFTTL RGRQL-CAPPD QPWVERIIQR LQRTSAKMKR RSSCCL19 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 93 amino acids (22098 a.a.) and having a molecular mass of 10.4 kDa. The CCL19 is fused to a 16 amino acid T7 tag at N-Terminus.

mMIP 3bRecombinant Mouse Macrophage Inflammatory Protein-3 β (CCL19); Small inducible cytokine A19, CCL19, Macrophage inflammatory protein 3 β, MIP-3- β, eBI1-ligand chemokine, eLC, β chemokine exodus-3, CK β-11, chemokine (C-C motif) ligand 19, CKb11, MIP3B, MIP-3b, SCyA19, MGC34433, epstein-Barr virus-induced molecule 1 ligand chemokine, eBI1-ligand chemokine

CHM-341-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be, Gly-Ala-Asn-Asp-AlaMacrophage Inflammatory Protein-3 beta Mouse Recombinant produced in E.Coli is a single, non-glycosyl-ated, polypeptide chain containing 83 amino acids and having a molecular mass of 9216 Dalton.

354 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MIP 3α (CCL20)CCL-20 is a chemotactic factor that draws lymphocytes and neutrophils, rathar than monocytes. MIP-3 α inhibits proliferation of myeloid progenitors in colony formation assays. MIP3α plays a role in the formation and function of the mucosal lymphoid tis-sues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. CCL-20 holdes antibacterial activity E.Coli atcc 25922 and s.aureus atcc 29213. CCL-20 gene transcription is activated by H. pylori, which activates NF-κB through intracel-lular signal pathway which involves IκB kinase and NF-κB-inducing kinase. MIP-3 α is invloved in chemokine-mediated lymphocyte trafficking during gastric inflammation in Helicobacter infection. CCL-20 expression is involved in the recruitment of CD45R0-positive T cell subsets into the intestinal lamina propria. MIP-3α is in charge of the advancement of pulpal inflammation through the recruit-ment of C-C motif Receptor 6-expressing lymphocytes Vaginal epithelial cells respond to factors present in semen by secreting MIP-3 α, which increases langerhans cells recruitment during HIV transmission.

MIP 3αRecombinant Human Macrophage Inflammatory Protein-3 α (CCL20); S Small inducible cytokine A20 precursor, CCL20, Macrophage inflammatory protein 3 α, MIP-3-α, Liver and activation- regulated chemokine, CC chemokine LARC, β chemokine exodus-1, CKb4, LARC, ST38, MIP3A, MIP-3a, SCyA20

CHM-351-20 °C

5 µg20 µg1 mg

50 130

2,700

ASNFDCCLGY TDRILHPKFI VGFTRQLANE GCDINAIIFH TKKKLSVCAN PKQTWVKYIV RLLSKKVKNMMIP-3 Α Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain contain-ing 70 amino acids and having a molecular mass of 8 kDa.

MIP 3α HisRecombinant Human Macrophage Inflammatory Protein-3 α (CCL20), His Tag; S Small inducible cytokine A20 precursor, CCL20, Macrophage inflammatory protein 3 α, MIP-3-α, Liver and activation- regulated chemokine, CC chemokine LARC, β chemokine exodus-1, CKb4, LARC, ST38, MIP3A, MIP-3a, SCyA20

-20 °C

2 µg10 µg1 mg

50 130

5,200

MGSSHHHHHH SSGLVPRGSH MASNFDCCLG YTDRILHPKF IVGFTRQLAN EGCDINAIIF HTKKKLS-VCA NPKQTWVKYI VRLLSKKVKN MMIP 3a Human Recombinant fused with a 21 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 91 amino acids (27-96 a.a.) and having a molecular mass of 10.3kDa.

