e – tender for :- civil, structure, boundry wall and …g) the bidders should ... 17.0 c...
TRANSCRIPT
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
1
Tender Notice No. : N.I.T./I.S.D.S/Engg/Civil/No.5426/17- 18/..Date : 28/12/2017
Indore Sahakari Dugdha Sangh Maryadit, Indore
E – TENDER FOR :-
Civil, Structure, boundry wall and ancillary works along withsupply of necessary labour, materials, equipment and servicesfor the construction and completion of the of new dairy Plantbuilding at Khandwa under Indore Sahakari Dugdha SanghMaryadit Indore.
Chief Executive Officer,Indore Sahakari Dugdha Sangh Maryadit, IndoreDairy Plant, Chandatalawali, Mangalia,Indore (M.P.) 453771TelephoneNo.0731-281154.Fax:0731-2811559.9425912957,E-mail: [email protected]
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
2
Table of Content
PERTICULARSPAGENO.
FRONT PAGE 1TABLE OF CONTENTS OF MEJOR SECTIONS 2PART A: GENERAL TERMS AND CONDITIONS 3INVITATION TO BID 3SECTION-1: INSTRUCTION TO THE BIDDER 4SECTION II: GENERAL CONDITIONS OFCONTRACT(DEFINATION AND INTERPRETATION)
16SECTION-III: SECTION III: SPECIAL CONDITIONS OFCONTERACT
56SECTION-IV: SCHEDULE OF SUPPLEMENTARY INFORMATION 58SECTION -V: FORM OF AGREEMENT 67SECTION VI: ACCETABLE FORMS OF BANK GAURANTEES 71PART B: TECHNICAL SPECIFICATIONS ( civil work) 78APPLICABLE STANDARD FOR CIVIL PLUMBING WORK 79LIST OF APPROVED MAKES 83PART C: BILL OF QUANTITIES ( FOR CIVIL WORK) 231PART D: PRICE BID 242PART E: DRAWINGS (SEPARATE ATTACHMENT) 253
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
3
PART-A GENERAL TERMS AND CONDITIONSIndore Sahakari Dugdha Sangh Maryadit. invites on line tenders from eligible bidders for Civil,Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipmentand services for the construction and completion of the of new dairy Plant building at Khandwa underIndore Sahakari Dugdha Sangh Maryadit Indore.
PART-A : GENERAL TERMS AND CONDITIONSINVITATION TO BID
Name of the Project : Civil, Structure, boundry wall and ancillary works along with supply ofnecessary labour, materials, equipment and services for the construction and completion of the of newdairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh Maryadit Indore
Name of Work: Civil, Structure, boundry wall and ancillary works along with supply of necessarylabour, materials, equipment and services for the construction and completion of the of new dairy Plantbuilding.
Ref No.: - N.I.T./.I.S.D.S/Engg/17-18/No- 5426/Dt28/12/2017
NOTICE INVITING E-TENDER AND GENERAL INFORMATIONS
Invitation of E-Tender for. Civil, Structure, boundry wall and ancillary works along with supply ofnecessary labour, materials, equipment and services for the construction and completion of the of newdairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh Maryadit Indore
Indore Sahakari Dugdh Sangh Maryadit Indore invites on-line tenders from eligiblebidders for Civil, Structure, boundry wall and ancillary works along with supply of necessarylabour, materials, equipment and services for the construction and completion of the ofnew dairy Plant building at Khandwa, under Indore Dugdh Sangh Sahakari Mydt Indore.Tender document is available & can be download up to 15/01/2018 till 5:00P.M.. Thetender document is also available on the website www.mpcdf.gov.in to read the terms &conditions, scope of works etc. as a reference only. The C.E.O., I.S.D.S .reserves all rightsto accept or reject any or all the tenders without assigning any reason.Corrigendum/Amendment if any to this publication would appear only on the abovementioned website and will not be published else where.
Chief Executive Officer
1). Detailed terms & conditions, Scope of Work, Technical specifications and schedule ofquantities for all the items and material are mentioned in bidding documents. Biddingdocuments comprises off our mejor parts as per index.
2). Detail drawings for reference are available at Indore SahakariDugdha Sangh Maryadit’soffice on all working days between 2:00 to 5:00 PM
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
4
Section I: – Instructions to the Bidders.General Information
Interested eligible bidders may obtain further information from the on line web-site office of the IndoreSahakari Dugdha Sangh Maryadit at the address given above in 2(i) Or on web siteathttp://mpcdf.mpeprocurement.gov.in
1. NAME OF WORK:Civil, Structure, boundry wall and ancillary works alongwith supply of necessary labour, materials, equipmentand services for the construction and completion of theof new dairy Plant building at Khandwa under IndoreSahakari Dugdha Sangh Maryadit Indore
2. PERIOD OF completion of project forcomplete work.
9 Months including rainy season from the date ofcontract agreement and issue of work order.
3. CONTACT PERSON:Mr. S M. Patel ,General Manager (Plant Op.) -9425912957
Mr. R.S. Nayak ,Manager(Civil)9425912944
4. Last date & time for Tender Documentpurchase online
15.01.2018 up to 5 pm
5. Last date and time for on-linesubmission of Bid .
16.01.2018 UPTO 2:30 P.M
6.Last date & time forphysicallysubmission of EM.D. andtechnical bid in separate envlops.
16.01.2018 UPTO 2:30 P.M
7.Date and time of on-line opening ofEnvelop of E.M.D.
16.01.2018 AT 3:00 P.M.
8.Date and time of on-line opening ofEnvelop (B) of Technical Bid.
16.01.2018 AT 3:30 P.M
09.Date and time of opening of physicallysubmitted E.M.D and technical bid.
16.01.2018 At 4:00 PM
10.Date and time of opening of on lineprice bid.
Shall be informed after evolution oftechnical bid.
11. Place of opening of physicallysubmitted Envelop of EMD.
Meeting Hall Of Admin.Block of I.S.D.S.,Chandatalawali, Manglia, Indore.
12.Cost of Tender Document Rs. 5000/-
13. Earnest Money Deposit (E.M.D.) Rs. 2,00,000/- (Rs, two Lakh Only)
14.Address forCommunicaation. Chief Executive Officer,I.S.D.S, Chandatalawali,Manglia, Indore
15.Name of the Employer/ownerIndore Sahakari Dugdha Sangh MaryaditChanda Talawli, Mangliya, Indore-45 377 Tel No.2802553 :2802554 : Fax
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
5
Description of Work:- Civil, Structure, boundry wall and ancillary works along with supply of necessarylabour, materials, equipment and services for the construction and completion of the of new dairy Plantbuilding at Khandwa under Indore Sahakari Dugdha Sangh Maryadit Indore
Owner:- IndoreSahakariDugdhaSanghMaryadit.
Location and Area: -Dairy Plant, Khandwa under Indore Sahakari Dugdha SanghMaryadit.Chanda Talawli, Mangliya, Indore-453771Tel No. 2802553 : : Fax -0731-2802559
(a) Nearest RailwayStation:- Khandwa, Delhi- Mumbai route(b) NearestAirport:- Indore(c) Nearest MajorTown:- Indore(d) Access Roads:- Khandwa City roads(150 km away by Road from Indore(e) Period of Completion:- 9 Months including rainy season from the date of contract agreement
followed by issue of work order .
Eligibility and the Qualifications requirements:-To be eligible for the award of the contracts, bidders shall provide evidence satisfactory to theIndore Sahakari Dugdha Sangh Maryadit .of their eligibility and of their capacity andadequacy of resources to carry out the contract effectively. To this end all the bids submittedshall include the following information:-
(a) copies of original documents defining the constituting of the legal status, place of registrationand the principal place of the business of the company or firm or partnership of if jointventure ,of each party there to constituting the bidders;
(b) The bidder’s annual financial turnover in the same name and style during the last three yearsshall not be less than equal to the value of contract as quoted by bidder.
(c) The bidder in the same name and style shall have satisfactorily completed at least two projectsof similar type of construction work during the last five years and of value equal to the contractvalue as quoted by the bidder.
(d) Power of attorney or a true copy thereof duly attested by a gazetted officer in case anauthorized representative has signed the bid.
(e) Income tax clearance certificate and sales tax clearance certificate in original or photo copiesduly sealed and signed by bider.
(f) Details of the experience and the past performance of the bidder on works of within the pastfive years, and details of current work in hand and the other contractual commitments shall besubmitted as per Table - 4 & 8 given in section IV respectively of this bidding document.
(g)The bidders should have valid registration for construction work as contractor with state / centralgovernment’s Roads &Building Department.
(h) Major items of proposed plant and machineries proposed for use in carrying out the contract in theformat prescribed in the Table - 1 and the qualifications and experience of key personnelproposed for administration and the execution of the contract, both on and off site, in the formatprescribed inTable-2 of section-IV of this bidding document.
(i) Proposals for the sub contracting elements of the works amounting more than 10% of the bids
price for each element and shall be as listed in theTable-3 of section V of this bidding document.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
6
(j) Reports of the financial standing of the bidder such as profit and loss statements, balance sheetsand auditor’s reports for the past three years, as prescribed in the Table – 7 of section V of thisbidding document and an authority from the bidder to seek reference from the bidder’s bankers ;and
(k) Statement of the arbitration / disputes in which the bidder is involved as prescribed in the Table-6
of section V of this bidding document.
For the purpose of this particular contract bidders shallmeet the following qualifying criteria as minimum:-
(a) The bidder should be in the business as Civil works contractors for aminimum period of 5 years in the same name and style at the time ofbid opening.
(b) The bidder’s annual financial turnover in the same name and style during the lastthree years shall not be less than 100 % of the value of contract as quoted by bider.
(c) The bidder in the same name and style shall have satisfactorily completed/running atleast one project of similar work as required in the tender.
(d) Thebidder shall furnish a copy of the Income Tax returns and the Income taxclearance certificate for the previous year(s), in original or certified true copies.
(e) The bidders should furnish a copy of approved registered contractor from competentauthority.
3.0 Cost of bidding:-
The bidder shall bear all costs associated with the preparation andsubmission of his bid. Indore Sahakari Dugdha Sangh Maryadit. will in anycase shall not be responsible or liable for these costs, regardless of theconduct or out come of the bidding process.
4.0 Site visit:-The bidder is advised to visit and examine the site of works and its surroundings and obtain for himselfon his own responsibility all information that may be necessary for preparing the bid and entering into acontract. The costs of visiting the site shall be at bidder’s own expense.The bidder and any of hispersonnel or agent (s) will be granted permission by Indore Sahakari Dugdha Sangh Maryadit. To enterupon the premises and lands for the purpose of such inspection, but only upon the express condition thatthe bidder, his personal or agent(s), will release and indemnify the Indore Sahakari Dugdha SanghMaryadit. and his personnel and agent(s) from and against all liabilities in respect thereof and will beresponsible for personnel injury (whether fatal or otherwise), loss of or damage to property and anyother loss or damage,costs and expenses however caused, which,but forth exercise of such permissionwould not have arisen.
B. Bidding Documents
5.0 Contents of the Bidding Documents.The set of bidding documents issued for the purpose of bidding includes thenumber of the copies as stated in Index, together with any addenda there to beissued in accordance with clause no 7.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
7
The bidder is expected to examine carefully all instructions conditions, forms, terms,specifications and drawings in bidding documents. Failure to comply with therequirements and the bid submission will be at the bidder’s own risk. Pursuant toclause 24, bids which are not substantially responsive to the requirements of thebidding, documents will be rejected.
6.0 Clarification of the Bidding Documents.
A prospective bidder requiring any clarification of the bidding documents maynotify the Indore Sahakari Dugdha Sangh Maryadit. in writing or through E-mail at the address indicated in the invitation to bid. The Indore SahakariDugdha Sangh Maryadit. will respond in writing 10 days prior to the dead linefor the submission of the bids. Written copies of the response of the IndoreSahakari Dugdha Sangh Maryadit. (including the description of the inquirywithout identifying its source) will be sent to allprospective bidders.
7.0 Amendmnt of the Bidding Documents.
7.1. At any time prior to the deadline for the submission of bids, Indore SahakariDugdha Sangh Maryadit. may for any reason whether at its own initiative or inresponse to clarification requested by the prospective bidder, modify the biddingdocument by issuing amendment.
7.2. The amendment will be sent in writing to all prospective bidders and will bebinding upon them. Prospectively bidders shall acknowledge receipt thereof, the prospectivebidder due to the postal delay shall not bind the bids. The amendment will be attached to thebidding document issued subsequently.
7.3. In order to afford prospective bidders reasonable time in which to take anamendment into account of preparing their bids, the Indore Sahakari Dugdha Sangh Maryadit.may, at its discretion, extend the deadline for the submission of bids in accordance with clause 18.
A. Preparation of the Bids.
8.0 Language ofBid
The bid prepared by the bidder and all correspondence and documents relating tothe bid exchanged by the bidder and the Indore Sahakari Dugdha Sangh Maryadit. shall be written inthe English language only. Supporting documents and printed literature furnished by the bidder withthe bid may be in another language provided they are accompanied by appropriate translation ofpertinent passage in the English. For the purpose of the interpretation of the bid, English languageshall prevail.
9.0. Documents comprising the Bid
Check list for documents comprising the Bid.
(a) EarnestMoneyDeposit.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
8
(b) The schedule of the quantities.(c) The schedule of the supplementary information, the information on the eligible andqualifications. – As per clause 2.0 of Instruction to the Bidders.
10. Bid Prices.10.1 Contract will be placed for work as described in the Invitation to bid based on the schedule of
unit rates and prices submitted by the bidder as prescribed in the bid formate to arrive on tenderrates.
10.2 The bidder shall fill in rates and prices for all items of works described in the schedule ofquantities, whether quantities are stated or not.
10.3 Specify Tax Condition separately. Weather CGST/SGST/any others. are applicable or not. If taxcondition is not specified your rate shall be considered inclusive of all taxes. The comparison ofthe bids by the Indore Sahakari Dugdha Sangh Maryadit. shall be made accordingly.
10.4 Fixed Prices –
This project is on rate contract basis and the rates / prices quoted by the bidder shall be fixed for theentire duration of the contract and shall not be subjected to the adjustment on any account. A bidsubmitted with any price adjustment condition shall be treated as non-responsive and rejected..
11.0 Currency of the Bid and Payment
The unit rates and prices shall be quoted in Indian Currency only.Subsequently all payment and financial transactions will be in Indian currencyonly.
12.0 Bid Validity
12.1 Bid submitted by bidder will remain valid for acceptance for period of 90 days fromthe date of bid opening.
12.2 In exceptional circumstances prior to the expiry of the original bid validity period, the IndoreSahakari Dugdha Sangh Maryadit. may request the bidder for specified extension in period of validity.The request and the response thereto shall be made in writing. A bidder may refuse the request withoutforfeiting his bid security. A bidder agreeing to the request shall not be permitted to modify his bid butshall be required to extend the validity of his Earnest Money Deposit correspondingly. The provisions ofclause 13 shall continue to apply during the extended period of bid validity.
13.0 Earnest Money Deposit (EMD)
13.1 The bidder shall furnish EMD as the part of the bid for the amount as specified In theInvitation of the bid/ general information.
13.2 The EMD shall be in the form of bank draft or pay order drawn in the favour of“INDORE SAHAKARI DUGDHA SANGH MARYADIT”. Payable at Indore.
13.3 Any bid not accompanied by EMD or EMD submitted in not-acceptable format shall beconsidered as non-responsive and will be rejected by the INDORE SAHAKARIDIGDHASANGHMARYADIT.
13.4 The EMD of unsuccessful bidders shall be refunded as promptly as possible but notlater than 30 days after expiry of period of bid validity as prescribed in clause – 12.0
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
9
13.5 The EMD of the Successful bidder shall be refunded within 30days from date of signingthe agreement and furnishing of required performance security
13.6 No interest shall be paid by Indore Sahakari Dugdha Sangh Maryadit on the EMDfurnished by the bidder.
13.7 The EMD may be forfeited in any of the following circumstances: -
(a) If a bidder withdraws his bid during period of bid the prescribed time limit to:-(i) Sign the agreement.(ii) Furnish the required performance security.(iii)Commence the work within the time limit prescribed.
14.0 Variation of the Bidding condition
14.1 The bidder shall submit offer, which comply fully with the requirements of thebidding documents, including the basic technical design and indicated in the drawingand specifications. Conditional bids are liable to be considered as non-responsive inaccordance with clause 24.
15.0 NA
16.0 Format and Signing of Bids.
16.1 The bidder shall prepare and submit the original copy of the documentscomprising the bidding documents.16.2 All the pages of the bidding documents shall be sealed and signed by the person(s)duly authorized, to bind the bidder to the contract. Proof of authorization shall be in theform of a pages of the bid documents, where entries and amendments had been made,shall additionally be initialized by the person (s) signing the bids.16.3 The complete bid shall be without the alterations, interlineations or erasures,except those in accordance with instruction issued by the Indore Sahakari DugdhaSangh Maryadit. or as necessary to correct errors made by the bidder, in which casesuch corrections shall initialed by the person (s) signing the bid. No over writing shallbe permitted.16.4 Each bidder may submit only one bid. No bidder may participate in the bid ofanother for the same contract in any relation whatsoever.16.5 The bidder shall quote the rate so arrived of total amount of each item as listed in price bidboth in figures and words.
17.0 C Submission of Bids17.1. The tender document can be purchased by downloading from the website www.mpeproc.gov.in bypayment of the cost of the tender document Rs. 5000/-as per the schedule mentioned in the Invitationto bid The tender document may also available on the website www.mpcdf.gov.in of M.P.Co-OperativeDairy Federation ltd Bhopal only to read the terms & conditions, scope of works etc.as a reference only.
17. 2 Bidder should read all terms & conditions of tender thoroughly before filling tenderonline ( Scanned copy of EMD, supporting document to be uploaded wherever
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
10
required).
17. 3. Scanned copy of EMD to be uploaded online only & original to be submittedAlong with the physical technical bid ( both in separate sealed envelops) upto 02:30 PM on 16/01/2018subscribing tender number & tender reference at Indore Sahakari Dugdh Sangh Mydt, Indore (personalSection).
17.4 Any tender which is not accompanied by Earnest Money Deposit is liable to be rejected. EarnestMoney deposit of unsuccessful tenderers will b returned against written request within 90 clear days fromthe date of opening of the tender. No interest will be paid for the earnest money deposited.
17.5 . The scaned copies ”Technical Bid Online” will comprised of supportingdocuments as per tender & should be Submitted online on website www.mpeproc.gov.in online–alongwith scanned copies of the Annexures& the documents required for fulfilling eligibility criteriafor “TechnicalBid”.The Technical Bid Physical should be submitted personally or send byRegistered post, so as to reach the office of the Chief Executive OfficerIndore Sahakari Dugdha Sangh ,Dairy Plant,Manglia, Indore (M.P.) on or before16/01/2018 up to 2:30 p.m.. The Indore SahakariDugdha Sangh will notbe responsible for any postal delay. Envelop to be superscribed with“TECHNICAL BID- Physical ”& tender for New Dairy plant Khandwa of ISDM.
17.6. The bid to be submitted by the bidder on line as per the bidding document, shall bein three separate parts.
Part I – – shall be named Earnest money in the form specified in respectiveand to be uploaded scaned copy online .
17.7 Part ll - -shall be named "Technical Bid" and shall comprise:
(i) Qualification Information and supporting documents as specified inInstructions to bidder
(ii) Certificates, undertakings, affidavits as specified above.
(iii) Any other information pursuant to these instructions.
(iv) Undertakings.
v) An affidavit affirming the information be has furnished in the biddingdocument is correct to the best of his knowledge and belief.
17.8 Part III -shall be named "Financial Bid" and shall comprise ofPriced Bill of Quantities as specified in price bid formate.
17.9 Following documents, will be deemed to be part of the bid.
Section Particulars
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
11
1 Invitation for Bids (IFB)
2 Instructions to Bidders
3 Conditions of Contract
4 Specifications
18.0 Deadline for submission of bids
18.1 Bids must be received by the Indore Sahakari Dugdha Sangh Maryadit. at theaddress of correspondence on or before the date & time of submission as statedin clause 2. (f) In the Invitation to Bid.
18.2 The Indore Sahakari Dugdha Sangh Maryadit. may, at its discretion, extend thedeadline for the submission of bids by issuing an amendment. All rights andobligation of Indore Sahakari Dugdha Sangh Maryadit. and the bidderspreviously subject to the original deadline shall thereafter be subject to the newdeadline as extended.
19.0 Late Bids
19.1 Any bid received by the Indore Sahakari Dugdha Sangh Maryadit. later than thedead line for the submission of bids as prescribed by the Indore SahakariDugdha Sangh Maryadit. in accordance with clause 17 shall be returnedunopened to the bidder.
20.0 NA.
Bid Opening and Evaluation.
21. Bid OpeningThe Indore Sahakari Dugdha Sangh Maryadit. will open the bids, including submission madepursuant to clause 19 in the presence of bidder’s representative who chooses to attend, at theoffice of the Indore Sahakari Dugdha Sangh Maryadit. in the address of the communication atthe time and date stated in the clause 2. (h) In the invitation to Bid. Only two representativesper bidder will be allowed to attend the bid-
opening meeting. The bidder’s representative whoever is attending the bid- opening meetingshall sign a register evidencing his/her attendance.
Bids for which an acceptable notice of withdrawal has been submitted pursuant to clause 19shall not be opened.
The Indore Sahakari Dugdha Sangh Maryadit. will examine the bids to determine whether theyare complete, whether the requisite Earnest Money Deposit have been furnished, whether thedocuments have been properly signed, and whether the bids are generally in order.
At the bid opening the Indore Sahakari Dugdha Sangh Maryadit. announce the bidder’s names,the bid prices, written notifications of bid modifications and withdrawals, if any, the presence of
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
12
requisite Earnest Money Deposit and such other details as the Indore Sahakari Dugdha SanghMaryadit.,Indore may consider appropriate.
The Indore Sahak ari Dug dha S angh Maryadit.,Indore shall prepare, for it’s own records,the minutes of the bid opening, including the information disclosed to those present inaccordance as above.