355 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mMIP 3αRecombinant Mouse Macrophage Inflammatory Protein-3 α (CCL20); Small inducible cytokine A20 precursor, CCL20, Macrophage inflammatory protein 3 α, MIP-3-α, Liver and activation- regulated chemokine, CC chemokine LARC, β chemokine exodus-1, CKb4, LARC, ST38, MIP3A, MIP-3a, SCyA20, C-C motif chemokine 20, CC chemokine ST38, exodus-1

CHM-236-20 °C

5 µg20 µg1 mg

50 130

2,700

ASNYDCCLSY IQTPLPSRAI VGFTRQMADE ACDINAIIFH TKKRKSVCAD PKQNWVKRAV NLLSL-RVKKMMacrophage Inflammatory Protein-3 α Mouse Recombinant produced in E.Coli is a single, non-glycosylat-ed, polypeptide chain containing 70 amino acids and having a molecular mass of 7.9 kDa.

MIP 4 (CCL18)Chemokine (C-C motif) ligand 18 (CCL18) is a small cytokine belonging to the CC che-mokine family that was previously called PARC (pulmonary and activation-regulated chemokine). CCL18 is approximately 60% identical in amino acid sequence to CCL3. It is expressed at high levels in lung and at lower levels in certain lymphoid tissues, such as the lymph nodes, and is chemotactic for activated T cells and non-activated lymphocytes. The gene for human CCL18 contains three exons and is located on chromosome 17.

MIP 4 Recombinant Human Macrophage Inflammatory Protein-4 (CCL18); Small inducible cytokine A18, CCL18, Macrophage inflammatory protein 4, MIP-4, Pulmonary and activation-regulated chemokine, CC chemokine PARC, Alternative macrophage activation-associated CC chemokine 1, AMAC-1, Dendritic cell chemokine 1, DC-CK1, chemokine (C-C motif) ligand 18, CKb7, PARC, AMAC1, DCCK1, SCyA18

CHM-322-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids of MIP-4 was determined and found to be Ala-Gln-Val-Gly-ThrMacrophage Inflammatory Protein-4 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular mass of 7813 Dalton.

MIP 4 HisRecombinant Human Macrophage Inflammatory Protein-4 (CCL18), His-Tag; Small inducible cytokine A18, CCL18, Macrophage inflammatory protein 4, MIP-4, Pulmonary and activation-regulated chemokine, CC chemokine PARC, Alternative macrophage activation-associated CC chemokine 1, AMAC-1, Dendritic cell chemokine 1, DC-CK1, chemokine (C-C motif) ligand 18, CKb7, PARC, AMAC1, DCCK1, SCyA18

CHM-339-20 °C

1 µg5 µg

50 µg

50 130

1,100

MGSSHHHHHH SSGLVPRGSH MGSHMQVGTN KELCCLVYTS WQIPQKFIVD YSETSPQCPK PGVILLTKRG RQICADPNKK WVQKYISDLK LNAMIP-4 Human Recombinant fused with a 25 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 93 amino acids (22-89 a.a.) and having a molecular mass of 10.4kDa.

356 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


MIP 5 (CCL15)CCL15, a new human CC chemokine, was isolated from a human fetal spleen cDNA library. CCL15 cDNA encodes a predicted 113 amino acid (aa) protein containing a putative signal peptide of 21 amino acids that is cleaved to generate a 92 aa residue mature protein. Within the CC family members, human CCL15 shares 45%, 44%, 35%, and 30% aa homology with mouse C10, human MPIF-1, human HCC-1, and mouse MIP-1?, respectively. The gene for MIP-5 is found on chromosome 17 where the genes for most of the human CC chemokines are located. Human CCL15 is ex-pressed in T and B lymphocytes, NK cells, monocytes and monocyte-derived dendritic cells. Human MIP-5 is chemotactic for T cells and monocytes and has been shown to induce calcium flux in human CCR-1-transfected cells

MIP 5Recombinant Human Macrophage Inflammatory Protein-5 (CCL15)

CHM-230-20 °C

5 µg25 µg1 mg

50 130

2,700

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQV-CAKPSGPGVQDCMKKLKPYSIMacrophage Inflammatory Protein-5 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1 kDa.

MIP 5 (68 a.a.)Recombinant Human Macrophage Inflammatory Protein-5 (CCL15) 68 a.a; Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 δ, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15

CHM-011-20 °C

5 µg25 µg1 mg

50 130

2,700

SFHFAADCCT SYISQSIPCS LMKSYFETSS ECSKPGVIFL TKKGRQVCAK PSGPGVQDCM KKLKPYSIMacrophage Inflammatory Protein-5 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a molecular mass of 7.4kDa.

NAP 2 (Neutrophil Activating Protein-2 (CXCL7))Chemokine (C-X-C motif) ligand (CXCL7) is a small cytokine belonging to the CXC chemokine family. It is a protein that is released in large amounts from platelets follow-ing their activation. It stimulates various processes including mitogenesis, synthesis of extracellular matrix, glucose metabolism and synthesis of plasminogen activator.

NAP 2Recombinant Human Neutrophil Activating Protein-2 (CXCL7); Platelet basic protein, PBP, Small inducible cytokine B7, CXCL7, Leukocyte-derived growth factor, LDGF, Macrophage-derived growth factor, MDGF, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), TC1, TC2, TGB, TGB1, B-TG1, CTAP3, NAP-2, SCyB7, THBGB, LA-PF4, THBGB1, β-TG, CTAPIII, CTAP-III

CHM-274-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Ala-Glu-Leu-Arg-CysNeutrophil Activating Protein-2 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 70 amino acids and having a molecular mass of 7609 Dalton.

357 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


NAP 2 95 a.a.Recombinant Human Neutrophil Activating Protein-2 (CXCL7), 95 a.a.; Platelet basic protein, PBP, Small inducible cytokine B7, CXCL7, Leukocyte-derived growth factor, LDGF, Macrophage-derived growth factor, MDGF, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), TC1, TC2, TGB, TGB1, B-TG1, CTAP3, NAP-2, SCyB7, THBGB, LA-PF4, THBGB1, Beta-TG, CTAPIII, CTAP-III

CHM-277-20 °C

2 µg10 µg1 mg

50 130

2,700

MSSTKGQTKR NLAKGKEESL DSDLYAELRC MCIKTTSGIH PKNIQSLEVI GKGTHCNQVE VIATLK-DGRK ICLDPDAPRI KKIVQKKLAG DESADNAP 2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 95 amino acids (35-128) and having a molecular mass of 10.3 kDa.

Avoid multiple freeze-thaw cycles.

rNAP 2Recombinant Rat Neutrophil Activating Protein-2 (CXCL7); Platelet basic protein, PBP, Small inducible cytokine B7, CXCL7, Leukocyte-derived growth factor, LDGF, Macrophage-derived growth factor, MDGF, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), TC1, TC2, TGB, TGB1, B-TG1, CTAP3, NAP-2, SCyB7, THBGB, LA-PF4, THBGB1, β-TG, CTAPIII, CTAP-II

CHM-269-20 °C

2 µg10 µg1 mg

50 130

2,700

IELRCRCTNT LSGIPLNSIS RVNVFRPGAH CDNVEVIATL KNGKEVCLDP TAPMIKKIVK KINAP-2 Rat Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 62 amino acids and having a molecular mass of 6.8kDa.

PF 4 (Platelet Factor-4 (CXCL4))Platelet factor-4 is a 70-amino acid protein that is released from the α-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role ap-pears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair. Oncostatin-A is a member of the CXC chemokine family. Human PF4 is used for the proof of heparin-induced thrombocytopenia. It is used as an inhibitor in the angiogenesis during tumor therapy.