22. Process to be confidential
22.1. After the public opening of bids, information relating to the examination, clarification,evaluation and comparison of bids and recommendations concerning the award ofcontract shall not be disclosed to bidders or other persons not officially concerned withsuch process untill the award of the contract to the successful bidder has beenannounced.Any effort by a bidder to influence the Indore S ahakari Dugdha Sa nghMaryadit.,Indore in the process of examination, clarification, evaluation andcomparison of bids and in the decision concerning the award of contract may result inthe rejection of the bidder’s bid.
23,Clarification of Bids
23.1 To assist in the examination, evaluation and comparison of bids, theIndore Sahakari Dugdha Sangh Maryadit.,Indore may ask the biddersindividually for clarification of their bids, including break down of unit rates.The request for clarification and the response shall be in writing but no changein the price or substance of the bid shall be sought, offered or permitted exceptas required to confirm the correction of arithmetic errors discovered by theIndore Sahakar i Dugdha Sangh M aryadit.,Indore during the evaluation ofthe bids in accordance with clause 26.
24.0 Determination ofResponsiveness
24.1 Prior to the detailed evaluation of the bids, the Indore S ahakari Dugd ha SanghMaryadit.,Indore will determine whether each bid is substantially responsive to therequirements of the bidding documents.
24.2 For the purpose of this clause, a substantially responsive bid is one, whichconforms to all terms, conditions and specifications of the bidding documentswithout material deviation or reservation. A material deviation or reservation isone which affects in any substantial way the scope, quality or the performanceof the works or which limits in any substantial way, inconsistent with thebidding documents, the Indore S ahakari Dugdha Sangh Maryadit.,Indore(Indore Sahakari Dugdha Sangh Maryadit.’s rights or the bidder’s obligationsunder the contractor, and the rectification of which deviation or reservationwould affect unfairly the competitive position of other bidders presentingsubstantially responsive bids.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
13
24.3 If a bid is not substantially responsive to the requirements of the biddingdocuments, it will be rejected by the Indore Sahakari Dugdha SanghMaryadit.,Indore and may not be subsequently made responsive by thebidder having corrected or withdrawn the non-conforming deviationorreservation.
25.0 Correction of Errors
25.1 Bids determined to be substantially responsive will be checked by the IndoreSahakari Dugdha Sa ngh M aryadit.,Indore for any arithmetic errors incomputation and summation. Errors will be corrected as follows:-
a) Where there is a discrepancy between rates or amounts in figures and in words,the rate or amounts in words shall govern and
b) Where there is a discrepancy between the unit rate and the total amountderived from the multiplication of the unit rate and the quantity the unit rate asquoted shall govern.
25.2 The amount stated in the form of bid will be adjusted by the Indore SahakariDugdha Sangh Maryadit.,Indore in accordance with the above procedure forthe correction of errors and, with the concurrence of the bidder, shall beconsidered as binding upon the bidder. If the bidder does not accept thecorrected amount of bid, his bid shall be rejected and the bid security shall beforfeited.
26.0 Evaluation and comparison of the Bids
26.1 The Indore Sa hakari Dugdha Sangh Maryadit.,Indore shall evaluate andcompare only bids determined to be substantially to the requirement of thebidding documents in accordance with clause 24.
26.2 In evaluating bids, the Indore Sahakar i Du gdha Sa ngh M aryadit., Indorewill determine for each bid the evaluated price by adjusting the bid pricemaking any correction for errors pursuant to clause 25.
26.3 The Indore Sahakari Dugdha Sangh Maryadit.,Indore reserves the right toaccept or reject any variation, deviation offers. Variations, deviations andalternative offers and other factors which are in excess of the requirementof the bidding documents or otherwise result in the accrual of unsolicitedbenefits to the Indore Sahakari Dugdha Sangh Maryadit.,Indore shall notbe taken in to account in bid evaluation.
F. Award of Contract
27.0 Award Criteria
27.1 Subject to clause 28, the Indore Sa hakari Dugdha Sa ngh M aryadit.,Indoreshall award the contract to the bidder whose bid has been determined to besubstantially responsive to the bidding documents and who has offered the
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
14
lowest evaluated bid price pursuant to clause 26, provided further that thebidder has the capability and the resources to carry out the contract effectively.
28. Indore S ahakari Du gdha Sangh M aryadit.,Indore( In dore S ahakariDugdha Sangh Maryadit. Indore) has right to accept any Bid and to reject any or allbids.
28.1 Not withstanding clause 27 or any other clauses stated above, the Indore Sahakari Dugdha Sangh Maryadit.,Indore reserves the right to accept or reject any / allbids, at any time prior to the award of the contract, without assigning any reasonsthereof.
29.0 Notification of Award
29.1 Prior to the expiry of the period of bid validity prescribed in the bid documents, the IndoreSahakari Dugdha Sangh Maryadit.,Indore will notify the successful bidder by confirmed inwriting that his bid has been accepted. This letter (hereinafter and in the conditions of contractreferred to as “Letter of Acceptance”) shall name the sum which the Indore Sahakari Dug dhaSangh M aryadit.,Indore will pay to the contractor in consideration of the execution,completion and the maintenance of the works by the contractors as prescribed by the contract(hereinafter and in the conditions of the contract referred to as the “contract price”).
29.2 The notification of the award will constitute the formation of the contract.
29.3 Upon the furnishing by the successful bidder of a performance security in accordance withthe clause 31 the Indore Sahakari Dugdha Sangh Maryadit.,Indore will notify theunsuccessful bidders that their bids have been unsuccessful.
30.0 Signing of Agreement.
At the same time that the Indore Sahakari Dugdha Sangh Maryadit.,Indore notifies thesuccessful bidder that his bid has been accepted, the Indore S ahakari Du gdha SanghMaryadit.,Indore will send the bidder the form of Agreement provided in the biddingdocuments, incorporating all agreements between the parties.Within 15 days of the receipt of theform of Agreement the successful bidder shall sign the form and return it to the Indore SahakariDugdha Sangh Maryadit.,Indore( Indore SahakariDugdha SanghMaryadit..
31.0 Performance Security
31.1 The successful bidder shall furnish a performance security in the form of bank draft/ bankgaurantee (proforma attached) for an amount of 5% of the contract value within 30 days of thereceipt of the notification of award from the Indore Sahakari Dugdha SanghMaryadit.,Indore, which shall be valid for the entire period of Contract including the Period ofMaintenance plus 90 days. The validity of the bank guarantee is suitably extended in the event ofextension of time of the Contractor pursuant to clause 44 herein.. The performance security shall
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
15
be released by the Indore Sah akari Du gdha Sa ngh Maryadit.,Indore within 60 days afterfinal bill / successful completion of work.
31.2 Failure of the successful bidder to comply with the requirements of the clause 30.0 and or/
31.3 shall constitute sufficient grounds for the annulment of the award and forfeiture of theEarnest Money Deposit.
31.4 Retantion of 5.0 % amount from invoices
ISDS shall retain 5.0 % amount from every invoice produced by supplier towards constructionwork/ services till the last paymant. This amount shall be released to the contractor after 90 daysfrom the date of handing over of building completed in all respect and subject to the submissionof bank gaurentee from nationalised bank of equal amount in favour of ISDS valid for one yearfrom the date of refund of retained amount which will be returned after one year on satisfactorycopletion of any maintannce work if required during the said period or else any losses/ expancesincurred by ISDS on account of non providing services/ repair/ replacemnt the cost of the sameshall be recoverd by informing to concernd bank towards the bank. gaurantee.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
16
Section II: - General Conditions of
Contract Definitionsand
Interpretations.
1.0 In the contract, as hereinafter defined, the following words and expression shallhavethe meanings hereby assigned to them, except where the context otherwiserequires: -
Owner - Shall mean the client on whose behalf the enquiry is issued by the IndoreSahakari Dugdha Sa ngh M aryadit.,Indore and shall include his successors andassignees, as well as his authorized representatives.
Consultant - Shall mean the Indore Sahakari Dugdha Sangh Maryadit.,Indore orthe consultants appointed by the owner for the Project.
Engineer: - Shall mean the Engineer or any other authorized representative of theIndore Sah akari Dugdha Sangh Maryadit.,Indore( Indore Sahakari Dugdha SanghMaryadit.Architect - shall mean the architect appointed by the Indore Sahakari Dugdha Sangh
Maryadit.
Structural Consultant: - Shall mean the structural consultants appointed by theIndore Sahakari Dugdha Sangh Maryadit.,Indore( Indore Sahakari Dugdha SanghMaryadit.
Bidder: - Shall be the firm / party / individual who submit the bid against the invitationto Bid.
Contractor: - Shall mean the successful bidder whose Bid has been accepted byIndore Sahakari Dugdha Sangh Maryadit.,Indore( Indore Sahakari Dugdha SanghMaryadit and on whom a work order has been placed and shall include his heirs, legalrepresentatives and assignees.
Sub-Contractor: - Shall mean the person / firm / party / named by the contractor whoma part of the contract has been sublet with the consent of Indore Sahakari Dugdha SanghMaryadit.And shall include his heirs, successors, legal representatives, and
assignees.
Contract price: - Shall mean the prices of the accepted Bid.
Contract: - Shall mean the articles of agreement, the conditions, the appendix, theschedule of quantities, and / or specifications attached herewith.
“Notice in writing": - shall mean a notice in written, typed or printed characters sent(unless delivered personally or otherwise proved to have been received) by registered /ordinary post to the last known address or the registered office of the addressee andshall be deemed to have been received when in the ordinary course of post it wouldhave been delivered.
Site: - shall mean the actual place of the proposed project or any other place wherework is to be executed under the contract. It shall also include any other land allotted bythe Indore S ahakari Du gdha Sangh M aryadit.,Indore for the contractor’s use likelabour colony, cement / material godown, steel yard, toilets etc. They shall use only the
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
17
allotted area and to ensure that workers, staff etc. shall not damage / destroy or keep ituntidy the area and surroundings allotted to them. They also should not loiter or enterinto running factory premises and other area.
Month: - Shall mean from the beginning of a given date of a calendar month to the endof the preceding date of the next calendar month.
Week: - Shall mean seven consecutive days.
Day: - shall mean a day from midnight to midnight.
Building: - shall mean the proposed building(s), roads, fencing, sanitary and watersupply etc. under the contract.
Bid Security: - Shall mean the sum paid along with the bid as a token to bind thecontract.
Award: - Shall mean the written acceptance of Bid by the Indore Sahakari DugdhaSangh Maryadit.,Indore given to the successful bidder.
Performance Security: - Shall mean the amount pledged with the Indore SahakariDugdha Sa ngh M aryadit.,Indore while signing the agreement for faithful andsatisfactory performance of the contract.
Constructional Plant: - Shall mean all appliances or things of whatsoever naturerequired in or about the execution and maintenance of the works but does no includethe materials or other things required intended to form or forming part of the works.
Specifications: - Shall mean the specification referred to in the bid and anymodification thereof or additional thereto as may from time to time be furnished orapproved in writing by the Indore Sahakari Dug dha S angh Maryadit.,Indore/Engineer.
Drawings: - Shall mean drawings referred to in the specifications and anymodification of such drawings approved in writing by the Engineer and such otherdrawings as may from time to time be furnished or approved in writing by the IndoreSahakariDugdhaSanghMaryadit.,Indore/Engineer.
Temporary Wor ks: - Shall mean the temporary works of every kind required in orabout the execution or maintenance of works.
Permanent Works: - Shall mean the permanent works to be executed and maintainedin accordance with the contract.
Works: - Shall include both temporary works and permanent works.
Approved / Approval: - Shall mean approved in writing, including subsequent writtenconfirmation of previous verbal or written approval.
I.S.S.: - Shall mean Indian Standard Specifications
Government: - Shall mean the Government of India or any other state Government.
Tender: - Shall mean the Bid and related contract documents.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
18
Headings and Marginal notes: - All headings of an notes to the clauses of theseConditions of Contract or of and to the Specifications or any other bid document aresolely for the purpose of giving concise indication and not a summary of the contentsthereof, and they shall never be deemed to be the part of the or be used in theinterpretation or construction thereof or of the Contract.
Singular and Plural: - In this Contract document unless otherwise stated specificallythe singular shall include the plural and vice-versa wherever the context so requires.
Cost: - The cost shall be deemed to include overhead cost whether on or off the site.
Engineer and Engineer’s Representative
2.0 Duties and Powers of the Engineer and the Engineer’s Representative.
The Field management shall be the responsibility of the Engineer. The Engineer shallcarry out such duties as taking decisions and issuing certificates and orders as specifiedin the Contract. The Engineer is empowered to take decisions on the following matters:
(a) Approval of subletting of any part of the works pursuant to clause 4.0 hereof;(b) Certification of additional sums under sub clause 53(2) hereof;(c) Determination of an extension of time pursuant to clause 44.0 hereof(d) Issuance of a variation order pursuant to clause 52.0 hereof;(e) Fixing rates or prices for the additional works executed under the Contract pursuant to
Clause 52.0 hereof.
The Engineer’s Representative shall be responsible to the Engineer and his duties are towatch and supervise the works and to test and examine any materials to be used orworkmanship employed with the works. The Contractor shall get the materials or theworkmanship tested, as instructed by the Engineer’s Representative, at his own cost. Heshall have no authority to relieve the Contractor of any of his duties or obligationsneither under the Contract nor, except as expressly providedhereunder or elsewhere inthe Contract, neither to order any work involving delay or any extra payment by theIndore Sahakari Dugdha Sangh Maryadit.,Indore( Indore Sahakari Dugdha SanghMaryadit. , ), nor to make any variation of or in theworks.
The Indore S ahakari Dugdha Sa ngh Maryadit.,Indore may from time to time inwriting delegate to the Engineer’s Representative any of the powers and authoritiesvested in the Engineer. Any written instruction or approval given by the Engineer’sRepresentative to the Contractor within the terms of such delegations, but not otherwise,shall bind the Contractor as though it had been given by the Engineer provided alwaysas follows: -
(a) Failure of the engineer’s Representative to disapprove any work or materials shallnot prejudice the power of the Engineer there after to disapprove such work or materialsand to order the pulling down, removal or breaking up thereof.
(b) If the Contractor shall be dissatisfied by reason of any decision of the Engineer’sRepresentative he shall be entitled to refer the matter to the Engineer, who shall thereupon confirm, reverse or vary such decision.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
19
3.0 Inspection of works
Indore Sahakari Dugdha Sangh Maryadit.,Indore and his representatives shall havefull power and authority to inspect the works at any time wherever the work is inprogress either on the site or at the Contractor’s premises/workshop wherever situated,premises/workshop of any person, firm or corporation where the work in connectionwith the Contract may be in hand or wherefrom materials are being produced or are tobe supplied, and the Contractor shall afford or procure for the Engineer every facilityand assistance to carry out such inspection. The Contactor shall at all timesduring usual working hours and at all other times at which reasonable notice ofthe intention of the Engineer or the Engineer’s Representative to visit theworks shall have been given to the Contractor, either himself be present toreceive the orders and instructions, or have a responsible agent representativeduly accredited in writing present for the purpose. Orders given to theContactor’s agent/representative shall be considered to have the same force asif they had been given to the Contractor himself. The Contractor shall give notless than three days notice in writing to the Engineer’s Representative beforecovering up or otherwise placing beyond the reach of inspection andmeasurement any work in order that the same may be inspected and measured.In the event of breach of the above the same shall be uncovered at theContractor’s expenses for carrying out such measurement or inspection.
No materials shall be removed form the site before obtaining the approval in writing ofthe Engineer. The Contractor is to provide at all times during the progress of the workand the maintenance period proper means of access with ladders, gangways, etc. and thenecessary attendance to move and adopt as directed for inspection or measurement ofthe works by the Engineer’s Representative.
The Contractor shall make available to the Engineer’s Representative free of cost allnecessary instruments and assistance in checking of setting out of works and checkingof any works made by the Contractor for the purpose of setting out and takingmeasurements of works.
4.0 Sub-letting of work:-
The Contractor shall not sub-let the whole of the works. Except where otherwiseprovided by the Contract, the Contractor shall not sub-let any part of the works withoutprior written consent of the Engineer, which shall not be unreasonably withheld, andsuch consent, if given shall not relieve the Contractor from any liability or obligationunder the Contract and he shall be responsible for the acts, defaults and negligence ofany sub-contractor, his agents, servants or workmen. Provided always that the provisionof labour on a piecework basis shall not be deemed to be a sub-letting under this clause.
5.0 Contract Documents
Language and Law of Contract.
i) All written material and correspondence shall be in Englishii) The law to which the Contract is to be subjected and according to which theContract is construed, shall be the law being in force in India and/or the statewhere the Contract shall be performed.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
20
5.1 Documents mutually explanatory.Except if any to the extend otherwise provided by the Contract, the provisionsof the General Conditions and Special Conditions of the Contract shall prevailover those of any other documents forming part of the Contract. Severaldocuments forming the Contract are to be taken as mutually explanatory.Should there be any discrepancy, inconsistency, error or omission in theContracts or any of them the matter may be referred to Engineer who shallgive his decisions and issue to the Contractor instructions, directing in whatmanner the work is to be carried out. The decision of the
Engineer shall be final and conclusive and the Contractor shall carry out thework in accordance with this decision.
Works shown upon the drawing but not mentioned in the specifications or described inthe specifications without being shown on the drawings shall nevertheless be held tobe included in the same manner as if they had been specifically shown upon thedrawings and described in the specifications.
6.0 Drawings: their purpose and the custody
The Contract drawings read together with the Contract specifications are intended toshow and explain the manner of executing the work and to indicate the type and theclass of materials to be used.
In case any feature of the work is not set forth in the drawings and specifications, theContractor shall forthwith apply to the Engineer for further instructions, drawings orspecifications.
The drawings shall remain in the sole custody of the Engineer, but two copies shall beissued to the Contractor free of charge. One copy of the drawings, furnished to theContractor as aforesaid, shall be kept by the Contractor on the site and the same shall atall responsible times be available for inspection and use by the Engineer or theEngineer’s Representative and by any other person authorized by the Engineer inwriting. At the completion of the Contract the Contractor shall return to the Engineer alldrawings issued under the Contract.
The Contractor shall give written notice to the Engineer whenever planning or progressof the works is likely to be delayed unless any further drawing or instruction is issuedby the Indore Sahakari Dug dha Sang h Maryadit.,Indore / Engineer within areasonable time. The notice shall include the detail of the drawing or instructionrequired and of why and by when it is required and of any delay or disruption likely tobe suffered if it is late.
The Contractor shall submit the following information, in triplicate, to the Engineer forapproval within the time stipulated against each item below.
A general layout plan of construction plant and equipment for theexecution of work within fourteen days from the date of notice to proceedwith the work; and
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
21
Drawings or prints showing the location of major plants and otherfacilities which he proposes to put up at the site including any changesin the general layout, at least fourteen days prior to the commencement ofthe respective work.
7.0 FurtherDrawingsandInstructions
The Engineer may also authorize his representatives to perform his duties and functions.The Contractor shall carry out and be bound by the same. The Engineer shall have fullpowers and authority to supply to the Contractor from time to time, during the progressof the works, such further drawings and instructions as shall be necessary for the properexecution of the project.
8.0 General Obligations
Contractor’s General Responsibilities.
The Contractor shall, subject to the provisions of the Contract, and with due care anddiligence, execute and maintain the Works and provide all labour, including thesupervision thereof, materials, Construction Plant and all other things, whether of atemporary or permanent nature, required in and for such execution and maintenance, sofar as the necessity for providing the same is specified in or is reasonably to be inferredfrom the Contract.
The Contractor shall take full responsibility for the adequate stability and safety of allsite operations and methods of construction, provided that the Contractor shall not beresponsible, except as may be expressly provided in the Contract, for the design orspecification of the Permanent Works, or for the design or specification of anyTemporary Works prepared by the Engineer.
9.0 Contract Agreement
The Contractor shall call upon so to do enter into and execute a Contract Agreement, inthe form annexed with such modification as may be necessary.
10.0 Performance Security
The successful bidder shall furnish a performance security for an amount of 5% of thecontract value within 30 days of the receipt of the notification of award from the IndoreSahakariDugdhaSanghMaryadit.,Indore.
The proceeds of the performance security shall be payable to the Indore S ahakariDugdha Sa ngh Maryadit.,Indore as compensation for any laws resulting from thecontractor's failure to complete the work under the contract.
The performance security shall be denominated in Indian Rupees and shall be in any ofthe following forms: -a) A Demand draft drawn in favor of Indore Sa hakari Dugdha SanghMaryadit.,Indoreb) A Bank guarantee issued by a Nationalized Indian Bank.. The acceptable formshall be strictly as provided in Section VII of the Binding documents.
The bank guarantee shall be valid for the entire period of Contract including the Period
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
22
of Maintenance plus 90 days. The validity of the bank guarantee is suitably extended inthe event of extension of time of the Contractor pursuant to clause 44 herein.
The performance security shall be released by the Indore Sah akari Du gdha Sa nghMaryadit.,Indore within 60 days after final bill / successful completion of work.
In the event of increase in the Contract value, in actual execution, proportionateadditional performance security shall be paid by the Contractor if called upon to do so.
In the event of decrease in the Contract value the performance security shall beproportionately adjusted on the completion of the work.
No interest shall be paid by the Indore Sahakari Dugdha Sangh Maryadit.,Indore forthe amount deposited as Performance security with the Indore Sahak ari DugdhaSangh Maryadit.,Indore.
11.0 Inspection of site
The Contractor shall be deemed to have inspected and examined the site and itssurroundings and information available in connection therewith and to have satisfiedhimself, before submitting his Tender, as to the form and nature thereof, including thesub-surface conditions, the hydrological and climatic conditions, the extent and natureof work and materials necessary for the completion of the Works, the means of accessto the Site and accommodation he may require and, in general, shall be deemed to haveobtained all necessary information, subject as above mentioned, as to risks,contingencies and all other circumstances which may influence or affect his Tender.
12.0 Sufficiency ofTender
The Contract shall be deemed to have satisfied himself before tendering as to thecorrectness and sufficiency of his Tender for the Works and of the rates and pricesstated in the priced Schedule of Quantities and the Schedule of Rates and Prices, if any,which Tender rates and prices shall, except insofar, as it is otherwise provided in theContract, cover all his obligations under the Contract and all matters and thingsnecessary for the proper execution and maintenance of the Works.