PF 4Human Platelet Factor-4 (CXCL4); CXCL4, PF-4, PF4, Iroplact, Oncostatin-A, SCyB4, MGC138298

CHM-234-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first four N-terminal amino acids was determined and was found to be Glu-Ala-Glu-GluHuman PF-4 a 7.8 kDa protein consisting of 70 amino acid residues.

PF 4 HumanRecombinant Human Platelet Factor-4 (CXCL4); CXCL4, PF-4, PF4, Iroplact, Oncostatin-A, SCyB4, MGC138298

CHM-350-20 °C

5 µg20 µg1 mg

50 130

2,700

The sequence of the first four N-terminal amino acids was determined and was found to be Glu-Ala-Glu-Glu-AspCXCL4 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 70 amino acids and having a molecular mass of 7.8 kDa.

358 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


PF 4 Variant-1Recombinant Human Platelet Factor-4 (CXCL4V1) Variant-1; CXCL4, PF-4, PF4, Iroplact, Oncostatin-A, SCyB4, MGC138298

CHM-243-20 °C

1 µg5 µg

50 µg

50 130

1,100

MHHHHHHEAE EDGDLQCLCV KTTSQVRPRH ITSLEVIKAG PHCPTAQLIA TLKNGRKICL DLQAL-LYKKI IKEHLESCXCL4 Variant-1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 77 amino acids and having a molecular mass of 8.7 kDa. The CXCL4 Variant-1 is fused to 6xHis tag at N-Terminus.

PF4 HisRecombinant Human Platelet Factor-4 (CXCL4), His Tag; CXCL4, PF-4, PF4, Iroplact, Oncostatin-A, SCyB4, MGC138298

CHM-015-20 °C

2 µg10 µg

100 µg

50 130

1,200

MGSSHHHHHH SSGLVPRGSH MEAEEDGDLQ CLCVKTTSQV RPRHITSLEV IKAGPHCPTA QLI-ATLKNGR KICLDLQAPL YKKIIKKLLE SPF4 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 91 amino acids (32-101 a.a) and having a molecular mass of 10kDa. PF4 is fused to a 21 amino acid His-tag at N-terminus.

mPF 4Recombinant Mouse Platelet Factor-4 (CXCL4); CXCL4, PF-4, PF4, Iroplact, Oncostatin-A, SCyB4, MGC138298

CHM-245-20 °C

5 µg20 µg1 mg

50 130

2,700 VTSAGPEESD GDLSCVCVKT ISSGIHLKHI TSLEVIKAGR HCAVPQLIAT LKNGRKICLD RQAPLYKKVI KKILESCXCL4 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 8.2kDa.

Rantes (Regulated upon Activation, Normal T-cell expressed, and Secreted (CCL5))

Regulated upon Activation, Normal T-cell Expressed, and Secreted or RANTES is an 8 kDa protein classified as a chemotactic cytokine or chemokine. Rantes has recently been renamed CCL5. RANTES is chemotactic for T cells, eosinophils and basophils and plays an active role in recruiting leukocytes into inflammatory sites. With the help of particular cytokines (i.e. IL-2 and IFN-g) that are released by T cells, RANTES also induces the proliferation and activation of certain natural killer (NK) cells to form CHAK (CC-Chemokine-activated killer) cells. Rantes is also an HIV-suppressive factor re-leased from CD8+ T cells. T he Rantes chemokine has been localized to chromosome 17 in humans.

Rantes HumanRecombinant Human Rantes (CCL5); Small inducible cytokine A5, CCL5, T-cell-specific RANTES protein, SIS-δ, T cell- specific protein P228, TCP228, chemokine (C-C motif) ligand 5, SISd, SCyA5, RANTeS, D17S136e, MGC17164

CHM-328-20 °C

5 µg20 µg1 mg

50 130

2,700

SPYSSDTTPC CFAYIARPLP RAHIKEYFYT SGKCSNPAVV FVTRKNRQVC ANPEKKWVRE YINSLEMSRantes Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 68 amino acids and having a molecular mass of 7809.2 Dalton.

359 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


Rantes HisRecombinant Human Rantes (CCL5) His Tag; Small inducible cytokine A5, CCL5, T-cell-specific RANTES protein, SIS-δ, T cell- specific protein P228, TCP228, chemokine (C-C motif) ligand 5, SISd, SCyA5, RANTeS, D17S136e, MGC17164

CHM-361-20 °C

2 µg10 µg1 mg

50 130

4,800

Rantes Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain contain-ing 68 amino acids fragment (24-91) having a total molecular mass of 17.5kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

rmRantesRecombinant Mouse Rantes (CCL5); Small inducible cytokine A5, CCL5, T-cell-specific RANTES protein, SIS-δ, T cell- specific protein P228, TCP228, chemokine (C-C motif) ligand 5, SISd, SCyA5, RANTeS, D17S136e, MGC17164

CHM-342-20 °C

5 µg20 µg1 mg

50 130

2,700

SPYGSDTTPC CFAYLSLALP RAHVKEYFYT SSKCSNLAVV FVTRRNRQVC ANPEKKWVQE YINYL-EMSRantes Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 68 amino acids and having a molecular mass of 7.8kDa.

rRantesRecombinant Rat Rantes (CCL5); Small inducible cytokine A5, CCL5, T-cell-specific RANTES protein, SIS-δ, T cell- specific protein P228, TCP228, chemokine (C-C motif) ligand 5, SISd, SCyA5, RANTeS, D17S136e, MGC17164

CHM-352-20 °C

5 µg20 µg1 mg

50 130

2,700

SPYGSDTTPC CFAYLSLALP RAHVKEYFYT SSKCSNLAVV FVTRRNRQVC ANPEKKWVQE YINYL-EMSRantes Rat Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 68 amino acids and having a molecular mass of 7876 Dalton.

360 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


SDF 1α (Stromal Cell-Derived Factor-1 α (CXCL12))SDF-1 (stromal cell-derived factor-1) is small cytokine belonging to the chemokine family that is officially designated Chemokine (C-X-C motif) ligand 12 (CXCL12). It is produced in two forms, SDF-1β/CXCL12a and SDF-1β/CXCL12b, by alternate splicing of the same gene. Chemokines are characterized by the presence of four conserved cysteines, which form two disulfide bonds. The CXCL12 proteins belong to the group of CXC chemokines, whose initial pair of cysteines are separated by one intervening amino acid. CXCL12 is strongly chemotactic for lymphocytes and has been implicated as an important cell co-ordinator during development. During embryogenesis it directs the migration of hematopoietic cells from foetal liver to bone marrow. Mice which were knocked-out for CXCL12 gene were lethal before the birth or within just 1 hour of life. As another role, CXCL12a alters also the electrophysiology of neurons. CXCL12 was shown to be expressend in many tissues in mice (including brain, thymus, heart, lung, liver, kidney, spleen and bone marrow).The receptor for this chemokine is CXCR4, which was previously called fusin. This CXCL12-CXCR4 interaction used to be considered exclusive (unlike for other chemo-kines and their receptors), but recently it was suggested that CXCL12 is also bound by CXCR7 receptor. The gene for CXCL12 is located on human chromosome 10. In human and mouse both CXCL12 and CXCR4 show high identity of sequence: 99% and 90%, respectively.

SDF 1αRecombinant Human Stromal Cell-Derived Factor-1 α (CXCL12); SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1A, TPAR1, SCyB12, SDF-1α, TLSF-α

CHM-262-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Lys-Pro-Val-Ser-LeuStromal Cell-Derived Factor-1 α Human Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 68 amino acids and having a molecular mass of 8004 Dalton.W.-C. Shyu, et al., The Journal of Pharmacology and Experimental Therapeutics, 324, 2 (2008).P.T. Thevenot, Mechanisms of Biomaterial Mediated Fibrotic Responses and Strategies to Improve Tissue Reactions to Biomaterial Implants, U. of TX (2010).