13.0 Work to be to the Satisfaction of Engineer
The Contractor shall execute and maintain the Works in strict accordance with theContract to the satisfaction of the Engineer and shall comply with and adhere strictly tothe Engineer’s instructions and directions on any matter whether mentioned in theContract or not, touching or concerning the Works. The Contractor shall takeinstructions and directions only from the Engineer.
14.0 Program to be furnished
The Contractor shall, after the acceptance of his Tender submit to the Engineer for hisapproval a program showing the order of procedure in which he proposes to carry outthe Works. The Contractor shall whenever required by the Engineer, also provide inwriting for his information a general description of the arrangements and methodswhich the Contractor proposes to adopt for the execution of Works.
If at any time it should appear to the Engineer that the actual progress of the Works
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
23
does not conform to the approved program referred to in sub-clause (1) of this Clause,the Contractor shall produce, at the request of the Engineer, a revised program showingthe modifications to the approved program necessary to ensure completion of the Workswithin the time for completion as defined in Clause 43 hereof.
The submission to and approval by the engineer of such programs or thefurnishing of such particulars shall not relieve the contractor of any of hisduties or responsibilities under the contract.
The program shall be reviewed and revised if required at three monthlyintervals and shall include a chart of the principal quantities of work forecastfor execution monthly and a schedule of payments expected to be made to theContractor by the Indore Sahakari Dugdha Sangh Maryadit.,Indore.15. Contractor’s Superintendence
15.1 The Contractor shall give or provide all necessary superintendence during theexecution of the Works and as long thereafter as the Engineer may considernecessary for the proper fulfilling of the Contractor’s obligations under theContract. The Contractor, or a competent and authorized agent or representativeapproved of in writing by the Engineer, which approval may at any time bewithdrawn, is to be constantly on the Works and shall give his whole time tothe superintendence of the same. If such approval shall be withdrawn by theEngineer, the Contractor shall, as soon as is practicable, having regard to therequirement of replacing him as hereinafter mentioned, after receiving writtennotice of such withdrawal, remove the agent from the Works and shall notthereafter employ him on the Works in any capacity and shall replace him byanother agent approved by the Engineer. Such authorized agent orrepresentative shall receive, on behalf of the Contractor, directions andinstructions from the Engineer.
16.0 Contractor’s Employees
The Contractor shall provide and employ on the Site in connection with the executionand maintenance of the Works:-
a) Only such technical assistants as are skilled and experienced in their respective fieldsand sub-agents, foremen and leading hands as are competent to give proper supervisionto the work they are required to supervise, andb) Such skilled, semi-skilled and unskilled labour as is necessary for the proper andtimely execution and maintenance of the Works.
It shall be the liability of the Contractor to remove forthwith from the works anypersonnel engaged by the Contractor, in or about the execution or maintenance of theworks, who, misconducts himself or is incompetent or negligent in the properperformance of his duties or whose engagement is otherwise considered to beundesirable and such person shall not be again engaged upon the work. Any person so
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
24
removed, by the Contractor, from the works shall be replaced, by the Contractor, assoon as possible by competent substitutes.
17.0 Setting-out
The Contractor shall be responsible for the true and proper setting-out of the Works inrelation to original points, lines and levels of reference given by the engineer inwriting and for the correctness, subject as above mentioned of the position, levels,dimensions and alignment of all parts of the Works and for the provision of allnecessary instruments, appliances and labour in connection therewith. If at any time,during the progress of the Works, any error shall appear or arise in the position, levelsdimensions or alignment of any part of the Works, the Contractor, on being requiredso to do by the Engineer shall, at his own cost, rectify such error to the satisfaction ofthe Engineer, unless such error is based on incorrect data supplied in writing by theEngineer in which case the expense of rectifying the same shall be borne by the IndoreSahakari Dugdha Sangh Maryadit.,Indore. The checking of any setting-out or ofany line or level by the Engineer shall not in any way relieve the Contractor of hisresponsibility for the correctness thereof and the Contractor shall carefully protect andpreserve all benchmarks, sight-rails, pegs and other things used in setting-out the Works.
18.0 BoreholesandExploratoryExcavationIf, at any time during the execution of the Works, the Engineer shall require theContractor to make boreholes or to carry out exploratory excavation, suchrequirement shall be ordered in writing and shall be deemed to be an addition orderedunder the provision of Clause 52 hereof, unless a provisional sum in respect of suchanticipated works shall have been included in Schedule of Quantities.
19.0 Watching and Lighting
The Contractor shall in connection with the Works provide and maintain at his own costall lights, guards, fencing and watching when and where necessary or required by theEngineer, for the protection of the Works, or for the safety and convenience of thepublic or others.
20.0 Care ofWorks
From the commencement of the Works until the date stated in the Certificate ofCompletion for the whole of the Works pursuant to Clause 49 hereof the Contractorshall take full responsibility for the care thereof. Provided that if the Engineer shallissue a Certificate of Completion in respect of any part of the Permanent Works theContractor shall cease to be liable for the fare of that part of the permanent Worksfrom the date stated in the Certificate of Completion in respect of that apart and theresponsibility for the care of that part shall pass to the Owner/ Indore Sa hakari Dugdha Sangh Maryadit.,Indore. Provided further that the Contractor shall take the fullresponsibility for the care of any outstanding work, which he shall have undertaken tofinish during the Period of maintenance until such outstanding work is completed. Incase any damage, loss or injury shall happen to the Works, or to any part thereof, fromany cause whatsoever, save and except the excepted risks as defined in clause 20.3,while the Contractor shall be responsible for the care thereof the Contractor shall, at
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
25
his own cost, repair and make good the same, so that at completion the PermanentWorks shall be in good order and condition and in conformity in every respect with therequirements of the Contract and the Engineer’s instructions. In the event of any suchdamage, looks or injury happening form any of the excepted risks, the Contractor shall,if and to the extent required by the Engineer and subject always to the provision ofClause 66 hereof, repair and make good the same as aforesaid at the cost of the IndoreSahakari Dugdha Sangh Maryadit.,Indore. The Contractor shall also be liable forany damage to the Works occasioned by him in the course of any operations carriedout by him for the purpose of completing any outstanding work or complying with hisobligations under Clause 50 or 51 hereof.
The Contractor shall not demolish, remove or alter the structures, trees or other facilitieson the site without the prior approval of the Engineer.
21.0 ExceptedRisks
21.1 The “excepted risks” are war, hostilities (whether war be declared or not),invasion, act of foreign enemies, rebellion, revolution insurrection or military orusurped power, civil war, or unless solely restricted to employees of theContractor or of his sub- Contractors and arising from the conduct of the Works,riot, commotion or disorder, or a cause solely due to the Engineer’s design of theWorks, or ionizing radiations or contaminating by radio-activity from anynuclear fuel or from any nuclear waste from the combustion of nuclear fuel,radio-active toxic explosive, or other hazardous properties of any explosive,nuclear assembly or nuclear component thereof, pressure waves caused byaircraft or other aerial devices traveling at sonic or supersonic speeds, or anysuch operation of the forces of nature as an experienced Contractor could notforesee, or reasonably make provisions for or insure against all or which areherein collectively referred to as “the excepted risks”
21.2 Insurance of Works, etc
Without limiting his obligations and responsibilities under Clause 20 hereof, theContractor shall prior to the commencement of the works insure in the joint names ofthe Indore Sahakari Dugdha Sangh Maryadit.,Indore and the Contractor against allloss or damage form whatever cause arising, other than the excepted risks, for whichhe is responsible under the terms of the Contractor and in such manner that the IndoreSahakari Du gdha Sangh M aryadit.,Indore and the Contractor are covered for theperiod stipulated in Clause 20.1 hereof and are also covered during the Period ofMaintenance for loss or damage arising from a cause, occurring prior to thecommencement of the Period of maintenance, and for any loss or damage occasionedby the Contractor in the course of any operations carried out by him for the purpose ofcomplying with his obligations under Clauses 5 and 51 hereof :-
a) The Works for the time being executed to the estimated current Contractvalue thereof plus 10 percent thereon to allow for any additional costsand professional fees resulting form the loss or damage.
b) The Constructional Plant and other things brought on to the Site by the
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
26
Contractor to the replacement value of such Constructional Plant andother things.
c) It shall be the responsibility of the Contractor to notify the insurer of anychange in nature and extent of the Works and to ensure the adequacyof the insurance cover at all times in accordance with the provisionsof thisClause.
Such insurance shall be affected with an insurer and the Contractor shall,produce to the Engineer/Indore Sahakari Dugdha Sangh M aryadit.,Indorethe policy or polices of insurance and the receipts for payments of the currentpremiums.
22.0 Damage to Persons and Property
20.1 The Contractor shall, except if and so far as the Contract providesotherwise, indemnify the Indore Sahakari Dugdha Sangh Maryadit.,Indoreagainst all losses and claims in respect of injuries or damage to any person ormaterial or physical damage to any property whatsoever which may arise outof or in consequence of the execution and maintenance of the Works andagainst all claims, proceedings, damages, costs, charges and expenseswhatsoever in respect of or in relation thereto except any compensation ordamages for or with respect to : -
a) The permanent use or occupation of land by the Works or any part thereof.
b) The right of the Indore Sahakari Dugdha SanghMaryadit.,Indore to execute theWorks of any part thereof on, over, under, in or through any land.
c) Injuries or damage to persons or property which are the unavoidable result of theexecution or maintenance of the Works in accordance with the Contract.
d) Injuries or damage to persons or property resulting form any act or neglect of theEngineer or other Contractors, not being employed by the Contractor, or for or inrespect of any claims proceedings, damages, costs, charges and expenses in respectthereof or in relation thereto or where the injury or damage was contributed to by theContractor, his servants or agents such part of compensation as may be just andequitable having regard to the extend of the responsibility of the Engineer or otherContractors for the damage or injury.
22.2 The Indore Sah akari Dugdha Sa ngh Maryadit.,Indore shall indemnify theContractor against all claims, proceedings, damages, costs, charges and expenses inrespect of the matters referred to in the proviso to sub-clause (1) of this Clause.
23.0 ThirdParty Insurance
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
27
Before commencing the execution of the Works the Contractor, but without limiting hisobligations and responsibilities under Clause 22 hereof, shall insure against his liabilityfor any material or physical damage, loose or injury which may occur to nay property,including that of the Indore S ahakari Dugdha S angh M aryadit.,Indore, or to anyperson, including any employee of the Indore S ahakari Dugdha Sa nghMaryadit.,Indore, or by arising out of the execution of Works or in the carrying out ofthe Contract, otherwise than due to the matters, referred to in the proviso to Clause 22.1hereof.
Such insurance shall be affected with an insurer for at least the amount stated in theAppendix to the Tender. The Contractor shall, produce to the Engineer / IndoreSahakari Dugdha Sangh Maryadit.,Indore the policy or policies of insurance and thereceipts for payment of the current premiums.
The terms shall include a provision whereby, in the event of any claim in respect ofwhich the Contractor would be entitled to receive indemnity under the policy beingbrought or made against the Indore Sahakari Dugdha Sangh Maryadit.,Indore, theinsurer will indemnity the Indore Sahakari Dugdha Sangh Maryadit.,Indore againstsuch claims and any costs, charges and expenses in respect thereof.
Such insurance shall be for an amount not less than `.2, 00,000/- per occurrence, withthe number of occurrences unlimited.
24.0 Accident or Injury to Workmen
The Indore Sah akari Dugdha Sangh Maryadit.,Indore shall not be liable for or inrespect of any damages or compensation payable at law in respect or in consequence ofany accident or injury to any workman or other person in the employment of theContractor or any sub- Contractor. The Contractor shall indemnify and keepindemnified the Indore Sahakari Dugdha Sangh Maryadit.,Indore against all suchdamages and compensation, save and except as aforesaid, and against all claims,proceedings, costs, charges and expenses whatsoever in respect thereof or in relation
thereto. Where any case is instituted against the Indore S ahakari Dugdha Sangh Maryadit.,Indore, the Contractor shall impale himself as a party as if thecase has been instituted against the Contractor.
The Contractor shall insure against such liability with an insurer and shall continue suchinsurance during the whole of the time that any persons are employed by him on theWorks and shall, produce to the Engineer/ Indore S ahakari Dugdha Sa nghMaryadit.,Indore such policy of insurance and the receipts for the payment of thecurrent premium. Provided always that, in respect of any persons employed by any sub-contractor, the Contractor’s obligation to insure as aforesaid under this sub-clause shallbe satisfied if the sub- Contractor shall have insured against the liability in respect ofsuch persons in such manner that the Indore Sa hakari D ugdha SanghMaryadit.,Indore is indemnified under the policy, but the Contractor to produce to theEngineer/Indore Sahakari Dugdha Sangh Maryadit.,Indore such policy of insuranceand receipt for the payment of the current premium.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
28
24.1 Employee State Insurance (ESI) Act.
The Contractor shall accept full and exclusive liabilities for the compliancewith all obligations imposed by the ESI Act 1948, and the Contractor shallfurther defend, indemnify and hold the Indore Sahakari Dugdha SanghMaryadit.,Indore harmless form any liabilities or penalties which may beimposed by the Central, State or local authorities by reason of any assertedviolation by Contractor or sub- Contractor of the ESI act, 1948 and also fromall claims, suits or proceedings that may be brought against the IndoreSahakari Dugdha Sangh Maryadit.,Indore arising under, growing up or byreason of the work provided for by this Contract whether brought by theemployees of the Contractor, by the third parties, or by Central or State Govt.authorities or any political sub-division thereof. The Contractor shall fill inwith the ESI the declaration form and all other forms which may be required inrespect of the Contractor’s or sub- Contractor’s employees and who areemployed by for the works provided for or those covered by ESI from time totime under the agreement. The Contractor shall deduct and secure theagreement of the sub- Contractor and deduct the employee’s contribution asper the first schedule of the ESI Act from wages and affix the employees’contribution cards at wages payment intervals. The Contractor shall remit andsecure that agreement of the sub- Contractor to remit, the employeescontribution as required by the Act. The Contractor shall maintain all codesand records as required under Act in respect of the employees and paymentand the Contractor shall secure the agreement of the sub Contractor tomaintain such records. Any expense incurred for the contribution ormaintaining records shall be to the Contractor’s account.
The Indore Sahakari Dugdha Sangh Maryadit.,Indore shall retain suchamount as may be necessary from the total contract value until the contractorshall furnish satisfactory proof the whole contribution as required by the ESIact have been paid.
25.0. Remedy on Contractor’s Failure to Insure
If the Contractor shall fail to effect and keep in force the insurances referred toin Clauses 21, 23 and 24 hereof, or any other insurance which he may berequired to effect under the terms of the Contract, then and in any such case theIndore Sa hakari Dugdha Sangh Maryadit.,Indore may effect and keep inforce any such insurance and
pay such premium or premiums as may be necessary for that purpose and formtime to time deduct the amount so paid by the Indore Sahak ari DugdhaSangh Maryadit.,Indore as aforesaid from any payment due or which may
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
29
become due to the Contractor, or recover the same as a debt to the Contractor,or recover the same as a debt due from the Contractor.26.0 Giving of Notices and Payment of Fees
The Contractor shall give all notices and pay all fees required to be given or paidby any National or State Statute, Ordinance, or Law, or any regulation, or bye-law of any local or other duly constituted authority in relation to the executionof the Works and by the rules and regulations of all public bodies andcompanies whose property or rights are affected or may be affected in any wayby the Works.
The Indore S ahakari Dugdha S angh M aryadit.,Indore will repay or allowto the Contractor all such sums as the Engineer/Indore S ahakari D ugdhaSangh Maryadit.,Indore shall certify to have been properly payable and paidby the Contractor in respect of such fees.
The Indore S ahakari Dugdha S angh M aryadit.,Indore will repay of allowto the contractor all such sums as the engineer / Indore Sahakari Dugdha Sangh Maryadit.,Indore shall certify to have been properly payable and paid bythe contractor in respect of such fees.
27.0 Fossiis, etc.
All fossils, coins, articles of value or antiquity and structures and other remainsor things of geological or archaeological interest discovered on the site of theWorks shall as between the Indore Sahakari Dugdha SanghMaryadit.,Indore and the Contractor be deemed to be the absolute property ofthe Indore S ahakari Dugdha Sa ngh Maryadit.,Indore. The Contractorshall take precautions to prevent his workmen or any other persons fromremoving or damaging any such article or thing and shall immediately upondiscovery thereof and, before removal, acquaint the Engineer of such discoveryand carry out the Engineer’s orders as to the disposal of the same.
28.0 Patent Rights and Royalties.
The Contractor shall save harmless and indemnify the Indore Sah akariDugdha Sangh Maryadit.,Indore from and against all claims and proceedingsfor or on account of infringement of any patent rights, design trademark or nameor other protected rights in respect or any Constructional Plant, machine work,or material and for in connection with the Works or any of them and from andagainst all claims, proceedings, damages, costs, charges and expenseswhatsoever in respect thereof or in relation thereto. Except where otherwisespecified , the Contractor shall pay all tonnage and other royalties, rent andother payments or compensation, if any, for getting stone, sand, gravel, clay orother materials required for the Works or any of them.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
30
29.0 Interference with Traffic and Adjoining Properties
All operations necessary for the execution of the Works shall, so far ascompliance with the requirements of the Contact permits, be carried on so asnot to interfere unnecessarily or improperly with the convenience of the public,or the access to, use and occupation of public or private roads and footpathsto or of properties whether in the possession of the Indore Sah akari Du gdhaSangh Maryadit.,Indore or of any other person. The Contractor shall saveharmless and indemnify the Indore Sahakari Dugdha SanghMaryadit.,Indore in respect of all claims, proceedings, damages, costs, chargesand expenses whatsoever arising out of, or in relation to, any such matters in sofar as the Contractor is responsible therefore.
30.0 Extraordinary Traffic
The Contractor shall use reasonable means to prevent any of the highways or bridgescommunicating with or on the routes to the site from being damaged or injured by anytraffic of the Contractor or any of his sub- Contractors and, in particular, shall selectroutes, choose and use vehicles and restrict and distribute loads so that any suchextraordinary traffic as will inevitably arise from the moving of plant and material fromand to the Site shall be limited, as far as reasonably possible, and so that no unnecessarydamage or injury may be occasioned to such highways and bridges.
Should it be found necessary for the Contractor to move one or more loads ofConstructional Plant, machinery or pre-constructed units or parts of units of works overa part of a highway or bridge, the moving where of is likely to damage any highwayorbridge unless special protection or strengthening is carried out, then the Contractor shallbefore moving the load on to such highway or bridge give notice to the concernedauthority of the weight and other particulars of the load to be moved and his proposalsfor protecting or strengthening the said highway or bridge and obtain approval from thatconcerned authority at his own cost. He shall keep the Engineer informed of the actiontaken.
If during the execution of the works or at any time thereafter the Contractor shallreceive any claim arising out of the execution of the Works in respect of damage orinjury to highways or bridges he shall immediately report the same to the Engineer andthereafter shall negotiate the settlement of and pay al sums due in respect of such claimand shall indemnify the Indore Sahakari Dugdha Sangh Maryadit.,Indore in respectthereof, and in respect of all claims, proceedings, damages, costs, charges and expensesin relation thereto.
Where the nature of the Works is such as to require the use by the Contractor of water-borne transport the foregoing provisions of this Clause shall be construed as though“highway” included a lock, dock, sea wall or other structure related to a waterway and“vehicle” included craft, and shall have effect accordingly.31.0 OpportunitiesforotherContractors
The Contractor shall, in accordance with the requirements of the Engineer,afford all reasonable opportunities for carrying out their work to any other
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
31
Contractor employed by the Indore Sahakari Dugdha SanghMaryadit.,Indore/ owner and their workmen and to the workmen of theIndore Sahakari Dugdha Sangh Maryadit.,Indore/ owner and of any otherduly constituted authorities who may be employed in the execution on or nearthe Site of any work not included in the Contract or of any Contract which theIndore Sahakari Dugdha Sangh Maryadit.,Indore may enter into inconnection with or ancillary to the Works. If, however, the Contractor shall, onthe written request of the Engineer, make available to any such otherContractor, or to the Indore S ahakari Dugdha S angh Maryadit.,Indore orany such authority, any roads, or ways for the
maintenance of which the Contractor is responsible, or permit the use by anysuch of the Contractor’s scaffolding or other plant on the Site, or provide anyother service of whatsoever nature for any such, the Indore S ahakariDugdha Sa ngh Maryadit.,Indore shall pay to the Contractor in respect ofsuch use or service such sum or sums as shall, in the opinion of the Engineer, bereasonable.32.0 Contractor to Keep Site Clear
During the progress of the Works the Contractor shall keep the site free fromall unnecessary obstructions and shall store / dispose or shift anyConstructional Plant / surplus materials, debris etc and clear away and removefrom the site any wreckage, rubbish or Temporary Works no longer required.
33.0 Clearance of Site on Completion
On the completion of the Works the Contractor shall clear away and remove form theSite all Constructional Plant, surplus materials, rubbish and Temporary Works of everykind, and leave the whole of the Site and Works clean and in a workmanlike conditionto the satisfaction of the Engineer.
34.0 LabourEngagementofLabour
The Contractor shall make his own arrangements for the engagements of all labour,local or otherwise, and save insofar as the Contractor otherwise provides, for thetransport, housing feeding and payment thereof. The Contractor to the extent possibleand reasonable to employ staff and labour with required qualifications and experiencefrom source within India.
The Indore Sahakari Dugdha Sangh Maryadit.,Indore may at their own discretionand convenience make available at the site, land for Contractor’s field office, godown,workshop and assembly yard required for the execution of the Contract. The Contractorshall at his own cost construct all these temporary buildings and provide suitable watersupply and sanitary arrangement approved by the Engineer.
The personnel so engaged by the Contractor shall be the employees of the Contractorand there shall exist no privacy of Contract between the personnel so engaged and the
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
32
Indore Sahakari Dugdha Sangh Maryadit.,Indore.
On completion of the works undertaken by the Contractor, he shall remove alltemporary buildings erected by him and have the site cleaned as directed by theEngineer. If the Contractor shall fail to comply with these requirements, the Engineermay at the expenses of the Contractor remove such surplus and rubbish materials anddispose off the same as he deems fit and get the site cleared as aforesaid; the Contractorshall forthwith pay the amount of all expenses so incurred and shall have no claim inrespect of any such surplus material disposed off as aforesaid. The owner reserves theright to ask the Contractor any time during the tendency of the Contract to vacate theland by giving 7 days notice without giving any reason.
Land for residential accommodation for staff and labour may be made available at thediscretion of the Indore Sahakari Dugdha Sangh Maryadit.,Indore/ Engineer.The Contractor shall, so far as is reasonably practicable, having regard to localconditions, provide on the Site, to the satisfaction of the Engineer an adequate supply ofdrinking and other water for the use of the Contractor’s staff and work people.
The Contractor shall not, otherwise than n accordance with the Statutes, Ordinances andGovernment Regulations or Orders for the time being in force, import, sell, give barteror otherwise dispose of any alcoholic liquor or drugs or permit any such importation,sale, gift, barter or disposal by his sub-contractors, agents or employees.
The Contractor shall not give, barter or otherwise dispose of to any person or person,any arms or ammunitions of any kind or permit the same as aforesaid.
The Contractor shall in all dealings with labour in his employment have due regard toall recognized festivals, days of rest and religious or other customers.
In the event of any outbreak of illness of an epidemic nature, the Contractor shallcomply with and carry out such regulations, orders and requirements as may be madeby the Government, or the local medical or sanitary authorities for the purpose ofdealing with and overcoming the same.
The Contractor shall at all times take all reasonable precautions to prevent anyunlawful, riotous or disorderly conduct by or amongst his employees and for thepreservation of peace and protection of persons and property in the neighborhood of theWorks against the same. The Contractor shall be responsible to comply with the variouslabour laws such as Contract Labour (R&A) Act, 1970, Obtaining Labour License,Payment of Wages Act, Minimum Wages Act, Provident Fund Act & Rules etc. inrespect of the persons engaged by him.
The Contractor shall be responsible for observance by his sub-contractors of theforegoing provisions.
35.0 Returns of Labour, etc
The Contractor shall submit to the Indore Sahakari Dugdha Sangh Maryadit.,Indorecopies of the license under the Contract Labour Act, if required and obtained by theContractor and his Provident Fund no.. The Contractor shall, if required by theEngineer, also deliver to the Engineer a return in detail in such form and at suchintervals as the Engineer may prescribe showing the supervisory staff and the numbers
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
33
of the several classes of labour from time to time employed by the Contractor on theSite and such information respecting Constructional Plant as the Engineer may require.
The Contractor shall not employ in connection with the works any person who has notcompleted fifteen years of age.
The Contractor shall in respect of labour employed by him comply with or cause to becomplied with the provision of the various labour laws and rules and regulations such asContract Labour Act (R&A) Act, 1970, Payment of Wages Act, Minimum Wages Act,Provident Fund Act & Rules etc. applicable to them in regard to all matters providedtherein and shall indemnify the Indore Sahakari Dugdha Sangh Maryadit.,Indore inrespect of all claims that may be made against the Indore Sahakari Dugdha SanghMaryadit.,Indore for noncompliance thereof by the Contractor.
Notwithstanding anything contained herein, the Engineer may take such actions as maybe necessary for compliance of the various labour laws and recover the costs thereofform the Contractor.
In the event of the Contractor committing a default or breach of any of the provisionsof labour laws and rules and regulations as applicable, shall pay penalties as imposedby the statutory Authorities and shall indemnify and keep indemnified the IndoreSahakari Dugdha Sangh Maryadit.,Indore all such penalties and compensations.
36.0 Materials and Workmanship
MaterialsandWorkmanship
All materials and workmanship shall be of the respective kinds described in theContract and in accordance with the Engineer’s instructions and shall be subjectedfrom time to time to such tests as the Engineer may direct at the place of manufactureor fabrication, or on the Site or at Such other place or places as may be specified in theContract, provide such assistance, instruments, machines, labour and materials as arenormally required for examining, measuring and testing any work and the quality,weight or quantity of any material used and shall supply samples of materials beforeincorporation in the Works for testing as may be selected and required by the Engineer.
All samples shall be supplied by the Contractor at his own cost if the supply thereofis clearly intended by on provided for in the Contract.
The cost of conducting any test ordered by the Engineer to ascertain the quality ofthe materials and the workmanship shall be borne by the Contractor.
37.0 InspectionofOperations
The Engineer and any person authorized by him shall at all times have accessto the Works and to all workshops and places where work is being prepared orfrom where materials manufactured articles or machinery are being obtainedfor the Works and the Contractor shall afford every facility for and everyassistance in or in obtaining the right to suchaccess.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
34
38.0 Examination of Work before Covering up
No work shall be covered up or put out of view without the approval of the Engineerand the Contractor shall afford full opportunity for the Engineer to examineand measure and work which is about to be covered up or put out of view andto examine foundations before permanent work is place thereon. TheContractor shall give due notice to the Engineer whenever such work orfoundations is or are read or about to be ready for examination and theEngineer shall unless he considers it unnecessary and advises the Contractoraccordingly, attend for the purpose of examining and measuring such work orof examining such foundations.
The Contractor shall uncover any part or parts of the Work or make opening inor through the same as the Engineer may from time to time direct and shallreinstate and make good such part or parts to the satisfaction of the Engineer. Ifany such part or parts have been put out of view after compliance with therequirement clause 38.1 and are found to be executed in accordance with theContract, the expenses of uncovering, making openings in or through,reinstating and making good the same shall be borne by the Indore SahakariDugdha Sangh Maryadit.,Indore, but in any other case all costs shall be borneby the Contractor.
39.0 Removal of Improper Work and Materials
The Engineer shall during the progress of the Works have power to order in writingfrom time to time.a) The removal from the Site, within such time or times as may be specified in theorder, of any materials, which, in the opinion of the Engineer, are not in accordancewith the Contract.
b) The substitution of proper and suitable materials and
c) The removal and proper re-execution, notwithstanding any previous test thereof orinterim payment there for, of any work which in respect of materials or workmanship isnot, in the opinion of the Engineer, in accordance with the Contract.In case of default on the part of the Contractor in carrying out such order, theIndore Sahakari Dugdha Sangh Maryadit.,Indore shall be entitled toemploy and pay other persons to carry out the same and all expensesconsequent thereon or incidental thereto shall be recoverable from theContractor by the Indore Sah akari Du gdha Sang h Maryadit.,Indore ormay be deducted by the Indore Sa hakari Dugdha Sangh Maryadit.,Indorefrom any payment due or which may become due to the Contractor.
40.0 Suspension ofWork
The Contractor shall, on the written order of the Engineer, suspend the progress of theWorks or any part thereof for such time or times and in such manner as the Engineermay consider necessary and shall during such suspension properly protect and securethe work, so far as is necessary in the opinion of the Engineer. The extra cost incurredby the Contractor in giving effect to the Engineer’s instructions under this Clause shall
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
35
be borne and paid by the Indore Sahakari D ugdha Sangh M aryadit.,Indoreunlesssuch suspension is:
a) Otherwise provided for in the Contract, or
b) Necessary by reasons of some default on the part of the Contractor, or
c) Necessary by reasons climatic conditions on the Site, or
d) Necessary for the proper execution of the Work or for the safety or the Works or anypart thereof insofar as such necessity does not arise from any act or default by theEngineer or the Indore Sahakari Dugdha Sangh Maryadit.,Indore or from any or theexcepted risks defined in Clause 20 hereof.
Provided that the Contractor shall not be entitled to recover any such extra costunless the give written notice of his intention to claim to the Engineer withinfifteen days of the Engineer’s order. The Engineer shall settle and determinesuch extra payment and/or extension of time under Clause 44 hereof to bemade to the Contractor in respect of such claim as shall, in the opinion of theEngineer, be fair and reasonable.
If the progress of the Works or any part thereof is suspended on the written order of theEngineer and if permission to resume work is not given by the Engineer within a periodof ninety days from the date of suspension then, unless such suspension is within
paragraph (a), (b), (c), or (d) of sub-clause (1) of this Clause, the Contractor mayserve a written notice on the Engineer requiring permission within twenty-eight days from the receipt thereof to proceed with the works, or that partthereof in regard to which progress is suspended and, if such permission is notgranted within the time, the Contractor by a further written notice so servedmay, but is bound to, elect or treat the suspension where it affects only part ofthe Works as an omission of such part under Clause 52 hereof, or, where itaffects the whole Works, as an abandonment of the Contract by the IndoreSahakari Dugdha Sangh Maryadit.,Indore.
41.0 Commencement Time and Delays
Commencement of Works
The Contractor shall commence the Works on Site within the period named in theAppendix to the Tender after the receipt by him of a written order to this effect from theEngineer and shall proceed with the same with due expedition and without delay, exceptas may be expressly sanctioned or ordered by the Engineer, or be wholly beyond theContractor’s control.
42.0 Possession of Site
Save insofar as the Contact may prescribe, the extent or portions of the Site of whichthe Contractor is to be given possession form time to time and the order in which suchportions shall be made available to him and, subject to any requirement in the Contact
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
36
as to the order in which the Works shall be executed, the Indore Sahakari DugdhaSangh Maryadit.,I ndore will, with the Engineer’s written order to commence theWorks, give to the Contractor possession of so much of the Site as may be required toenable the Contractor to commence and proceed with the execution of the Works inaccordance with the program referred to in Clause 14 hereof, if any and otherwise inaccordance with such reasonable proposals of the Contractor as he shall, by writtennotice to the Engineer, make and will, from time to time as the Work proceed, give tothe Contractor possession of such further portions of the Site as may be required toenable the Contractor to proceed with the execution of the Works with due dispatch inaccordance with the said programmers or proposals, as the case may be. If theContractor suffers delay from the failure on the part of the Indore Sahakari DugdhaSangh M aryadit.,Indore to give possession in accordance with the terms of the isClause, the Engineer shall grant an extension of time for the completion of the Worksas, in his opinion shall be fair and the price escalation pursuant to clause 71.0 hereof,provided the extended time period including the original contract period exceeds 09Months.
The Contractor shall bear all costs and charges for special or temporary way leavesrequired by him in connection with access to the Site. The Contractor shall also provideat his own cost any additional accommodation outside the Site required by him for thepurposes of the Works.
43.0 Time for Completion
Subject to any requirement in the Contract as to completion of any section of the Worksbefore completion of the whole, the whole of the Works shall be completed, inaccordance with the provisions of Clause 49 hereof, within the time stated in theContract or such extended time as may be allowed under Clause 44 hereof.
44.0 Extension of Time of Completion
Should the amount of extra or additional work of any kind or any cause of delayreferred to in these Conditions, or exceptional adverse climatic conditions, or otherspecial circumstances of any kind whatsoever which may occur, other than through adefault of the Contractor, be such as fairly to entitle the Contractor to an extension oftime for the completion of the works, the Engineer shall determine the amount of suchextension and shall notify the Indore Sahakari Dugdha Sangh Maryadit.,Indore andthe Contractor accordingly. Provided that the Engineer is not bound to take in accountany extra or additional work or other special circumstances unless the Contractor haswithin thirty days after such work has been commenced, or such circumstances havearisen, or as soon thereafter as is practicable, submitted to the Engineer full and detailedparticulars of any extension of time to which he may consider himself entitled in orderthat submission may be investigated at the time.
45.0 No NightWork
Subject to any provision to the contrary contained in the Contract, none of thePermanent Works shall, save as hereinafter provided, be carried on during the nightwithout the permission in writing of the Engineer except when the work is unavoidableor absolutely necessary for the saving of life or property or for the safety of the Works,in which case the Contractor shall immediately advise the Engineer. Provided always
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
37
that the provisions of this Clause shall not be applicable in the case of any work, whichit is customary to carry out by rotary or double shifts.
46.0 Rate ofProgress
If for any reason, which does not entitle the Contractor to an extension of time, the rateof progress of Works or any section is at any time, in the opinion of the Engineer, tooslow to ensure completion by there prescribed time or extended time for completion, theEngineer shall so notify the Contractor in writing and the Contractor shall thereupontake such steps as are necessary and the Engineer may approve to expedite progress soas to complete the Works or such section by the prescribed time or extended tie. TheContractor shall not be entitled to any additional payment for taking such steps. If, as aresult of any notice given by the Engineer under this Clause, the Contractor shall seekthe Engineer’s permission to do any work at night, such permission shall not beunreasonably refused.
47.0 Liquidated Damages for Delay
If the Contractor shall fail to achieve completion of the Works within the timeprescribed in the Appendix to the Form of Bid, then the Contractor shall pay to theIndore Sahakari Dugdha Sangh Maryadit.,Indore the sum at the rate of 0.50 % ofthe Contract value as liquidated damages for such default and not as a penalty for everyweek or part of the week which shall elapse between the time prescribed by Clause 43hereof and the date of certified completion of the particular Works. The IndoreSahakari Dugdha S angh M aryadit.,Indore may without prejudice to any othermethod of recovery, deduct the amount of such damages from any payment in its hands,due or which may become due to the Contractor. The payment or deduction of suchdamages shall not relieve the Contractor from his obligation to complete the works, orform any other of his obligations and liabilities under the Contract.
The aggregate maximum of the liquidated damages payable to the Indore Sa hakariDugdha Sangh Maryadit.,Indore under this clause shall be subject to a maximum of10% of the Contract value.
If, before the completion of the whole of the Works any part or section of the Works hasbeen certified by the Engineer as completed, pursuant to Clause 49 hereof, and occupiedby the Indore Sahakari Dugdha Sangh Maryadit.,Indore, the liquidated damages fordelay shall, for any period of delay after such certificate be reduced in the proportionwhich the value of the part or section so certified bears to the value of the whole of theWorks.
The criteria for deriving the liquidated damage shall be the actual value of worksexecuted and the amended time of completion.
48.0 NA
49.0 Certification of Completion of Works
When the whole of the Works have been virtually completed and have satisfactorilypassed any final test that may be prescribed by the Contract, the Contractor may give anotice to that effect to the Engineer accompanied by an undertaking to finish anyoutstanding work during the period of Maintenance. Such notice and undertaking shallbe in writing and shall be deemed to be a request by the Contractor for the Engineer to
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
38
issue a Certificate of Completion in respect of the Works. The engineer shall, on receiptof such notice either issue to the Contractor, with a copy to the Indore S ahakariDugdha S angh Maryadit.,Indore, a Certificate of Completion stating the date onwhich, in his opinion, the Works were virtually completed in accordance with theContract or give instructions in writing to the Contractor specifying all the work which,in the engineer’s opinion, requires to be done by the Contractor before the issue of suchCertificate. The engineer shall also notify the Contractor of any defects in the Worksaffecting virtual completion that may appear after such instructions and beforecompletion of the works specified therein. The Contractor shall be entitled to receivesuch Certificate of Completion, or on the completion, to the satisfaction of the Engineer,of the works so specified and making good any defects so notified.
Similarly, in accordance with the procedure set out in sub clause (1) of this Clause, theContractor may request and the Engineer shall issue a Certificate of Completion inrespect of: -a) Any section of the Permanent Works in respect of which a separate time forcompletion is provided in the Contract and
b) Any substantial part of the permanent Works, which has been both, completed to thesatisfaction of the Engineer and occupied by the Indore Sahak ari Dug dha SanghMaryadit.,Indore/ owner.
If any part of the permanent Works shall have been virtually completed andshall have satisfactorily passed any final test that may be prescribed by theContract, the Engineer may issue a Certificate of Completion in respect of thatpart of the Permanent Works before completion of the whole of the Works and,upon the issue of such Certificate, the Contractor shall be deemed to haveundertaken to complete any outstanding work in that part of the Works duringthe Period of Maintenance.
Provided always that a Certificate of Completion given in respect of any sectionor part of the Permanent Works before completion of the whole shall not bedeemed to certify completion of any ground or surfaces requiringreinstatement, unless such Certificate shall expressly so state.
Maintenance and Defects. (Defect Liability)
50 Definition of Period of Maintenance
In these Conditions the expression “Period of Maintenance” shall mean the period ofmaintenance name in the Appendix to the Tender, calculated from date of thecompletion of the Works, certified by the Engineer in accordance with Clause 49hereof, or, in the event of more than one certificate having been issued by the Engineerunder the said Clause, from the respective dates so certified and in relation to the Periodof Maintenance the expression “the Works” shall be construed accordingly.
To the intent that the Works shall at or as soon as practicable after the expiry ofPeriodof Maintenance be delivered to the Indore Sa hakari Du gdha SanghMaryadit.,Indore in the condition required by the Contract, fair wear and tearexcepted, to the satisfaction of the Engineer, the Contractor shall finish the work, if any,
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
39
outstanding at the date of completion, as certified under the clause 49 hereof, as soon aspracticable after which date and shall execute all such work of repair, amendment,reconstruction, rectification and making good defects, imperfections, shrinkages orother faults as may be required of the Contractor in writing by the Engineer during thePeriod of Maintenance, or within fifteen days after its expiry as a result of an inspectionmade by or on behalf of the Engineer prior to its expiry.
All such work shall be carried out by the Contractor at his own expense if the necessitythereof shall, in the opinion of the Engineer, be due to the use of materials orworkmanship not in accordance with the Contract, or to neglect or failure on the part ofthe Contractor to comply with any obligation, expressed or implied, on the Contractor‘spart under the Contract.
If the Contractor shall fail to do any such work as aforesaid required by the Engineer,the Indore Sahakari Dugdha Sangh Maryadit.,Indore shall be entitled to employ andpay other persons to carry out the same and if such work is work which in the opinionof the Engineer, the Contractor was liable to do at his own expense under the Contract,then all expenses consequent thereon or incidental thereto shall be recoverable from theContractor by the Indore Sah akari Du gdha Sangh M aryadit.,Indore or may bededucted by the Indore Sahak ari Dug dha S angh M aryadit.,Indore from anypayment due or which may become due to the Contractor.
51.0 Contractor to Search
The Contractor shall, if required by the Engineer in writing, search under the directionof the Engineer for the cause of any defect, imperfection or fault appearing during theprogress of the Works or in the Period of Maintenance. Unless such defect,imperfection or fault shall be one for which the Contractor is liable under the Contract,the cost of the work carried out by the Contractor in searching as aforesaid shall beborne by the Indore Sahakari Dug dha Sa ngh M aryadit.,Indore. If such defect,imperfection or fault shall be one for which the Contractor is liable as aforesaid, thecost of the work carried out in searching as aforesaid shall be borne by the Contractorand he shall in such case repair, rectify and make good such defect, imperfection orfault at his own expense in accordance with the provisions of Clause 50 hereof.
Alterations, Additions and Omissions
52 Variations
The Engineer shall make any variations of the form quality or quantity of the Works orany part thereof that may, in his opinion, be necessary and for that purpose, or if for anyother reason it shall, in his opinion be desirable, he shall have power to order theContractor to do any of the following: -
a) Increase or decrease the quantity of any work included in the Contract,
b) Omit any such work,
c) Change the Character or quality or kind of any such work,
d) Change the levels, lines, position and dimensions of any part of the Works, and
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
40
e) Execute additional work of any kind necessary for the completion of the Works,
f) Change any specified sequence, method or timing of construction of any part of theworks,
And no such variation shall in any way vitiate or invalidates the Contract, butthe value, if any, of all such variations shall be taken into account inascertaining the amount of the Contract Price. No extra payment other thenquoted rates shall be applicable for variation in quantities as per site conditionand project requirement.
No such variations shall be made by the Contractor without an order in writing of theEngineer. Provided that no order in writing shall be required for increase or decrease inthe quantity of any work where such increase or decrease is not the result of an ordergiven under this Clause, but is the result of the quantities exceeding or being less thanthose stated in the Schedule of Quantities. Provided also that if for any reason theEngineer shall consider it desirable to give any such order verbally, the Contractor shallcomply with such order and any confirmation in writing of such verbal order given bythe Engineer, whether before or after the carrying out of the order, shall be deemed tobe an order in writing within the meaning of this clause. Provided further that if theContractor shall within seven days confirm in writing to the Engineer and the Engineershall not contradict such confirmation in writing within fourteen days, it shall bedeemed to be an order in writing by the Engineer.
Quantity mention in tender based on estimate, it may vary on either side up to anyextent as per site situation / to full fill project requirements. For that no extra paymentother than quoted rate shall be applicable for variation in quantities.
53.0 Valuation of Extra items ( Items not covered in the tender but
executed by Contractor as per MDG’s instruction.
All extra or additional items of work done or items of work omitted in the order, theEngineer shall be valued at the rates and prices set out in the Contract if, in the opinionof the Engineer, the same shall be applicable. If the Contract does not contain any ratesor prices applicable to the extra or additional work, then suitable rates or prices shall beagreed upon between the Engineer and the Contractor. In the event of disagreement theEngineer shall fix such rates or prices as shall, in his opinion, be reasonable and properbased on the rate analysis duly submitted by the contractor and scrutinized by theMDG’s Engineer In charge. The basis shall be cost of material + Labour +Transportation, loading, unloading etc. at actual + 15 % Over Heads & Profits of thecontractor. Taxes shall be extra at actual.
Provided that if the nature or amount of any omission or addition relative to the natureor amount of the whole of the works or to any part thereof shall be such that, in theopinion of the Engineer, the rate or price contained in the Contract for any item of theWorks is, by reason of such omission or addition, rendered inapplicable, then a suitable
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
41
rate or price shall be agreed upon between the Engineer and the Contractor. In case ofdisagreement the Engineer shall work out and fix the rate or the price.
In case of any class of work for which there is not such specification supplied by theOwner/Indore S ahakari Dugdha S angh Maryadit.,Indore as is mentioned inaccordance with Indian Standard Specifications and if the I.S.S. do not cover the samethe work should be carried out as per the standard Engineering practice subject to theapproval of the Engineer.