SDF 1α, HisRecombinant Human Stromal Cell-Derived Factor-1 α (CXCL12) His-Tag; SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1A, TPAR1, SCyB12, SDF-1α, TLSF-α

CHM-241-20 °C

2 µg10 µg1 mg

50 130

2,900

MKHHHHHHAS KPVSLSYRCP CRFFESHVAR ANVKHLKILN TPNCALQIVA RLKNNNRQVC IDPKLK-WIQE YLEKALNKStromal Cell-Derived Factor-1 α Human Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 78 amino acids, having a molecular mass of 9.2 kDa. The SDF-1a is fused to 10 amino acids His-Tag at N-terminus

361 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mSDF 1αRecombinant Mouse Stromal Cell-Derived Factor-1 α (CXCL12); SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1A, TPAR1, SCYB12, SDF-1α, TLSF-α, 12-O-tetradecanoylphorbol 13-acetate repressed protein 1, Thymic lymphoma cell-stimulating factor, TLSF

CHM-324-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Lys-Pro-Val-Ser-LeuStromal Cell-Derived Factor-1 α Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 68 amino acids and having a molecular mass of 7921 Dalton.

rSDF 1αRecombinant Rat Stromal Cell-Derived Factor-1 α (CXCL12); SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1A, TPAR1, SCYB12, SDF-1a, TLSF-a, 12-O-tetradecanoylphorbol 13-acetate repressed protein 1, Thymic lymphoma cell-stimulating factor, TLSF

CHM-354-20 °C

2 µg10 µg1 mg

50 130

2,700

KPVSLSYRCP CRFFESHVAR ANVKHLKILN TPNCALQIVA RLKSNNRQVC IDPKLKWIQE YLDKALNKStromal Cell-Derived Factor-1 α Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 68 amino acids and having a molecular mass of 7.9 kDa.

SDF 1βRecombinant Human Stromal Cell-Derived Factor-1 β (CXCL12); SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1B, TPAR1, SCYB12, SDF-1b, TLSF-β

CHM-325-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Lys-Pro-Val-Ser-LeuStromal Cell-Derived Factor-1 β Human Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 72 amino acids and having a molecular mass of 8508 Dalton

SDF 1β HisRecombinant Human Stromal Cell-Derived Factor-1 β (CXCL12) His Tag; SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1B, TPAR1, SCYB12, SDF-1b, TLSF-b, 12-O-tetradecanoylphorbol 13-acetate repressed protein 1, Thymic lymphoma cell-stimulating factor, TLSF

CHM-249-20 °C

2 µg10 µg1 mg

50 130

5,200

MGSSHHHHHH SSGLVPRGSH MKPVSLSYRC PCRFFESHVA RANVKHLKIL NTPNCALQIV ARLKNNNRQV CIDPKLKWIQ EYLEKALNKR FKMSDF-1 β Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 93 amino acids (22-93 a.a.) and having a molecular mass of 10.8 KDa. It is fused to 20 amino acid His-Tag at N-terminus.

362 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


mSDF 1βRecombinant Mouse Stromal Cell-Derived Factor-1 β (CXCL12); SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1B, TPAR1, SCyB12, SDF-1β, TLSF-β, 12-O-tetradecanoylphorbol 13-acetate repressed protein 1, Thymic lymphoma cell-stimulating factor, TLS

CHM-326-20 °C

2 µg10 µg1 mg

50 130

2,700

The sequence of the first five N-terminal amino acids was determined and was found to be Lys-Pro-Val-Ser-LeuStromal Cell-Derived Factor-1 β Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypep-tide chain containing 72 amino acids and having a molecular mass of 8513 Dalton.