Provided also that no increase or decrease under clause 53.1 or variation of rateor price under clause 53.2 of shall be made unless, as soon after the date of theorder as is practicable and, in the case of extra or additional work, before thecommencement of the work or as soon thereafter as is practicable, notice shallhave been given in writing:-
a) By the Contractor to the Engineer of his intention to claim extra payment or a variedrate or priceor
b) By the Engineer to the Contractor of his intention to vary a rate or price.
If, on certified completion of the whole of the works it shall be found that a reduction orincrease greater than 25 per cent of the sum named in the Letter of Acceptance, resultsfrom: -
a) The aggregate effect of all Variation Orders, and
b) All adjustments upon measurement of the estimated quantities set out in the Scheduleof Quantities, excluding the adjustments of price made under Clause 71.1 hereof,
but not from any other cause, the amount of the Contract Price shall be adjustedby such sum as may be agreed between the Contractor and the Engineer or,failing agreement, fixed by the Engineer having regard to all material andrelevant factors, including the Contractor’s site and general overhead cost of theContract.
The Contractor shall send to the Engineer once in every month an account givingparticulars, as full and detailed as possible, of all claims for any additional payment towhich the Contractor may consider himself entitled and of all extra or additional workordered by the Engineer which he has executed during the preceding month.
No final or interim claim for payment for any such work or expense will beconsidered which has not been included in such particulars. Provided alwaysthat the Engineer shall be entitled to authorize payment to be made for anysuch work or expense, notwithstanding the Contractor’s failure to comply withthis condition, if the Contractor has, at the earliest practicable opportunity,notified the Engineer in writing that he intends to make a claim for such work.
54.0 Plant, Temporary Works and Materials
Plant, etc. Exclusive Use for the Works
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
42
All Constructional Plant, Temporary Works and materials provided by the Contractorshall, when brought on to the Site, be deemed to be exclusively intended for theexecution of the Works and the Contractor shall not remove the same or any partthereof, except for the purpose of moving it from one part of the site to another, withoutthe consent, in writing, of the Engineer, which shall not be unreasonably withheld.
Upon completion of the Works the Contractor shall remove from the Site allthe said Constructional Plant and Temporary Works remaining thereon andany unused materials provided by the Contractor.
The Indore Sahakari Dugdha Sangh Maryadit.,Indore shall not at any timebe liable for the loss of or damage to any of the said Constructional Plant,Temporary Works or materials save as mentioned in Clauses 20 and 66 hereof.
55.0 Approval of Materials, etc., not implied
The Operation of Clause 54 hereof shall not be deemed to imply any approval by theEngineer of the materials or other matters referred to therein nor shall it prevent therejection of any such materials at any time by the Engineer.
56.0 MeasurementQuantities
The quantities set out in the Schedule of Quantities are the estimated quantities of thework, but they are not to be taken as the actual and exact quantities of the Works to beexecuted by the Contractor in fulfillment of his obligations under the Contract.
57.0 Works to be measured
The Engineer shall, except as otherwise stated, ascertain and determine by measurementthe value in terms of the Contract of work done in accordance with the Contract. Heshall, when he requires any part or parts of the Works to be measured, give notice to theContractor’s authorized agent or representative, who shall forthwith attend or send aqualified agent to assist the Engineer in making such measurement, and shall furnish allparticulars required by either of them. Should the Contractor not attend, or neglect oromit to send such agent, then the measurement made by the Engineer or approved by
him shall be taken to be the correct measurement of the work. For the purposeof measuring such permanent work as is to be measured by records anddrawings, the Engineer shall prepare records and drawings month by month ofsuch work and the Contractor, as and when called upon to do so in writing,shall, within fourteen days, attend to examine and agree such records anddrawings with the Engineer and shall sign the same when so agreed. If theContractor does not so attend to examine and agree to such records anddrawings, they shall be taken to be correct. If, after examination of suchrecords and drawings, the Contractor does not agree to the same or does notsign the same ass agreed, they shall nevertheless be fourteen days of suchexamination, lodge with the Engineer, for decision by the Engineer, notice inwriting of the respects in which such records and drawings are claimed by himto be incorrect.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
43
58.0 Method ofMeasurement
The Works shall be measured net, as prescribed in the specification of works,notwithstanding any general or local custom, except where otherwise specificallydescribed or prescribed in the Contract. Wherever not specifically mentioned in theContract, the mode of measurement as prescribed in the relevant IS codes shall beapplicable and binding to the Contract. A list of ISS code of practices, which shall bereferred to in that event, is attached as annex to the Section IV of TechnicalSpecifications. Only the latest editions of all the codes of practices including all latestofficial amendments and revisions shall be applicable.
For measurement of items of work in foundation and plinth & in super structure thecriteria shall be the plinth level of the individual buildings covered under this Contract.
59.0 Nominated Sub-Contractor.
Definitions of “Nominated Sub-Contractors”
All specialists, merchants, tradesmen and others executing any work or supplying anygoods, materials or services, who may have been or be nominated or selected orapproved by the Indore Sahakari Dugdha Sangh Maryadit.,Indore or the Engineer,and all persons to whom by virtue of the provisions of the Contract the Contractor isrequired to sub-let any work shall, in the execution of such work or the supply of suchgoods, materials or services, be deemed to be sub- Contractors employed by theContractor and are referred to in this contract as “nominated Sub- Contractors”.
The Contractor shall not be required by the Indore S ahakari Dugdha Sa nghMaryadit.,Indore or the Engineer or be deemed to be under any obligation to employany nominated Sub- Contractor against whom the Contractor may raise reasonableobjection, or who shall decline to enter into a sub-contract with the Contractorcontaining provisions : -
a) That in respect of the work, goods, materials or services the subject of the sub-contract, the nominated Sub- Contractor will undertake towards the Contractor the likeobligations and liabilities as are imposed on the Contractor towards the IndoreSahakari Dugdha Sangh Maryadit.,Indore by the terms of the Contract and will saveharmless and indemnify the Contractor from and against the same and from all claims,proceedings, damages, costs, charges and expenses whatsoever arising out of or inconnection therewith, or arising out of or in connection with any failure to performsuch obligations or to fulfill such liabilities, and
b) That the nominated Sub- Contractor will save harmless and indemnify the Contractorfrom and against any negligence by the nominated Sub- Contractor, his agents,workmen and servants and from and against any misuse by him or them of anyConstructional Plant or Temporary Works provided by the Contractor for the purposesof the Contractor and from all claims as aforesaid.
If in any connection with any Provisional Sum the services to be provided include anymatter of design or specification of any part of the permanent works or of anyequipment or plant to be incorporated therein, such requirement shall be expressly
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
44
stated in the Contract and shall be included in any nominated Sub-Contract. Thenominated Sub-Contract shall specify that the nominated Sub- Contractor providingsuch services will save harmless and indemnify the Contractor from and against thesame and from all claims, proceedings, damages, costs, charges and expenseswhatsoever arising out of or in connection with any failure to perform such obligationsor to fulfill such liabilities.
For all work executed or goods, materials, or services supplied by any nominated Sub-Contractor, there shall be included in the Contract Price : -
a) The actual price paid or due to be paid by the Contractor, on the direction of theEngineer, and in accordance with the4 Sub-Contract;
b) The sum, if any, entered in the Schedule of Quantities for labour supplied by theContractor in connection therewith, or if ordered by the Engineer as my bedetermined in accordance with Clause 53 hereof;
c) In respect of all other charges and profit, a sum being a percentage rate of theactual price paid or due to be paid calculated, where provision for such is made in aspecial item provided in the Schedule of Quantities for such purpose.
Before issuing, under Clause 60 hereof, any certificate, which includes any payment inrespect of work done or goods, materials, or services supplied by any nominated Sub-Contractor, the Engineer shall be entitled to demand from the Contractor reasonable thatall payments, less retentions, included in previous certificates in respect of the work orgoods, materials or services of such nominated Sub-Contractor have been paid ordischarged by the Contractor, in default whereof unless the Contractor shall
a) Inform the Engineer in writing that he has reasonable cause for withholding orrefusing to make such payments and
b) Produce to the Engineer reasonable proof that he has so informed such nominatedsub- contractor in writing,
The Indore S ahakari Dugdha S angh M aryadit.,Indore shall be entitled topay to such nominated sub- contractor direct, upon the certificate of theEngineer, all payments, less retentions, provided for in the sub-contact, whichthe Contractor has failed to make to such nominated sub- contractor and todeduct by way of set-off the amount so paid by the Indore Sahakari DugdhaSangh Maryadit.,Indore from any sums due or which may become due fromthe Indore Sa hakari Dug dha Sangh Maryadit.,Indore the Contractor.Provided always that, where the Engineer has
certified and the Indore Sahakari Dugdha Sangh Maryadit.,Indore has paiddirect as aforesaid, the Engineer shall in issuing any further certificate in favourof the Contractor deduct from the amount thereof the amount so paid, direct asaforesaid, but shall not withhold or delay the issue of the certificate itself whendue to be issued under the terms of theContract.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
45
In the event of a nominated sub-contractor, as hereinbefore defined, having undertakentowards the Contractor in respect of the work executed, or the goods, materials or servicessupplied by such nominated sub-contractor, any continuing obligation extending for aperiod exceeding that of the Period of Maintenance under the Contract, the Contractor shallat any time, after the expiry of the Period of Maintenance, assign to the Indore SahakariDugdha Sangh Maryadit.,Indore, at its request and cost, the benefit of such obligation forthe unexpired duration thereof.
Certificates and Payments
60.0 Interim Payment Certificate
(a) The Contractor shall submit a bill or shall submit measurement of works executedfor the preparation of the bill on computer of Indore S ahakari Dugdha SanghMaryadit.,Indore for interim payment in 3 copies to the Engineer on a specified date ineach month in a form approved by the Engineer. The bill for interim payment shallinclude the following items, as applicable, which shall be taken in to account in thesequence listed:-
The estimated Contract value of the Permanent Works executed since the submission of the last bill,obtained by applying the base unit rates and prices in the Schedule of Quantities measured by theEngineer pursuant to clause 57.
The estimated Contract value of the Permanent Works as obtained above executed up to the previousbill.
The cumulative estimated Contract value at base unit rates and prices of the Permanent Works upto the bill in question.
The cumulative amounts approved in respect of extra items executed up to the bill in question,obtained by applying the rates approved.
An amount reflecting any changes in cost pursuant to clause 71
hereo ; Any amount to be withheld under the retention provisions
clause 60.3;
Any credit or debit for the period in question in respect of
materials on site intended for, but not yet incorporated in, the
Permanent Works in the amount and under the conditions set
forth in clause 60.2;
Any other sum to which the Contractor may be entitled under the Contract.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
46
Deductions of Income tax shall be made on the gross amount of each bill as per the provision ofthe Income tax Act.
Any amount to be deducted on account of water charges and power supply, if any, pursuant to clause5.40 & 6.20 of Section III, Special Conditions of Contract.
Any amount to be deducted on account of materials issued to the Contractor pursuant to clause 7.1of section III, Special Conditions and Contract.
b) Within 15 days of the receipt of the said bill for interim payment, it shall be approved oramended such that, in the Engineer’s opinion, the certificate reflects the amount due tothe Contractor in accordance with the Contract. In cases where there is difference ofopinion as to the value of any item, the Engineer’s view shall prevail.
The Contractor shall be entitled to such sum as the Engineer may consider proper inrespect of materials intended for but not yet incorporated in the Permanent Worksprovided that:-
a) The materials are in accordance with the specification for the Permanent Works;
b) Such materials have been delivered to the site, and are properly stored andprotected against loss or damage or deterioration to the satisfaction of the Engineer;
c) The Contractor’s records of the requirements, orders, receipts and the use ofmaterials are kept in a form approved by the Engineer and such records shall beavailable for inspection by the Engineer;
d) The Contractor shall submit with his monthly statement the estimated value of thematerials on site together with such documents as may be required by the Engineer forthe purpose of the valuation of materials and providing evidence of ownership andpayment therefore;
e) The ownership of such materials shall be deemed to vest in the Indore SahakariDugdhaSangh Maryadit.,Indore;and
f) The sum payable for such materials on site shall not exceed 75% of the relatedexfactory / exwarehouse / exquarry price of the building materials, which shall in anycase not be more than the materials, which shall in any case not be more than thematerial component of the base unit rates in the Schedule of Quantities.
Retention Money
a) A retention amounting to 5.0 % of the amount included in any monthly interimpayment certificate pursuant to clause 60.1 due to the Contractor on account of thepermanent Works executed by him shall be made by the Engineer in the first andfollowing certificates until last bill.
b) If the Contractor so requests, the Indore Sahak ari Dugdha SanghMaryadit.,Indore may pay the cumulative amount of retention money to theContractor upon lodgment with the Indore Sa hakari D ugdha S anghMaryadit.,Indore of a Bank guarantee issued by a Nationalized Indian Ban k.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
47
. The acceptable form of Bank guarantee shall be strictly as per Performa P.1given in Section VII of the bidding document.
d) Such accumulated retention money shall be paid to the contractor after successfulcompletion of defect liability period. Provided always that, if at such time there shallremain to be executed by the Contractor any works ordered during such period pursuantto clause 50 and 51 hereof, the Indore S ahakari Dugdha Sa ngh M aryadit.,Indoreshall be entitled to withhold payment until the completion of such works of so much ofthe balance of the retention money as shall, in the opinion of the engineer, represent thecost of the works so remaining to be executed; and
e) No interest shall be paid by the Indore Sahakari Dugdha Sangh Maryadit.,Indoreto the Contractor for the amount withheld as Retention Money with the IndoreSahakariDugdhaSanghMaryadit.,Indore.
The Engineer may by any Interim Payment Certificate make any corrections ormodifications in any previous bills (other than one purporting to be a Final paymentcertificate) which shall have been issued by him and shall have power to modify orwithhold any Interim Payment Certificate if the works or any part thereof are not beingcarried out to his satisfaction.
61.0 Approval only byMaintenance Certificate
No Certificate other than the Maintenance Certificate referred to in Clause 62 hereofshall be deemed to constitute approval of the Works.
62.0 Maintenance Certificate
The Contract shall not be considered as completed until Maintenance Certificate shallhave been signed by the Engineer and delivered to the Indore S ahakari Dug dhaSangh Maryadit.,Indorestating that the Works have been completed and maintained tohis satisfaction. The Maintenance Certificate shall be given by the engineer after theexpiry of the Period of Maintenance, or, if different periods of maintenance shallbecome applicable to different sections or parts of the Works, the expiry of the latestsuch period, or as soon thereafter as any works ordered during such period, pursuant toClause 50 and 51 hereof, shall have been completed to the satisfaction of the Engineerand full effect shall be given to his Clause, notwithstanding any previous entry on theWorks or the taking possession, working or using thereof or any part thereof by theIndore Sahakari Dugdha Sangh Maryadit.,Indore.
The Indore S ahakari Dugdha Sa ngh Maryadit.,Indore shall not be liable to theContractor for any matter or thing arising out of or in connection with the Contract orthe execution of the works, unless the Contractor shall have made a claim in writing inrespect thereof before the issuance of the Maintenance Certificate under this Clause.
Notwithstanding the issue of the Maintenance Certificate the Contractor and, subject toclause 62.2, the Indore Sahakari Dugdha Sangh Maryadit.,Indore shall remain liablefor the fulfillment of any obligation incurred under the provisions of the Contract priorto the issue of the Maintenance Certificate which remains unperformed at the time suchCertificate is issued and, for the purposes of determining the nature and extent of anysuch obligation, the Contract shall be deemed to remain in force between the partieshereto.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
48
63.0 Remedies and Power
Default ofContractor
If the Contractor shall become bankrupt, or have a receiving order made against him orshall present his petition in execution levied on his goods, or it the Engineer shall certifyin writing to the Indore Sahakari Dugdha Sa ngh Maryadit.,Indore that in hisopinion the Contractor: -
a) Has abandoned the Contract, or
b) Without reasonable excuse has failed to commence the works or has suspended theprogress of the works for 28 days after receiving from the Engineer written notice toproceed, or
c) Has failed to remove materials from the site or pull down and replace work for 30days after receiving from the Engineer written notice that the said materials or work hadbeen condemned and rejected by the Engineer under these conditions, or
d) Despite previous warnings by the Engineer, in writing, is not executing the works inaccordance with the Contract, or is persistently neglecting to carry out his obligationsunder the Contract, or
e) Has, to the detriment of good workmanship, or in defiance of the Engineer’sinstructions of the Engineer’s instructions to the contrary, sub-let any part of theContract.
Then the Indore Sahakari Du gdha Sa ngh M aryadit.,Indore may, aftergiving 15 day’s notice in writing to the Contractor, enter upon the site and theworks and expel the Contractor there from and without thereby voiding theContract, or releasing the Contractor from any of his obligations or liabilitiesunder the Contact, or affecting the rights and powers conferred on the IndoreSa hakari Du gdha Sangh Maryadit.,Indore or the Engineer by the Contract,and may himself complete the works or may employ and other Contractor tocomplete the works. The Indore Sahakari Dugdha Sangh Maryadit.,Indoreor such other Contractor to complete the works. The Indore S ahakari Dugdha S angh M aryadit.,Indore or such other Contractor may use for suchcompletion so much of the constructional plant, temporary works and materials,which have deemed to be reserved exclusively for the execution of the works,under the provisions of the Contract, as he or they may think proper, and theIndore Sahakari Dugdha Sangh Maryadit.,Indore may at any time, sell anyof the said Constructional Plant, temporary works and unused materialsincluding invocation of bank guarantees and apply the proceeds of sale in ortowards the satisfaction of any sum(s) due or which may become due to himfrom the Contractor under the Contract.
The Engineer shall, as soon as may be practicable after any such entry and expulsion bythe Indore Sahakari Dugdha Sangh Maryadit.,Indore, fix and determine ex-party,or by or after reference to the parties, or after such investigation or enquiries as he maythink fit to make o r institute, and shall certify what amount, if any, had at the time ofsuch entry and expulsion been reasonably earned by or would reasonably accrue to the
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
49
Contractor in respect of work then actually done by him under the Contract and thevalue of any of the said unused or partially used materials, any Constructional Plant andany temporary works.
If the Indore S ahakari Dugdha S angh M aryadit.,Indore shall enter and expel theContractor under this clause, it shall not be liable to pay to the Contractor any money onaccount of the Contract until the expiry of Period of Maintenance and thereafter untilthe costs of execution and maintenance, damages for delay in completion, if any, and allother expenses incurred by the Indore Sahakari Dugdha S angh M aryadit.,Indorehave been ascertained and the amount thereof certified by the Engineer. The Contractorshall then be entitled to receive only such sum(s), if any, as the Engineer may certifywould have been payable to him upon due completion by him after deducting the saidamount. If such amount shall exceed the sum which would have been payable to theContractor on due completion by him, then the Contractor shall, upon demand, pay tothe Indore Sahakari Dug dha Sa ngh M aryadit.,Indore the amount of such excessand it shall be deemed a debt due by the Contractor to the Indore Sah akari DugdhaSangh Maryadit.,Indore and shall be recoverable accordingly.
In such event, the Indore Sahakari Du gdha Sangh M aryadit.,Indore shall charge15% overhead to cover the departmental charges and the same shall be recovered fromthe Contractor.
No credit shall be allowed to the Contractor in case the amount spent by theIndore Sahakari Dugdha Sangh Maryadit.,Indore for a particular item,which shall be less than the amount payable as per the tender amount.
64.0 Urgentrepairs.
If, by reason of any accident, or failure, or other event occurring to in or in connectionwith the works, or any part thereof, either during the execution of the works, or duringthe Period of Maintenance, any remedial or other work or repair shall, in the opinion ofthe Engineer, be urgently necessary for the safety of the works and the Contractor isunable or unwilling at once to do such work or repair, the Indore Sahakari DugdhaSangh Maryadit.,Indore may employ and pay other persons to carry out such work orrepair as the Engineer may consider necessary. If the work or repair so done by theIndore Sahakari Dugdha Sangh Maryadit.,Indore is work, which, in the opinion ofthe Engineer, the Contractor was liable to do at his own expense under the Contract, allexpenses properly incurred by the Indore Sahakari Dugdha Sangh Maryadit.,Indorein so doing shall be recoverable from the Contractor by the Indore Sahakari DugdhaSangh Maryad it.,Indore , or may become due from the Contractor. Provided alwaysthat the Engineer, as the case may be, shall as soon after the occurrence of any suchemergency as may be reasonably practicable, notify the Contractor thereof in writing.
Special Risks
65.0 No Liability for War etc.
Notwithstanding anything in the Contract contained:-
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
50
The Contractor shall be under no liability whatsoever whether by way ofindemnity or otherwise for or in respect of destruction of or damage to theworks, save to work condemned under the provisions of Clause 39 hereof priorto the occurrence of any special risk hereinafter mentioned, or to propertywhether of the Indore S ahakari Dugdha Sangh Maryadit.,Indore or ofthird parties, or for or in respect of injury or loss of life which is theconsequence of any special risk as hereinafter defined. The Indore SahakariDugdha Sa ngh Maryadit.,Indore shall indemnify and save
harmless the Contractor against and from the same and against and fro, allclaims, proceedings, damages, costs, charges and expenses whatsoever arisingthere out or in connection therewith.
If the works or any material on the site, or any other property of the Contractor used orintended to be used for the purposes of the works, shall sustain destruction or damageby reason of any of the said special risks the Contractor shall be entitled to payment for:
a) Any permanent work and for any materials so destroyed or damaged, and, as so far asmay be required by the Engineer, or as may be necessary for the completion of theworks, on the basis of costs plus such profit as the Engineer may certify to bereasonable
b) Replacing or making good any such destruction or damage of the works:
c) Replacing or making good such materials or other property of the Contractor used orintended to be used for the purposes of works.
Destruction, damage, injury or loss of life caused by the explosion or impact wheneverand wherever occurring of any mine, bomb, shell, grenade or other projectile, missile,munitions or explosive of war, shall be deemed to be a consequence of the said specialrisks.
The Indore Sahakari Dugdha Sangh Maryadit.,Indore shall repay to the Contractorany increased cost of or incidental to the execution of the work, other than such as maybe attributable to the cost of reconstruction work condemned under the provisions ofClause 39 hereof, prior to the occurrence of any special risk, which is however,attributable to or consequent on or the result of or in any way whatsoever connectedwith the said special risks, subject however to the provisions in this clause hereinaftercontained in regard to outbreak of war, but Contractor shall as soon as any such increaseof cost shall come to his knowledge forthwith notify the Engineer thereof in writing.
The Special Risks are unprecedented flood, earthquake or other convulsion of nature,war, hostilities (whether war be declared or not) invasion, act of foreign enemies, thenuclear and the pressure wave risk described in clause 20 hereof, or in so far as itrelated to the country in which the works are being or are to be executed or maintained,rebellion, revolution, insurrection, military or usurped power, civil work, or unlesssolely restricted to the employees of the Contractor or of his Sub- Contractors andarising from the conduct of the works, riot, commotion or disorder.
If, during the currency of the Contract, there shall be an outbreak of war, whether war is
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
51
declared or not, in any part of the world which, whether financially or otherwise,materially affects the execution of the works, the Contractor shall, until and unless theContract is terminated under the provision of this Clause, continue to use his bestendeavors to complete the execution of the works. Provided always that the IndoreSahakari Dugdha Sangh Maryadit.,Indore shall be entitled at any time3 after suchoutbreak of war to terminate the Contract by giving written notice to the Contractor and,upon such notice being given, this Contract shall, except as to the rights of the partiesunder this clause and to the operation of clause 65.8 hereof, terminate, but withoutprejudice o the right of either party in respect of any antecedent breach thereof.
If the Contract shall be terminated under the provisions of the last preceding sub-clausethe Contractor shall, with all reasonable dispatch, remove from the site allconstructional plant and shall give similar facilities to his sub- Contractor to do so.
If the Contract shall be terminated as aforesaid, the Contractor shall be paid by theIndore Sahakari Dugdha Sangh Maryadit.,Indore , as in so far as much amount oritems shall not have already been covered by payments on account made to theContractor, for all works executed prior to the date of termination at the rates and pricesprovided in the Contract and in addition: -
a) The amounts payable in respect of any preliminary terms, so far as the works orservice comprised therein has been carried out or performed, and a proper proportionas certified by the Engineer of any such items, the work or service comprise in whichhas been partially carried out or performed.b) The cost of materials or goods reasonably ordered for the works which shall havebeen delivered to the Contractor, or of which the Contractor is legally liable to acceptdelivery, such materials or goods becoming the property of the Indore S ahakariDugdha Sangh Maryadit.,Indore upon such payments being made by him.
c) A sum to be certified by the Engineer, being the amount of any expenditurereasonably incurred by the Contractor in the expectation of completing the whole ofthe works insofar as such expenditure shall not have been covered by the payments inthis sub-clause before mentioned.
d) Any additional sum payable under the provision of the clauses 65.1,65.2 and 65.4.
e) The reasonable cost of removal of construction plant under clause 65.7 and, ifrequired by the Contractor, return thereof to the Contractor’s main plant yard in hiscountry of registration or to any other destination, at no greater cost.
f) The reasonable cost of repatriation of all the Contractor’s staff and workmenemployed in or in connection with the works at the time of such termination.
Provided always that against that against any payments due from the IndoreSahakari Dugdha Sangh Maryadit.,Indore shall be entitled to be creditedwith any outstanding balance due from the Contractor for advances in respectof constructional plant and materials and any other sums which at the date of
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
52
termination were recoverable by the Indore S ahakari Dugdha S angh Maryadit.,Indore from the Contractor under the terms of the Contract.
66.0 Payment in the Event of Frustration
66.1 If a war or other circumstances outside the control of both parties, arises afterthe Contract is made so that either party is prevented form fulfilling hisContractual obligation, or under the law governing the Contract, the partiesare released from further performance, then the sum payable by the IndoreSahakari Dugdha Sangh Maryadit.,Indore to the Contractor in respect ofthe work executed shall be the same as that which would have been payableunder clause 65 hereof if the Contract and been terminated under theprovisions of clause 65 hereof.
67.0 Settlement of Disputes
If the Contactor considers any work demanded of him to be outside the requirements ofthe Contract, or considers any drawings, record or ruling of the Engineer on any matterin connection with or arising out of the Contract or the carrying out of the work to beunacceptable, he shall promptly ask the Engineer in writing, for written instructions ofdecision. There upon the Engineer shall give his written instructions or decision withina period of thirty days of such request.
Upon the receipt of the written instructions or decisions the Contractor shall promptlyproceed without delay to comply with such instructions or decisions.
If the Engineer fails to give his instructions or decisions in writing within a period ofthirty days after being requested, or if the Contractor is dissatisfied with theinstructions and decisions the contractor may appeal to the Indore SahakariDug dha Sa ngh Maryadit.,Indore which shall afford an opportunity to theContractor to be heard and to offer an evidence in support of his appeal. TheIndore S ahakari Dugdha Sa ngh Maryadit.,Indore shall give a decisionwithin a period of thirty days after the Contractor has given the said evidencein support of his appeal.
If the Contractor is dissatisfied with this decision, the Contractor within a period ofthirty days from the receipt of the decision shall indicate his intention to referthe dispute to Arbitration, failing which the said decision shall be final andconclusive.
68.0 Arbitration
All disputes or differences whatsoever which shall at any time arise between the partieshereto on this is agreement of project or any clause herein contained or any matter in any wayconnected therewith or the rights, duties, obligations of the parties hereto shall within 3 months of thewritten notice of such difference (s) being given by one party to the other be finally referred to the
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
53
Chairman of ISDS, adjudication of the Sole Arbitrator and his decision will be final and binding to boththe parties. If the Arbitrator so appointed is unable or unwilling to act or resigns his appointment orvacates his office due to any reason whatsoever, an arbotrator shall be appointed by ISDS and thevenue of the Arbitration shall be Indore only and jurisdiction for any matter/dispute arising out of orconcerning or connected with such Arbitration shall be of Indore court only as the case may be.
The award of the Arbitrator shall be final and binding to both the parties.
The Arbitration proceedings shall be governed by the Indian Arbitration act, 1940 and the rules thereunder or any statutory modification thereof for the time being in force. Performance under the contract,shall, if reasonably possible, continue during the Arbitration proceedings and the payments due to thecontractor by the Indore Sahakari Dugdha Sangh Maryadit.,Indore shall not be withheld, unless theyare the subjects of the Arbitration proceedings
69.0 Notices
All Certificates, notices or written orders to be given by the Indore Sahakari DugdhaSangh Maryadit.,Indore or by the Engineer to the Contractor under the terms of theContract shall be served by sending by post to or delivering the same to the Contractor’sprincipal place of business, or such other address as the Contractor shall nominate forthispurpose.
All notices to be given to the Indore Sahakari Dugdha SanghMaryadit.,Indore or to the Engineer under the terms of the Contract shall beserved by sending by post or delivering the same to the respective addressesnominated for that purpose.
Either party may change a nominated address to another address in thecountry where the works are being executed by prior written notice to the otherparty and the Engineer may do so by prior written notice to both parties.
70.0 Default of Indore Sahakari Dugdha Sangh Maryadit.,Indore
In the event of the Indore Sahakari Dugdha Sangh Maryadit.,Indore : -
a) Failing to pay to the Contractor the amount due under any certificate of theEngineer within 60 days after the same shall have become due under the terms of theContract, subject to any deduction that the Indore S ahakari Dugdha Sa nghMaryadit.,Indore is entitled to make under the Contract, or
b) Interfering with or obstruction or refusing any required approval to the issue of anysuch certificate, or
Giving to the Contractor a formal notice that for any unforeseen reasons, it isimpossible Indore Sahak ari Dugdha San gh Maryadit.,Indore to meet itsContractual obligations.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
54
The Contractor shall be entitled to terminate his employment under theContract after giving thirty days prior written notice to the Indore SahakariDug dha Sa ngh Maryadit.,Indore , with a copy to the Engineer.
Upon the expiry of the fourteen days notice referred to in clause 70.1, the Contractorshall, notwithstanding the provisions of clause 54.1 hereof, with all reasonable dispatch,remove from the site all constructional plant brought by him thereon.
In the event of such termination the Indore Sahakari Dugd ha Sa nghMaryadit.,Indore shall be under the obligations to the Contractor in regard to paymentas if the Contract had been terminated under the provisions of clause 65 hereof, but, inaddition to the payments specified in clause 65.8 hereof, the Indore Sahakari DugdhaSangh Maryadit.,Indore shall pay to the Contractor the amount of any loss or damageto the Contractor arising out of or in connection with or by consequence of suchtermination, as are deemed reasonable and fair.
71.0 Changes in Cost and Legislation
No price adjustment if the Contract period is less than and up to 12 months. Pursuant toclause 11.4 of Section I Instructions to Bidders. However due to unforeseencircumstances if the completion time is extended, the rates quoted shall remainunchanged for period of sixth months beyond the stipulated completion time. Beyondthis period of 18 months change in cost would be worked out as per mutually agreedupon formula.
72.0 Taxation
The Contractor will have to specify tax conditions. Weather CGST/ SGST/ any othertax etc are applicable or not. If these taxes are applicable at what rate they will beapplicable. If Tax condition is not specified, your rate should be considered asinclusive of all taxes. Which ever is applicable that may be levied according to the lawsand regulations on the constructional plant, material and supplies acquired for thepurpose of the Contract and on the services performed under the Contract. Nothing inthe contract shall relieve the Contractor from his responsibility to pay any tax that maybe levied on profits made by him in respect of the Contract.
The Contractor’s staff, personnel and labour will be liable to pay personnel incometaxes in respect of such of their salaries and wages as are chargeable under the laws andregulations for the time being in force, and the Contractor thereof as may be imposed onhim by such laws and regulations.
73.0 Bribery and Collusion
The Indore Sahakari Dugdha Sangh Maryadit.,Indore shall be entitled to terminatethe contract and recover from the contractor the amount of any loss resulting from suchtermination if the contractor shall have offered or given to any person any gift orconsideration of any kind as an inducement or reward for doing, or for bearing to doany action in relation to obtaining, or in the execution of contract or any other contract
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
55
with the Indore Sahakari Dugdha Sangh Maryadit.,Indore , or if any of thelike acts shall have been done by any person employed by the contractor oracting on his behalf (whether with or without the knowledge of thecontractor), or if the contractor shall have come in to any agreement withanother contractor(s) whereby an agreed quotation or estimate shall be offeredas a bid to the Indore S ahakari Dug dha Sangh Maryadit.,Indore by oneor more contractors.
In the event of such termination, the contractor shall:
a) Proceed as provided in sub clause 65.7 hereof, andb) Be paid by the Indore Sahakari Dugdha Sangh Maryadit.,Indore as provided insub clause 65.8 hereof, provided that any loss referred herein shall first be deducted.
74.0 Termination of contract for Indo re Sahakari Dugdha SanghMaryadit.,Indore ’S convenience
The Indore S ahakari Dugdha Sa ngh M aryadit.,Indore shall be entitled toterminate this contract at any time for its own convenience after giving 60 days priornotice to the contractor, with a copy to the Engineer.
In the event of such termination the contractor:a) Shall proceed as provided in sub clause 65.7 here of, andb) Shall be paid by the Indore Sahakar i Dug dha Sangh Maryadit.,Indore as
provided in sub clause 65.8 hereof.
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
56
Section III: - Special Conditions of Contract
1.0 The following special conditions of contract shall supplement the Generalconditions of contract, given in section II, wherever there is a conflict theprovision herein shall prevail over those in the General conditions of contract.
Taxes
Specify Tax Condition. If Service Tax, VAT, Work Contract Tax, Sales tax etc. areapplicable or not. If tax co ndition is not sp ecified y our ra te s hall be co nsideredinclusive of all taxes.
Time ofCompletion
The contractor shall execute the contract up to 10% increase in the value of the workswithin the specified completion period of the contractor and no extension of time shallbe granted. In case the increase in the value exceeds 10% of the contract amount,proportionate extension of time shall be granted, for the entire amount of increase overthe original contract value.
Engineer’s office Accommodation
The contractor shall at his own cost provide a temporary office accommodation of size3M x 4M for the Engineer along with toilet facility and shall provide electricalconnection to the same. The contractor, at his own cost, shall remove the structure afterthe completion of work.
Water for Construction and Other Use
The water suitable for construction purpose shall be provided at one point (Maximum30 m away form construction site) the contractor shall make his own arrangement forwater connection and distribution pipelines in the construction area.
Water charges @0.5% shall be recovered from the gross amount of work done fromeach Interim bill.
The MDG shall not guarantee the maintenance of uninterrupted water supply. It will bethe responsibility of the contractor to make alternative arrangements for water supply athis own cost in the event of any break down so that the progress of work is not affectedfor want of water. No claim or damage or refund of water charges shall be entertainedon account of such break down.
Power(Electricity)Supply
E – TENDER FOR :-Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials, equipment andservices for the construction and completion of the of new dairy Plant building at Khandwa under Indore Sahakari Dugdha Sangh MaryaditIndore.
57
The Power supply shall be made at one point in the site at the direction of the Engineer.The contractor shall make his own arrangement to carry and distribute the powerwherever it is required within the site as per IEA rules.
Electricity charges @0.5% shall be recovered from the gross amount of workdone from each Interim bill.
6.3 The temporary supply lines shall be removed and the contractor shall clear the site after thecompletion of the work at his own cost.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
58
Section-IV : - Schedule of Supplementary Information.
The bidder shall provide latest and updated Supplementary Information as on date ofsigning of bid as annexed in the form of tables mentioned hereunder. All thesesupplementary information shall be considered for the bid evaluation, and it in thecontract execution. If the bidder then the bid does not supply the requisite informationshall be considered non-responsive and shall be rejected.
a) Table – 1 Equipment, Plant & Machinery.
b) Table – 2 Key Personnel.
c) Table – 3 Nominated Sub-contractors.
d) Table – 4 Major works successfully completed during last five years.
e) Table – 5 NA
f) Table – 6 Statement of Arbitration & Disputes in last five years.
g) Table – 7 Financial Business Capability and Income Tax returns certificates for thelast threeyears.
h) Table – 8 Works in Hand
Bidders can use tables given herewith to furnish this information or separate sheets canalso be attached for this purpose.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
59
Table – 1 Equipment, Plant & Machinery.
Major items of equipments, plants and machinery to be deployed by the bidder.
Sr.
No.
Description Of Equipment Make ofequipment
Nos. available withthe bidder inworking condition
Nos. proposedto bedeployedat site.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
60
Table – 2 Key Personnel
Personnel Nos. of person employ ed withthe bidder.
Nos. of persons to be
deploy ed for this project
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
61
Table. – 3 Nominated sub contractors
(List of works of value more than 10 % of the contract value proposed to besublet)
Sr.
No.
Description of Work Approxi mate Value ofwork ` .
Name ofthe sub-
contractor.
Place where s i milarworks previous ly
executed.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
62
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
63
TABLE-5
NOT APPLICABLE
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
64
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
65
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
66
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
67
SECTION V- FORM OF AGREEMENT FOR –
Civil, Structure, boundry wall and ancillary works along with supply of necessary labour, materials,equipment and services for the construction and completion of the of new dairy Plant building atKhandwa under Indore Sahakari Dugdha Sangh Maryadit Indore
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
68
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
69
SECTION-VI- ACCEPTABLE FORMS OFBANK GAURANTEES
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
70
(On non-judicial stamp paper of applicable amount) Bank guaranteeno……………………………………dated…………………… This deed of bankguarantee made this………… day of 2018 (Two thousand eighteen) By (nameand address of the bank) here in after referred to as bank, which shall unless repugnant to
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
71
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
72
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
73
(non-judicial stamp paper of applicable amount)
…………………………………..only) being the retaintion amount of money ie 5.0 % of
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
74
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
75
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under IndoreSahakari Dugdha Sangh, marya.Indore M.P on turnkey basis.
76
PART-B-Technical specifications
(Civil materials and construction work)
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
79
Title – Applicable Standards for Civil & Plumbing Works.
1 Conversionfactors IS:7862 Method of measurement ofbuildingworks IS:12003 Code of practice for measurement of civilengineeringworks IS:33854 Materials and workmanship for earthworkandexcavation IS:1200 (PARTI)5 Safety code for blasting and relateddrillingoperations IS:40816 Safety code forexcavationwork IS:37647 Moisture content in sandforfilling IS:27208 Determination ofmoisturecontent IS:2720 (PARTII)9 Determinationofmoisturecontent&drydensityrelationusinglightcompaction IS: 2720(PARTVIII)10Determinationofdrydensityofsoilsin-placebythesandreplacementmethodIS:2720(PARTXXVIII)11Determinationofdrydensityofsoilsin-placebythecorecuttermethod IS:2720(PARTXXIX)12Antitermitetreatment IS:6313(PARTI TOIII)
13 Constructionwater IS:45614 Methodsofsamplingandtest(physicalandchemicalwaterusedinindustry) IS:302515 Ordinary (33 grade)/low heatPortlandcement IS:26916 Ordinary Portland cement(43grade) IS:811217 Ordinary Portland cement(53grade) IS:1226918 WhitePortlandcement IS:8042-E19 Portlandpozzolanacement IS:148920 Rapid hardeningPortlandcement IS:8041,IS:26921 Portland(blast furnace)slagcement IS:45522 Hydrophobiccement IS:804323 Highaluminacement IS:645224 Supersulphatedcement IS:690925 Oilwellcement IS:8229E26 Standard for testingofcement IS:65027 Methods of physical tests forhydrauliccement IS:403128 Specification for standard sand for testingofcement IS:65029 Coarse and fine aggregatesforconcrete IS:383,IS:51530 Gradation ofcoarseaggregates IS:383(TABLEII)31 Gradation offineaggregates IS:383 (TABLEIII)32 All-in-aggregates IS:383 (TABLEIV)33 Method of tests for aggregatesforconcrete IS:2386 (PARTITOVIII)34Methodsofdeterminationthemaximumqty.ofdeleteriousmaterialsinaggregate IS:2386 (PARTII)35 Limitingvaluesofthemaximumquantitiesofdeleteriousmaterialsinaggregate IS:383 (TABLEI)36 Flakiness indexofaggregates IS:2396 (PART I),IS:564037 Moisture content testforaggregatesIS:2386(PARTIII)38SpecificationformildsteelandmediumtensilesteelbarsandharddrawnsteelwireforIS:432(PARTI&II)concrete reinforcement.39Specificationforplainharddrawnsteelwirefabricforcementconcrete IS:156640 Specification for cold twisted steel bars forconcretereinforcement IS:178641Specificationsforhotrolledmildsteelandmediumtensilesteeldeformedbars IS:1139,IS:173942 Code of practice for bending and fixing of bars forconcretereinforcement IS:250243 Mild steelbindingwire IS:28044 Code of practice for welding of mild steel bars usedforRCC IS:275145 Code of practice for plain andreinforcedconcrete IS:45646 Code of practice for general construction of plain and RCCfordams IS:45747 Testing of reinforcedcementconcrete IS:51648 Method of tests for strengthofconcrete IS:51649 Methods of sampling & analysisofconcrete IS:119950 Code of practice for concrete structures for storageofliquids IS:3370 (PART I TOIV)51 Code of practice forcompositeconstruction IS:393552 Codeofpracticeforconstructionofreinforcedconcreteshellroof IS:220453 Criteria for the design of RCC shell structures andfoldedplates IS:221054 Specification for batch typeconcretemixers IS:179155 Specification for portable swing weigh batchersforconcrete IS:272256 Specification for rollerpanmixer IS:2438
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
80
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
81
Title – Applicable Standards for Civil & Plumbing Works.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
82
Title – Applicable Standards for Civil & Plumbing Works
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
83
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
84
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
85
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
86
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
87
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
88
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
89
GENERAL TECHNICAL SPECIFICATIONS FOR BUILDING WORKS
General:1. In the specifications, “as directed” / “Approved” shall be taken to mean “asdirected” / “approved” by the Architect /Engineer-in-charge.2. Wherever a reference to any Indian Standard appears in the specifications, it shallbe taken to mean as a reference to the latest edition of the same in force on thedate ofagreement.3. In “Mode of Measurement” in the specifications wherever a dispute arises in theabsence of specific mention of a particular point or aspect, the provisions on theseparticular points, or aspects in the relevant Indian Standards shall be referredto.4. All measurements and computations, unless otherwise specified, shall be carriedout nearest to the followinglimits:
1. Length, width and depth (height) – 0.01Metre.2. Areas – 0.01Sq.Mt.3. Cubic Contents – 0.01Cu.Mt.
5. The distance which constitutes lead shall be determined along the shortestpractical route and not necessarily the route actually taken. The decision of theEngineer – in – charge in this regard shall be taken asfinal.6. Where no lead is specified, it shall mean “allleads”7. Lift shall be measured from plinthlevel.8. Upto“floortwolevel”meansactualheightoffloor(maxi.4M.)upto3Mt.,aboveplinthlevel.9. Definite particulars covered in the items of work, though not mentioned orelucidated in it, specifications shall be deemed to be includedtherein.10. Reference to specifications of materials as made in the detailed specifications ofthe items of work is in the form of a designation containing the number of thespecifications of the material and prefix “M” e.g. “M-5”11. Approval to the samples of various materials given by the Engineer – in – chargeshall not absolve the contractor from the responsibility of replacing defectivematerial brought on site or materials used in the work found defective at a laterdate. The contractor shall have no claim to any payment or compensationwhatsoever on account of any such materials being rejected by the Engineer – in –charge.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
90
to cause or lead to damage or overloading of the various components of the structure.17. All works shall be carried out in a workmanlike manner as per the best technique for the particularitem.18. All tools, templates, machinery and equipment for correct execution of the work as well as for checking lines,levels, alignment of the works during execution shall be kept in sufficient numbers and in good workingcondition on the site of the work.19. The mode, procedure and manner of execution shall be such that it does not cause damage or over loading ofthe various components of the structure during execution or after completion of thestructure.20. Special modes of construction not adopted in general engineering practice, if proposed to be adopted by thecontractor, shall be considered only if the contractor provides satisfactory evidence that such special mode ofconstruction is safe, sound and helps in speedy construction and completion of work to the required strengthand quality. Acceptance of the same by the Engineer-in-charge shall not, however, absolve the contractor of theresponsibility of any adverse effects and consequences of adopting the same in the course of execution ofcompletion of thework.21. All installations pertaining to water supply and fixtures thereof as well as drainage lines and sanitary fittingsshall be deemed to be completed only after giving satisfactory tests by the contractors.22. The contractor shall be responsible for observing the rules and regulations imposed under “Minor MineralsAct” and such other laws and rules prescribed by Government from time to time.23. All necessary safety measures and precaution (including those laid down in the various relevant IndianStandards), shall be taken to ensure the safety of men, materials and machinery on the works as also of theworkitself.24. The testing charges of all materials shall be borne by the Contractor unless recovery at one percent towardsusing charges is separatelymade.25. Approval to any of the executed items for the work does not in any way relieve the contractor of hisresponsibility for the correctness, soundness and strength of the structure as per the drawingsandspecifications.