fSDF 1βRecombinant Feline Stromal Cell-Derived Factor-1 β (CXCL12); SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1B, TPAR1, SCyB12, SDF-1β, TLSF-β, 12-O-tetradecanoylphorbol 13-acetate repressed protein 1, Thymic lymphoma cell-stimulating factor, TLSF

CHM-247-20 °C

2 µg10 µg1 mg

50 130

2,700

KPVSLSYRCP CRFFESHVAR ANVKHLKILN TPNCALQIVA RLKNNNRQVC IDPKLKWIQE YLE-KALNKRF KMStromal Cell-Derived Factor-1 β Feline Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 72 amino acids and having a molecular mass of 8526 Dalton.

rSDF 1βRecombinant Rat Stromal Cell-Derived Factor-1 β (CXCL12); SDF-1, CXCL12, Pre-B cell growth-stimulating factor, PBSF, hIRH, chemokine (C-X-C motif) ligand 12, SDF1, SDF1B, TPAR1, SCyB12, SDF-1β, TLSF-β, 12-O-tetradecanoylphorbol 13-acetate repressed protein 1, Thymic lymphoma cell-stimulating factor, TLSF

CHM-248-20 °C

2 µg10 µg1 mg

50 130

2,700

KPVSLSYRCP CRFFESHVAR ANVKHLKILN TPNCALQIVA RLKSNNRQVC IDPKLKWIQE YLD-KALNKRL KMSDF-1 β Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 72 amino acids and having a molecular mass of 8.4 kDa.

SDF 1gRecombinant Human Stromal Cell-Derived Factor-1 γ (CXCL12); Stromal cell-derived factor 1, SDF-1, hSDF-1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, IRH, hIRH, Pre-B cell growth-stimulating factor, PBSF, CXCL12, SDF1, hSDF-1γ, SDF-1g, TLSF, TPAR1, SCyB12

CHM-020-20 °C

2 µg10 µg1 mg

50 130

2,700

GKPVSLSYRC PCRFFESHVA RANVKHLKIL NTPNCALQIV ARLKNNNRQV CIDPKLKWIQ EYLE-KALNKG RREEKVGKKE KIGKKKRQKK RKAAQKRKNSDF-1 γ Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain contain-ing 99 amino acids and having a molecular mass of 11.6kDa.

363 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


TARC (Thymus and Activation Regulated Chemokine (CCL17))TARC cDNA encodes a 94 amino acid precursor protein with a 23 amino acid residue signal peptide that is cleaved off to generate the 71 amino acid residue mature se-creted protein. Along with CC chemokine family members, CCL-17 has approximately 24-29% amino acid sequence identity with RANTES, MIP-1a, MIP-1b, MCP-1, MCP-2, MCP-3 and I-309. TARC is expressed in thymus, and at a lower level in the lung, colon, and small intestine. TARC is in addition transiently expressed in stimulated peripheral blood mononuclear cells. Recombinant TARC has been shown to be che-motactic for T cell lines but not monocytes or neutrophils. CCL-17 was recently identi-fied to be a specific functional ligand for CCR4, a receptor that is selectively expressed on T cells. CCL17 is one of quite a few Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. CCL17 shows chemotactic activity for T lymphocytes, but not monocytes or granulocytes. CCL17 binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.

TARCRecombinant Human Thymus and Activation Regulated Chemokine (CCL17); C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCyA17, TARC, A-152e5.3, MGC138271, MGC138273

CHM-240-20 °C

5 µg20 µg1 mg

50 130

2,700

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAV-KYLQSLERSCCL17 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 8 kDa.

TARC HisRecombinant Human Thymus and Activation Regulated Chemokine (CCL17) His Tag; C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCyA17, TARC, A-152e5.3, MGC138271, MGC138273

CHM-359-20 °C

2 µg10 µg1 mg

50 130

5,200

MGSSHHHHHH SSGLVPRGSH MARGTNVGRE CCLEYFKGAI PLRKLKTWYQ TSEDCSRDAI VFVT-VQGRAI CSDPNNKRVK NAVKYLQSLE RSTARC Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 92 amino acids (24-94 a.a.) and having a molecular mass of 10.3 kDa. It is fused to 20 amino acid His-Tag at N-terminus.

mTARCRecombinant Mouse Thymus and Activation Regulated Chemokine (CCL17); C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCyA17, TARC, A-152e5.3, MGC138271, MGC138273

CHM-270-20 °C

5 µg20 µg1 mg

50 130

2,700

ARATNVGREC CLDYFKGAIP IRKLVSWYKT SVECSRDAIV FLTVQGKLIC ADPKDKHVKK AIRLVKNPRPTARC Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 70 amino acids and having a molecular mass of 7.9kDa.

364 Order Hotline 1-800-777-4779 502-266-8787

PEPT

IDES

INTE

RNAT

IONA

LRE

cOm

bINA

NT P

ROTE

INS

- chE

mO

kINE


rTARCRecombinant Rat Thymus and Activation Regulated Chemokine (CCL17); Thymus and activation-regulated chemokine, CCL17, SCyA17, TARC

CHM-012-20 °C

5 µg20 µg1 mg

50 130

2,700

ARATNVGREC CLDYFKGAIP IRKLVTWFRT SVECPKDAIV FETVQGRLIC TDPKDKHVKK AIRHLKNQRLTARC Rat Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of 8.1kDa.

TeCK (Thymus expressed Chemokine (CCL25))CCL25 (Teck) is a novel CC chemokine, which is distantly related (about 20% amino acid sequence identity) to other CC chemokines. The mouse CCL25 cDNA has also been cloned and shown to encode a 144 a.a. protein, which exhibits 49% a.a. se-quence identity to the human CCL25. Human and mouse CCL25 expression was shown to be greatly restricted to the thymus and small intestine. While dendritic cells are identified as the source of CCL25 production in the thymus, dendritic cells derived from bone marrow do not express CCL25. CCL25 signals through the CCR9 receptor. Teck is possibly involved in T-cell development. Recombinant human and mouse Teck were shown to be chemotactic for activated macrophages, dendritic cells and thymocytes. The recombinant protein demonstrates chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritic cells but is inactive on peripheral blood lymphocytes and neutrophils.

TeCKRecombinant Human Thymus expressed Chemokine (CCL25); C-C motif chemokine 25, Small-inducible cytokine A25, Thymus-expressed chemokine, Chemokine TeCK, CCL25, SCyA25, TeCK, Ckb15, MGC150327

CHM-364-20 °C

5 µg20 µg1 mg

50 130

2,700

QGVFEDCCLA YHYPIGWAVL RRAWTYRIQE VSGSCNLPAA IFYLPKRHRK VCGNPKSREV QRAMKLL-DAR NKVFAKLHHN MQTFQAGPHA VKKLSSGNSK LSSSKFSNPI SSSRKNVSLL ISANSGLTECK Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 127 amino acids and having a molecular mass of 14.2kDa.

mTeCKRecombinant Mouse Thymus expressed Chemokine (CCL25); C-C motif chemokine 25, Small-inducible cytokine A25, Thymus-expressed chemokine, Chemokine TeCK, CCL25, SCyA25, TeCK, Ckb15, MGC150327

CHM-259-20 °C

5 µg20 µg1 mg

50 130

2,700

QGAFEDCCLG YQHRIKWNVL RHARNYHQQE VSGSCNLRAV RFYFRQKVVC GNPEDMNVKR AIRILT-ARKR LVHWKSASDS QTERKKSNHM KSKVENPNST SVRSATLGHP RMVMMPRKTN NTECK Mouse Recombinant produced in γ is a single, non-glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of 14.1kDa.

k bca 1 o e proteins - pepnet.com · 319order hotline 1-800-777-4779 502-266-8787 peptides...

Documents