IV. MATERIALS SPECIFICATIONS for - CIVIL M-1 Water
:
Water shall not be salty or brackish and shall be clean, reasonably clear and free from objectionable quantities of silt and traces of oil andinjurious alkalies salts, organic matter and other deleterious material which will either weaken the mortar or concrete or cause efflorescence orattack the steel in RCC container for transport, storage and handling of water shall be clean. Water shall conform to the standards specified inIS : 456.
Title – Material Specifications for Civil Works Sheet 2 OF 2
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
91
If required by the Engineer-in-charge it shall be tested by comparison with distilled water. Comparison shall be made by means of standard cement testsfor soundness, time of setting and mortar strength as specified in IS : 269. Any indication of unsounding change in time of setting by 30 minutes or moreor decrease of more than 10 per cent in strength of mortar prepared with water sample when compared with the results obtained with mortar preparedwith distilled water shall be sufficient cause for rejection of water under test.Water for curing mortar, concrete or masonry should not be too acidic or too alkaline. It shall be free of elements which significantly affectthe hydration reaction or otherwise interfere with the hardening of mortar or concrete during curing or those which produce objectionablestains or other unsightly deposits on concrete or mortar surfaces.Hard and bitter water shall generally be found unsuitable for curing mortar orconcrete.Potable water shall be generally found suitable for curing mortar andconcrete.Testing Standards :
A. Chemical Analysis :-Sampling : Test shall be carried out only once for one particular source. Results :a) TDS - 3000 mg/lit. e) Carbonic contents - 200mg/lit.b) Sulphates - 5000 mg/lit. f) Non-carbonic contents - 3000 mg/lit.c) pH values - 6 to8d) ChloridesP.P.C - 2000 mg/lit.R.C.C - 1000 mg/lit.
M-2 Lime :Lime shall be hydraulic lime as per IS : 712. Necessary test shall be carried out as per IS : 6932 (Parts I to X)The following fields tests for limes are to be carried out:(1) A very rough idea can be formed about the type of lime by its visual examination i.e. fat lime bears pure white colour, limein form of Porous lumps of dirty white colour indicates quick lime, and solid lumps are the unburnt lime stone.(2) Acid test for determining the carbonate contents in lime. Excessive amount of impurities and rough determination of classof lime.Storage shall comply with IS : 712. The slaked lime, if stored, shall be kept in a weather proof and damp- proof shed with impervious floor andsides to protect it against rain, moisture, weather and extraneous materials mixing with it. All lime that has been damaged in any way shall berejected and all rejected materials shall be removed from site of work.Field testing shall be done according to IS : 1624 to show the acceptability of materials.
M-3 Cement :
ORDINARY PORTLAND CEMENT:3.1 Cement shall be ordinary Portland cement, grade 33, as per IS : 269, grade 43, as per IS : 8112 and grade 53, asper IS : 12269 or Portland slag cement as per IS : 455.Testing Standards :
A. Setting time : Sampling :(i) From a lot of 50 tones of cement, 2% of bags shall be picked out at random, from which one sample of 15 kg. shall betaken.(ii) For a lot of 50 to 100 tones - 2 samples(iii) For a lot of 100 to 200 tones - 3 samples(iv) For a lot of 100 to 200 tones - 3 samples(v) For a lot of 200 to 300 tones - 4 samples(vi) For a lot of 300 to 500 tones - 5 samples
For a lot of 500 to 800 tones - 6 samples
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
92
Title – Earth WorksThe excavated stuff of the selected type shall be used in filling the trenches and plinth or leveling the ground in layers, including rammingand watering etc.complete.The Contractor shall remove the balance of the excavated quantity from the site of work, to a place, as directed, within aleadupto50m.measuredfromtheouterfaceofthebuilding/workunderconsiderationandforalllift.The lead is the shortest practical route and not necessarily the route actually taken. The decision of Engineer-Incharge shall be finalin thisregard.6.0 Mode of Measurement andPayment:The measurement of excavation in trenches for foundation shall be made according to the sections of trenches shown on thedrawing or as per sections given by the Architect and Engineer-in-charge. No payment shall be made for surplus excavation made inexcess of above requirements or due to stepping and sloping back as found necessary, on account of conditions of soil and requirementsofsafety.The rate shall include for clearing the site, surface dressing, making layout of the building, fixing permanent grid points with MS ironposts, embedded in C.C. 1:2:4, placed sufficiently away from the building and establishing bench marksetc.The rates shall include for necessary shoring, timbering and strutting for protection of sides of the excavated trenches andpits,pumpingoutrainorsurfacewateratanystageofconstructionsoastokeepthetrenches/pitsdry,tothesatisfactionof theArchitect/Engineer-in-charge.The rate shall include leveling and ramming the bottoms of excavations to receive concrete, etc. including trimming to slope wherevernecessary etc.complete.The rate shall also include backfilling of trenches up toNGL.The rate shall be for a unit of one m3.Excavation for foundation in Black cotton soil including sorting out and stacking of useful materials, disposing of the excavatedstuff upto 50 m. lead, including dewatering and excavating debris excluding backfilling the trenches/ foundation and includingdressing the base of trench / foundation etc. complete, asdirected.
a) Depth up to 1.5mb) Depth 1.5 to 3mc) Depth 3 to 5md) Depth 5 to 7m
General:Soil which generally possess typical characteristics of shrinkage and swelling due to moisture movement through it with atmosphericchanges and soil which has its grains in the form of platelet or sheet is termed as Black Cotton Soil. It easily yields to the application ofpickaxes and shovels, phawaras, rakes or any such ordinary excavating implement. This soiltypewillhaveverylowbearingcapacityandwillbeblackishincolor.Thedepthoftheexcavationshallbeaspertheitemdescription.Workmanship and Mode of Measurements andPayment:The relevant specifications of the item no. 1.01 shall be followed except that excavation shall be done in Black cotton soil. The rateexcludes backfilling the trenches.The rate shall be for anunitofonem3.Excavation for foundation in dense or hard soil including sorting out and stacking of useful materials and disposing of theexcavated stuff upto 50 m. in lead, including dewatering and excavating debris excluding backfilling etc. complete, asdirected.
a) Depth up to 1.5mb) Depth 1.5 to 3mc) Depth 3 to 5md) Depth 5 to 7me) Depth 7 to10m
General:Any soil which generally yields to the application of pickaxes and shovels, spades, rakes or any such ordinary excavating implement ororganic soil, gravel, silt, sand turf loam, clay, peat etc. falls under this category. For materials and workmanship for earthwork andexcavation, relevant specifications of IS 1200 (Part I) and IS: 3764 shall be followed.The depth of the excavation shall be as per the item description.Clearing the Site:The site on which the structure is to be built shall be cleared and all obstructions, loose stones, materials and rubbish of all kind, bush,wood shall be removed, as directed. The materials so obtained shall be the property of the Government and shall be conveyed andstacked as directed, within 50-m. lead. The roots of the trees coming in the sides of the trenches shall be cut and coated with hot asphalt.All types of trees, woods etc. which requires prior permission of Govt./Forest Authority, before cutting shall be cut after obtaining suchpermission from them. It shall be the Contractor's responsibility to obtain such permission from the respective authorities.The rate of site clearance is deemed to be included in the rate of earthwork, for which no extra will be paid.Setting out:After cleaning the site, the centerlines will be given by the Architect and Engineer-in-charge. The Contractor shall assume fullresponsibility for alignment, elevation and dimension of each and all parts of the work. Contractor shall supply labours, materials, etc.required for setting out the reference marks and bench marks made of MS angle iron and embedded in 1:2:4 CC. They shall maintain thesame as long as required and directed.
Excavation:
The excavation in the foundation shall be carried out either manually or by mechanical means, in true line and level and shall have
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
93
Excavation:
The excavation in the foundation shall be carried out either manually or by mechanical means, in true line and level and shall have thewidth and depth, as shown in the drawings or as directed. The Contractor shall do the necessary shoring and strutting or shall providenecessary slopes to a safe angle or steps, as required or directed, at his own cost. No extra payment shall be made for such precautionarymeasures, taken. The bottom of the excavated area shall be leveled both longitudinally and transversely, as directed, by removing excess soiland watering, as required. No earth filling will be allowed for bringing it to level, if by mistake or any other reason, excavation is made deeperor wider than shown on the drawings or as directed. The extra depth or width shall be made up with concrete of the same proportion, asspecified for the foundation concrete, at the cost of the Contractor.The Contractor shall at his own expense and without extra charge make provision of supporting all utility services, lighting the trenches,separating and stacking serviceable materials neatly, shoring, timbering, strutting, bailing out water either sub-soil or rainwater, includingpumping at any stage of the work. Trenches shall be kept free of water while masonry or concrete works are in progress and tillthe Architect and Engineer-in-charge considers it necessary,
i.e. till the concrete is sufficiently set.
5.0 Disposal of the Excavated Stuff:The excavated stuff of the selected type shall be used in filling the trenches and plinth or leveling the ground in layers, including ramming andwatering etc. complete.The Contractor shall remove the balance of the excavated quantity from the site of work, to a place, as directed, within a lead upto 50 m.measured from the outer face of the building / work under consideration and for all lift.
The lead is the shortest practical route and not necessarily the route actually taken. The decision of Engineer-Incharge shall be final inthis regard.6.0 Mode of Measurement and Payment:
The measurement of excavation in trenches for foundation shall be made according to the sections of trenches shown on the drawingor as per sections given by the Architect and Engineer-in-charge. No payment shall be made for surplus excavation made in excess ofabove requirements or due to stepping and sloping back as found necessary, on account of conditions of soil and requirements ofsafety.
The rate shall include for clearing the site, surface dressing, making layout of the building, fixing permanent grid points with MS iron posts,embedded in C.C. 1:2:4, placed sufficiently away from the building and establishing bench marksetc.The rates shall include for necessary shoring, timbering and strutting for protection of sides of the excavated trenches and pits, pumpingout rain or surface water at any stage of construction so as to keep the trenches/pits dry, to the satisfaction of the Architect/Engineer-in-charge.The rate shall include leveling and ramming the bottoms of excavations to receive concrete, etc. including trimming to slope wherevernecessary etc. complete.The rate shall also include backfilling of trenches up toNGL.The rate shall be for a unit of one m3.
Excavation for foundation in Black cotton soil including sorting out and stacking of useful materials, disposing of the excavated stuffupto 50 m. lead, including dewatering and excavating debris excluding backfilling the trenches/ foundation and including dressingthe base of trench / foundation etc. complete, asdirected.
a) Depth up to 1.5mb) Depth 1.5 to 3 m
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
94
c) Depth 3 to 5 md) Depth 5 to 7 m
General:Soil which generally possess typical characteristics of shrinkage and swelling due to moisture movement through it with atmospheric changesand soil which has its grains in the form of platelet or sheet is termed as Black Cotton Soil. It easily yields to the application of pickaxes andshovels, phawaras, rakes or any such ordinary excavating implement. This soil type will have very low bearing capacity and will be blackish incolor.The depth of the excavation shall be as per the item description.Workmanship and Mode of Measurements and Payment:The relevant specifications of the item no. 1.01 shall be followed except that excavation shall be done in Black cotton soil. The rate excludesbackfilling the trenches.The rate shall be for an unit of one m3.Excavation for foundation in dense or hard soil including sorting out and stacking of useful materials and disposing of the excavatedstuff upto 50 m. in lead, including dewatering and excavating debris excluding backfilling etc. complete, as directed.
f) Depth up to 1.5mg) Depth 1.5 to 3 mh) Depth 3 to 5 mi) Depth 5 to 7 mj) Depth 7 to 10m
General:Any soil which generally requires close application of pickaxes or jumpers or scarifiers to loosen it, stiff clay and cobble stone etc., fallunder this category.The depth of the excavation shall be as per the item description.Workmanship and Mode of Measurements and Payment:The relevant specifications of the item no. 1.01 shall be followed except that excavation shall be done in dense or hard soil.The rate shall be for an unit of one m3.
Excavation for foundation in hard murrum including sorting out and stacking of useful materials and disposing of the excavated stuffupto 50 m. in lead, including dewatering and excavating debris excluding backfilling the trenches/ foundation etc. complete, asdirected.
a) Depth up to 1.5mb) Depth 1.5 to 3 mc) Depth 3 to 5 md) Depth 5 to 7 me) Depth 7 to 10m
1.0 General :The hard murrum shall be disintegrated rocks, which contain silicone material and natural mixture of clay of calcareous origin. The size ofhard murrum will not be more than 20 mm.The depth of the foundation shall be as per the item description.Workmanship:The relevant specifications of item no. 1.01 shall be followed except that the excavation work shall be carried in hard murrum.Mode of Measurements and Payment:The relevant specification of item no. 1.01 shall befollowed.The rate shall be for an unit of one m3.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
95
BLA
B
Title – PCC & RCC Works
Providing and laying Cement Concrete including compaction, finishing top surface to the level curing but excluding cost offormwork etc. complete as per specifications and directions as per Engineer-in-charge. In foundations, plinth, sub base of floorsetc. (For all civil, plumbing and electricalworks).
a) PCC 1:2:4 (1 cement : 2 coarse river sand : 3 stone aggregates using 40 / 20mm nominal size graded hard granite/ black trap stone aggregate obtained fromquarry)
b) PCC 1:3:6 (1 cement : 3 coarse river sand : 6 stone aggregates using 40 / 20mm nominal size graded hard granite/ black trap stone aggregate obtained fromquarry)
c) PCC 1:4:8 (1 cement : 4 coarse river sand : 8 stone aggregates using 40 / 20mm nominal size graded hard granite/ black trap stone aggregate obtained fromquarry)
d) PCC 1:5:10 ((1 cement : 5 coarse river sand : 10 stone aggregates using 40 / 20mm nominal size graded hardgranite / black trap stone aggregate obtained fromquarry)
1.0 Materials: Water shall conform to M-1. Sand to M-6. Cement to M-3. Black trap stone aggregate 40/ 20mm mm.MaximumnominalsizetoM-12.NominalmixdesignshallbedoneasperM3FWorkmanship :General: Before commencing the concreting, the depth and width of the excavated foundation shall be checked as per the drawing.The bed of foundation trenches shall be cleared off of all loose materials, levelled, watered and rammed, as directed.The concrete mix is not required to be designed by preliminary tests and only nominal mix as per IS: 456-2000 shall be followed. Theproportion of the concrete mix shall be 1:2:4 (1 cement: 2 coarse sand: 4 graded Black trap stone aggregate 20 mm. nominal size) byvolume. All Concrete work shall have fair finished concrete surface unless otherwise specified. Mix design shall be carried out for
environmental exposure condition as given in IS 456:2000 page 18 table3.
ThenominalmixconcreteshallonlybeusedforconcretegradeM20andlower.
The ingredients required for ordinary concrete containing one bag of cement of 50 Kg. by weight (0.0347 m3.) for differentproportionsofmixshallbeasunder:(asperIS456:2000Table9pg23)
The proportion of the fine to coarse aggregates shall be adjusted from upper limit to lower limit progressively as the grading of fineaggregates becomes finer and the maximum size of coarse aggregate becomes larger. Graded coarse aggregate shall be used. For anaverage grading of fine aggregate (Zone II of table 4 of IS 383), the proportions shall be 1:1.5, 1:2and1:2.5forthemaximumsizeofaggregates10mm,20mmand40mmrespectively.The water cement ratios shall not be more than those specified in the above table. The cement of the mix specified in the table shallbe proportionately increased, if the quantity of water in a mix has to be increased to overcome the difficulties ofplacementandcompactionsothatthewatercementratiospecifiedinthetableisnotexceeded.
Grade of Concrete Total Qty of Dry aggregate bymass per 50 kg of cement tobe taken as the sum ofindividual mass of fine andCoarse aggregate, (Maximum)inkgProportion of fine aggregate tocoarse aggregate Qty of water per 50kg of Cement,(Maximum) liters
M 10 ( 1:3:6 ) 480 Generally 1:2 for FA to CA byvolume but subject to upperlimit of 1:1.5 and lower limit1:2.534M 15 ( 1:2:4 ) 330 32M 20 ( 1:1.5:3) 250 30
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
96
Title – PCC & RCC Works Sheet 2 OF 6
For reinforced concrete work, coarse aggregates having maximum nominal size of 20 mm. are generally considered satisfactory.For heavily reinforced concrete members as in the case of ribs of main beams, the nominal maximum size of coarse aggregate shouldusually be restricted to 5 mm. less than the minimum clear distance between the main bars, or 5 mm. less than the minimum cover to thereinforcement, whichever issmaller.Coarseandfineaggregateshallbebatchedseparately.AllinaggregatemaybeuseifspecifiedbyEngineer-in-charge.Admixture (chloride free) may be used in concrete only with approval of the Architect and Engineer-in-charge based upon theevidence that with the passage of time, neither the compressive strength of concrete is reduced nor are other requisitequalitiesofconcreteandsteelimpairedbytheuseofsuchadmixtures.Thecostoftheformworkshallbeincludedorexcludedaspertheitemdescription.Forhotandcoldweatherprecautionstobetakenareasfollow:1. TemperatureofcoarseaggregateshallbemaintainedasperISspecificationsbyuseofIceFlakesformassconcrete. In hot weather,ice flakes shall be added in the concrete or aggregate shall be kept cool by sprinkling water.Necessarycorrectionsshallbeperformedinthemixdesignoftheconcrete.2. Coarse aggregate shall be stored under shed in case of hot weathertemperature.3. AvoidconcretinginthenoontimeincaseofhotweatherandduringnighttimeincaseofColdweather.4. In hot weather, the formwork shall be sprinkled with water before commencing the concretework.
Workmanship :Proportioning : Proportioning shall be done by volume, except cement which shall be measured in terms of bags of 50Kg.weight.Thevolumeofonesuchbagbeingtakenas0.0347m3.Boxesofsuitablesizesshallbeusedformeasuringsand and aggregate. The size of the boxes (internal) shall be 30 cm. x 30 cm. and 38 cm. deep or as per the convenience of thecontractor. The Internal volume of the box shall be taken as 0.0347 m3. While measuring the aggregate and sand, the box shallbe filled without shaking ramming or hammering. The proportioning of sand shall be on the basis of its dry volume and in caseof damp sand; allowances for bulkage shall be made.
Mixing :For all work, concrete shall be mixed in a mechanical mixer which along with other accessories shall be kept in first class workingcondition and maintained throughout the construction. The mixer shall comply with IS 1791 and IS 12119. Measured quantity ofaggregate, sand and cement required for each batch shall be poured into the drum of the mechanical mixer while it is continuouslyrunning. After about half a minute of dry mixing, measured quantity of water required for each batch of concrete mix shall be addedgradually and mixing continued for another one and a half minute. Mixing shall be continued till materials are uniformly distributed anduniform colour of the entire mass is obtained and each individual particle of the coarse aggregate shows complete coating of mortarcontainingits proportionate amount of cement. In no case shall the mixing bed one for less than 2 minutes after all ingredient shave beenput in to the mixer.When hand mixing is permitted by the Architect and Engineer-in-charge for small jobs or for certain other reasons, it shall be done on asmooth watertight platform large enough to allow efficient turning over the ingredients of concrete before and after adding water. Mixingplatforms shall be so arranged that no foreign material gets mixed with concrete nor does the mixing water flow out. Cement in requirednumber of bags shall be placed in a uniform layer on top of the measured quantityoffineandcoarseaggregate,whichshallalsobespreadinalayerof uniformthicknessonthemixingplatform.Dry coarse and fine aggregate and cement shall then be mixedthoroughly by turning over to get a mixture of uniform colour. Specified quantity of water shall then be added gradually through a rose-canand the mass turned over till a mix of required consistencyisobtained.Inhandmixing,quantityofcementshallbeincreasedby10%abovethatspecified.Mixers, which have been out of use for more than 30 minutes, shall be thoroughly cleaned before putting in a new batch. Unlessotherwise agreed to by the Architect and Engineer-in-charge, the first batch of concrete from the mixture shall contain only 2/3rds ofnormal quantity of coarse aggregate. Mixing plant shall be thoroughly cleaned before changing from one type of cement toanother.Consistency : The degree of consistency which shall depend upon the nature of the work and methods of vibration of concrete, shallbe determined by regular slump tests in accordance with IS : 1199-1959. The slump of 10 mm. to 25 mm. shall be maintained forworkability. The concrete shall be compacted with vibrator -needle or surface type depending on the nature of application.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
97
blan k
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
98
Title – PCC & RCC Works Sheet 3 OF 6
Inspection: Contractor shall give the Architect and Engineer-in-charge due notice before placing anyconcrete in the forms, to permit him to inspect and accept the false work and forms as totheir strength, alignment and general fitness but such inspection shall not relieve theContractor of his responsibility for the safety of men, machinery, materials and for resultsobtained. Immediately before concreting, all forms shall be thoroughly cleaned. Contractorshall proper access with railing for inspection ofwork.Centering design and its erection shall be got approved from the Architect and Engineer-in-charge. One carpenter with helper shall invariably be kept present throughout the period ofconcreting. Movement of labour and other persons shall be totally prohibited afterreinforcement is laid in position. For access to different parts, suitable mobile platforms shallbe provided so that steel reinforcement in position is not disturbed. For ensuring propercover, mortar blocks/ PVC cover of suitable size and thickness as per the drawing shall betied to the reinforcement. Timber, kapachi or stone pieces shall notbeusedforthispurpose.ForexposedconcretemembersPVCblocksofgreycolorshallonlybeused.All formwork shall be cleaned and made free from standing water, dust, snow or iceimmediately before placing of concrete. No concrete shall be placed in any part of thestructure until the approval of the Architect and Engineer-in-charge has been obtained.Formwork for Exposed concrete surface (Ifindicated):All vertical members for formwork shall be of steel like acroprops, H frame etc. Care shall be taken to set all formwork in perfectline, level (or in required camber or slope as specified) and plumb. Formwork propping shall be strong, rigid and sturdy. The formworkshall be as per pattern &design shown in drawings. Formwork shall be done accurately and precisely so as to achieve neat, clean andsmooth concrete surface, in line, level and plumb. Clinks, twists, offsets, warps, riveting etc. in plates or forms shall not be allowed. Beforeplacing concrete, forms shall be thoroughly cleaned off of all rust, dust and loose materials. Mould release agent of approved make or asper the Architect / Engineer incharge shall be applied on sheathing before placing the reinforcement steel. Also the formwork materialwill be of laminated plywood/best quality steel sheathing or any sort of such material, as approved by the Architect, so that all exposedconcrete surfaces have uniform colour and texture. After deshuttering, all concrete surfaces shall be properly rendered with sand paperor emery stone. Thesampleoftheexposedconcreteshallbegotapprovedbythearchitectorengineerinchagre
For walls and columns, the sheathering plates shall be bolted with special nuts and bolts- spring coils and PVC cone spacer.No through bolts shall be allowed.For all kind of exposed concrete work only one brand (to be approved by the Architect or Engineer-in-charge) of cement shallbeused.
For exposed concrete element specified in the drawing, steel shuttering made out of CR MS sheet not lessthan 2mm thickness (14 guage) or laminated plywood with steel supporting frame work shall beusFor other concrete shuttering material shall be as follows: Columns: Moulds from marine ply with wooden battens or steelplates Straight walls / Curved wall in plan: Marine plywood with wooden battens / Acro make or equivalentmake steel plates andsoldiers. Beam: steel plates and marine ply withbattens
Transportation, laying andcompaction: The method of transporting and placing concrete shall be as approved by Engineer-incharge.Concrete shall be sotransportedandplacedthatnocontamination,segregationorlossofitsconstituentmaterialtakesplace. Concreting shall proceed continuously over the area between construction joints. Freshconcrete shall not be placed against concrete, which has been in position for more than 30minutes, unless a proper construction joint is formed. Concrete shall be compacted in its finalposition within 30 minutes of its discharge from the mixer. Except where otherwise agreed toby the Architect and Engineer in-charge, concrete shall be deposited in horizontal layers to acompacted depth ofnotmorethan0.45m.wheninternalvibratorsareusedandnotexceeding0.3m.inallothercases.Unless otherwise agreed to by the Architect and Engineer-in-charge, concrete shall not bedropped into place from a height exceeding 2 m. when trunking or chutes are used they shallbe kept closed and used in such a way so as to avoid segregation. When concreting has to beresumed on a surface, which has hardened, it shall be roughened, swept clean, thoroughlywetted and covered with a 13-mm. thick layer of mortar composed of cement and sand in thesame ratio as in the concrete mix itself. This 13-mm. layer of mortar shall be freshly mixed
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
99
Title – PCC & RCC Works Sheet 4 OF 6
bristle brushes, care being taken to avoid dislodgment of any particles or coarse aggregate. The surface shall then be thoroughlywetted, all free water removed and then coated with neat cement grout. The first layer of concrete to be placed on this surfaceshall not exceed 150 mm. in thickness and shall be well rammed against old work, particular attention being given to cornersand close spots.Allconcreteshallbecompactedtoproduceadensehomogeneousmasswiththeassistanceofneedleorsurfacevibrators/ iron ranmmer, unless otherwise, permitted by the Architect and Engineer-in-charge forexceptional case, such as concreting under water, where vibrators cannot be used. Sufficientvibrators in serviceable condition shall be kept at site so that spare equipment is always available inthe event ofbreakdowns.Concrete shall be judged to be compacted when the mortar fills the spaces between the coarseaggregate and begins to cream upto form an even surface. Compaction shall be completed before theinitial setting starts i.e. within 30 minutes of addition of water to dry mixture. During compaction, itshall be observed that needle vibrators are not applied on reinforcement, as it tends to destroy thebond between concrete andreinforcement.
Curing : Immediately after placing and compaction, concrete shall be protected from weather, including rain, runningwater, shocks, vibration, traffic, rapid temperature changes, frost and drying out process. After 24 hours it shall be coveredwith wet sacking basin or other similar absorbent material approved soon after the initial set and shall be keptcontinuously wet for a period of not less than 14 days from the date of placement. Masonry work over foundationconcretemaybestartedafter48hoursofitslayingbutcuringofconcreteshallbecontinuedforaminimumperiodof14 days.Sampling and testing of concrete:The contractor shall set up a site laboratory to carry out various tests as specified. The laboratoryshall include equipments like cube testing machine, slump cone, cube moulds for concrete andmortar, mechanical balance, sieve set, flakiness testing apparatus, core cutteretc.
Samples from fresh concrete shall be taken as per IS : 1199 and cubes shall be made, cured andtested at 7 days or 28 days as per requirements in accordance with IS : 516. A random samplingprocedure shall be adopted to ensure that each concrete batch shall have a reasonable chance ofbeing tested i.e. the sampling should be spread over the entire period of concreting and cover allmixing units. The minimum frequency of sampling of concrete of each grade shall be in accordancewith following:----------------------------------------------------------------------------------------------------------------------------- ------------------------Qty. of concrete inthework No. of samples of concrete for testing at 28day-----------------------------------------------------------------------------------------------------------------------------------------------------1-5m3. 16-15m3. 216-30m3. 331-50m3. 451andabove 4 + one additional for each additional 50m3or part thereof.----------------------------------------------------------------------------------------------------------------------------- -----------------------NOTE : Atleast 1 sample shall be taken from each shift. Three test specimens shall be made for each sample for testing at28days.Additionalsamplesmustbetakentodeterminestrengthat7or3daysoratthetimeofstrikingtheformwork,orto determine theduration of curing, or to check the testing error. The samples of concrete shall be taken on each day of the concreting as perabove frequency. The number of specimens may be suitably increased as deemed necessary by the Architect and Engineer-in-charge when procedure of tests given above reveals a poor quality of concrete and in other specialcases.
3.7.2 The test results of the sample shall be average of the strength of 3 specimens. The individual variation shall not be 15% of theaverage strength of the sample. The compressive mean strength for the group of 4 non-overlapping consecutive test results
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
100
Title – PCC & RCC Works Sheet 5 OF 6
concrete has sufficiently hardened. Centering shall be gradually and uniformly lowered in such manner as to permit theconcrete to take stress due to its own weight uniformly and gradually. Where internal metal ties are permitted, they or theirremovable parts shall be extracted without causing any damage to the concrete and remaining holes filled with mortar. Nopermanently embedded metal part shall have less than 25 mm covers to the finished concrete surface. Where it is intended tore-use the formwork, it shall be cleaned and made good to the satisfaction of the Architect and Engineer in-charge. Afterremoval of formwork and shuttering the Engineer-in-charge shall inspect the work and satisfy by random checks that concreteproduced is of good quality.The number of props left under, their sizes and disposition shall be such as to be able to safelycarry the full load of theslab,beamorarchasthecasemaybetogetherwithanyliveloadlikelytooccurduringcuringorfurtherconstruction.Immediately after the removal of forms, all exposed bolts etc. passing through the cementconcrete member and used for shuttering or any other purpose shall be cut inside the cementconcrete member to a depth of atleast 25 mm. below the surface of the concrete and the resultingholes be filled by cement mortar. All fine mortar lines caused by form joints, all cavities producedby the removal of form ties and all other holes and depressions honeycomb spots, broken edgesor corners and other defects shall be thoroughly cleaned saturated with water and carefullypointed and rendered true with mortarofcementandfinesand.Considerablepressureshallbeappliedinfillingandpointingtoensurethoroughfillinginall voids.Surfaces, which are pointed, shall be kept moist for a period of 24 hours. For repairing concretemembers, suitable bonding agent shall be used as directed by theconsultant.
3.8.4 If rock pockets/honeycombs in the opinion of Architect and Engineer-in-charge are of such an extent or character so as toeffectthestrengthofthestructure,materiallyortoendangerthelifeofthesteelreinforcement,hemaydeclaretheconcretedefectiveandrequiretheremovalandreplacementoftheportionofthestructureaffectedwithnoextracost.3.9 Incase contractor intends to use Ready Mix Concrete (RMC), contractor shall submit specifications for RMC and obtain priorapproval from theengineer-incharge.
Mode of Measurements and Payment:
The consolidated cubical contents of concrete work as specified in item shall be measured. The concrete laid in excess ofsectionshownondrawingorasdirectedshallnotbemeasured.Nodeductionshallbemadefor:(asperSP27)a. Ends of dissimilar materials such as joists, beams, posts, girders, rafters, purline trusses, corbels and steps etc. upto500 cm2. insection.b. Architectural openings upto 0.1m2.c. Noextralabourshouldbepaidforformingsuchopenings,voidsorpocketsofanyshape.
The rate includes cost of all materials, labour, tools and plant required for mixing, placing in position, vibrating and compacting,finishing as directed, curing and all other incidental expenses for producing concrete of specified strength, forallfloors,allshapesatanyheightandlevel,andinanyposition.Therateshallbeforaunitofonem3.Thecostoftheformworkshallbeincludedorexcludedaspertheitemdescription.
Providingandlayingbrickbatcementconcreteandcuringcompleteincludingcostofformworkifrequiredina) 1:3:6(1cement:3coarsesand:6gradedbrickbats40mm-maximumnominalsize.)b) 1:4:8 ( 1cement: 4 coarse sand: 8 graded brick bats 40mm-maximum nominalsize)
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
101
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
102
Supplying, fabricating and placing in position reinforcement bars of all diameter confirming to IS-1786 reinforcement for RCCstructure / items as per design including transporting steel to the work site, handling wastage, decoiling, cutting, bending,cranking, fabricating to required shape, placing in position, binding with 18 gauge (1.22 mm) MS wires, welding if necessary byusing approved welding rods etc. for all levels etc. complete as directed by the engineer-in-charge. The quoted rate should beinclusive the cost of binding wire and the same will not be measured and paid separately. (Rolling margin’s and wastage shallnot be paid.) Measurement will be made on the length basis and converted into weight by using standard co-efficient) (For allcivil, plumbing & electricalworks.)
a) Mild steel reinforcement, yield stress not less than 250N/mm2b) HighyielddeformsteelbarsFe-415,yieldstressnotlessthan415N/mm2c) TMT bars- Fe-415, yield stress not less than 415N/mm2 d)TMT bars Fe- 500, yield stress not less than 500N/mm2e) TMTbarsFe-550,yieldstressnotlessthan550N/mm2f) TMTbars-CRSFe-500,yieldstressnotlessthan500N/mm2g) TMTbars-CRSFe-550,yieldstressnotlessthan550N/mm2
2 Materials : Mild steel bars shall conform to M-18. GI binding wires to M-21. High yield deform steel M-19A. TMTM19B.Workmanship :
The work shall consist of furnishing and placing reinforcement to the shape and dimensions, as shown on the drawings orasdirected.The type of reinforcement shall be as per the item description. The contractor shall submit the test certificate from steel
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
103
Bar bending schedule shall be made by the contractor before starting the work. The payment shall be done based onquantityworkedoutinbarbendingschedule.ThebarbendingscheduleshallbepreparedasperSP34.MildSteel:
Reinforcing steel shall conform accurately to the dimensions given in the bar bending schedules shown on relevant drawings. Barsshall be bent cold to specified shape and dimensions or as directed using a proper bar bender, operated by hand or power to attain properradius of bends. Bars shall not be bent or straightened in a manner that will injure the material. Bars bent during transportation orhandling shall be straightened before being used on the work. They shall not beheatedtofacilitatebending.Unlessotherwisespecified,aUtypehookattheendofeachbarshallinvariablybeprovidedto main reinforcement. Theradius of the bend shall not be less than twice the diameter of the round bar and the length of straight part of the bar beyond the end ofthe curve shall be atleast 4 times the diameter of the round bar. In case of bars which are not round and incase of deformed bars, thediameter shall be taken as the diameter of circle having anequivalenteffectivearea.Thehooksshallbesuitablyencasedtopreventanysplittingoftheconcrete.High yield strength deformedsteel:
The specification of TMT/HYSD steel shall be same as mild steel bars. The bars shall be used with or without hooks at the ends.Deformed bars without hooks shall comply with relevant anchoragerequirements.TMTbars
The specification of TMT steel shall be same as mild steel bars. The bars shall be used with or without hooks at the ends. Deformedbars without hooks shall comply with relevant anchoragerequirements.All the reinforcement bars shall be accurately placed in exact position shown on the drawings and shall be securely held in positionwith 16 Guage GI binding wire of size not less than 1mm as approved by Engineer-in-charge. The rebars shall be placed with stay blocksor metal chair spacers, metal hangers, supporting wires or other approved devices at sufficiently close intervals. Bars shall not be allowedto sag between supports nor displaced during concreting or any other operations of the work. All devices used for positioning shall be ofnon-corrodible material. Wooden and metal supports shall not extend to the surface of concrete, except where shown on drawing. Placingbars on layers of freshly laid concrete as the work progresses for adjusting bar spacing shall not allowed. Pieces of broken stone or brickand wooden blocks shall not be used. Layers of bars shall be separated by spacer bars, Precast mortar blocks or PVC cover blocks shall beused to maintain the cover of the concrete members as directed by Engineer-in-charge. Reinforcement after being placed in position shallbe maintained in a clean condition until completely embedded in concrete. Special care shall be exercised to prevent any displacement ofreinforcement in concrete already placed. To prevent reinforcement from corrosion, concrete cover shall be provided as indicated ondrawing. All the bars projecting from concrete and to which other bars are to be spliced andwhichare likelytobe exposed fora periodexceeding10 days shall beprotectedbya thickcoatofneatcement grout.
Bars crossing each other where required shall be secured by 16 guage GI binding wires (annealed) of size not less than 1mm.,insuchmannerthantheydonotslipovereachotheratthetimeoffixingandconcreting.As far as possible, bars of full length shall be used. In case this is not possible, overlapping of bars shall be done asdirected.Wheredirected,wherepracticable,overlappingbarsshallnottoucheachother,butbekeptapartby25mm.or1.25 times the maximum size of the coarse aggregate, whichever is greater by concrete between them. Where not feasible,overlapping bars shall be bound with annealed wires not less than 1 mm. thick, twisted tight. The overlaps shall be staggered fordifferent bars and located at points along the span where neither shear nor bending movement is maximum in beam andslab.Whenever indicated on the drawings or desired by the Engineer-in-charge, bars shall be joined by couplings which shall have across section sufficient to transmit the full stresses of bars. The ends of the bars that are joined by coupling shall be upset forsufficient length so that the effective cross sectional the base of threads is not less than normal cross section of the bar. Threadsshall be standard threads. Steel coupling shall conform to IS :226.When permitted or specified on the drawings, joints of reinforcement bars shall be welded with appropriate welding rod as per
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
104
Title – PCC & RCC Works Sheet 6 OF 6
welding. It shall be ensured that no voids are left in welding and when welding is done in 2 or 3 stages, previous surface shall becleaned properly. Ends of the bars shall be cleaned of all loose scale, rust, grease paint and other foreign matter before welding.Only competent welders shall be employed on the work. The M.S electrodes used for welding shall conform to IS : 814. Weldedpieces of reinforcement shall be tested. Specimen shall be taken from the actual site and their number and frequency of test shallbe as directed.Atthetimeofconcreting,abarfittershallremainatsitetokeepthereinforcementinposition.Bars shall be bent cold to specified shape and dimensions or as directed using a proper bar bender, operated by hand or power to attainproper radius of bends. Bars shall not be bent or straightened in a manner that will injure the material. Bars bent during transportation orhandling shall be straightened before being used on the work. They shall not be heated to facilitate bending. Unless otherwise specified, aU type hook at the end of each bar shall invariably be provided to main reinforcement or as shown in the drawing. The radius of the bendshall not be less than twice the diameter of the round bar andthelength of straight part ofthebar beyondtheendofthecurveshallbeatleast4timesthediameter oftheroundbar. In case of bars which are not round and incase of deformed bars, the diameter shall be taken as thediameter of circle havinganequivalenteffectivearea.Thehooksshallbesuitablyencasedtopreventanysplittingoftheconcrete.Steel shall be clean and free from rust and loose mill scale, at the time of fixing in position and subsequentconcreting.
Mode of Measurements and Payment:
Reinforcement shall be measured in length including overlaps, separately for different diameters as actually used in the work. Wherewelding or coupling is resorted to in place of lap joints, such joints shall be measured for payment as equivalent length of overlap as perdesign requirement. From the length so measured, the weight of reinforcement shall be calculated in tones by using standard IS co-efficient. Length shall include hooks at the ends. The wastage of steel and binding wires shall not be measured and the cost of these itemsshall be needed to be included in the rate for reinforcement. The rolling margin of steel shall not be paidextra.The rate for reinforcement shall include cost of GI binding wires, cutting, bending, transporting steel to the work site, loading,unloading, placing in postion and tying / binding, for all floors/ all levels / all heights as shown on the drawings and as directed. It shallalso include all devices like chairs, pins etc. for keeping reinforcement in approved position, cost ofjoiningasperapprovedmethodandallwastage,coversandspacerbars.TherateshallbeforaunitofoneMT.
2.08.c.a Extra over (only for labour) item TMT FE-500 bars for work of Jacketting.
Relevant specifications of 2.08.c shall be followed. Rates quoted shall only be for the additional labour requiredforJackettingworks.Itemwillbemeasuredandpaidasperitem2.08.c.
Labour charges for fabricating and fixing in position steel reinforcement for RCC structures as per design including handling atsite, cutting, bending and binding with wires, welding if necessary etc. for all floors complete as directed by Engineer.Measurement will be made on the length basis and converted into weight by usingstandardISco-efficient(rollingmargin’sandwastagewillnotbepaid).
The reinforcement shall be
a) Mild steel reinforcement, yield stress not less than 250N/mm2b) HighyielddeformsteelbarsFe-415,yieldstressnotlessthan415N/mm2c) TMTbarsFe-500,yieldstressnotlessthan500N/mm2d) TMTbarsFe-550,yieldstressnotlessthan550N/mm2
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
105
Title – Centering & Formwork Sheet 1 OF 4
Providing form work rigid and water tight, centering and shuttering using best quality of ordinary timber plankingand/or shuttering plywood /steel plates with supporting system of MS adjustable steel props
/Hframe/spans/FramesforallRCCworksallheights/alllevels/alldepths/allfloorsinhorizontal/vertical/slanting surfaces of any shape and size including strutting, propping, bracing, staging etc. complete, so asto give smooth/ fair finish and careful removal of formwork etc. complete all as per specifications anddirection of Engineer-in-charge. The Height of propping and centering below supporting as specifiedbelow. For all civil, plumbing &electricalworks.
a) Basement Height up to 4.75mb) 0.00 to 7.5 mtrs for Ground floor, First floor &Above allFloors. c) -Do-asabovebutheightabove7.5mtr.Upto10.0mtr.d) -Do- as above but height above 10.0 mtr. Up to 25.0 mtr.
Materials:Shuttering plywood shall conform to M-26B and M26C. The thickness of the plywood sheathing shall be as per the shape andsize of the concretemember.The dimensions of scantling and battens shall conform to the design. The strength of the wood shall not be less than thatassumed in thedesign.ContractorsshalldesigntheformworkandgetitapprovedbytheEngineer-incharge.
Workmanship :The formwork shallconformtotheshape,linesanddimensionsasshownonthedrawingsandshallbesoconstructed so as toremain sufficiently rigid and water-tight, during the placement and compaction of the concrete. Adequate arrangement shall bemade by the Contractor to safe guard against any settlement of the formwork during the course of concreting and afterconcreting. The formwork of shuttering, centering, scaffolding, bracing, etc. shall be as per the design and shall be made fromshuttering plywood with batten/ steel plates and steel supporting system. In case of double height, false staging should beerected preferably with Acro-props &spans or Hframes.Cleaning &Treatment of Forms : All rubbish, particularly chipping, shaving and saw dust shall be removed from theinterior of the form before the concrete is placed and the formwork in contact with concrete shall be cleaned thoroughly. Thesurface shall be coated with approved release agent as directed by Engineer Incharge or Architect.Careshallbetakenthatthecoatingisnotappliedontheconstructionjointssurfaceandsteelreinforcementbars.Stripping Time : In normal circumstances and where ordinary portland cement is used, formwork may be struck afterexpiry of the following periods:
(a) Sides of walls columns and vertical facesofbeams 16 to24hours.(b) Slab soffit (props to be refixed immediately after removalof formwork) 3days(b) Beam soffits (Propsleft under) 7days.(c) Removal of props forslabs- (i) Slabs spanning upto4.5m. 7days.
(ii) Slabs spanning over4.5m. 14days.(d) Removal of props to beams andArches- (i) Spanning upto6m. 14days.
(ii) Spanning over6m. 21Days.Procedure while removing the formwork : All formwork shall be removed without such shocks or vibrations as woulddamage the reinforced concrete surface. Before the soffit formwork and struts are removed, the soffits and theconcretesurfaceshallbeexposedwherenecessary,inordertoascertainthattheconcretehassufficientlyhardened.Centering: The centering to be provided shall be got approved. It shall be sufficiently strong to ensure absolute safety of the
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
106
Title – Centering & Formwork Sheet 2 OF4
is a failure of formwork or centering, the Contractor shall be responsible for the damages to the work, injury tolife and damage to property.2.5.4 For walls, columns and beams, the shuttering plates on either side shall be bolted withtierodsmade from spring coils on either side, welded with two nos 8mm MS rods. PVC coneshall be placed on either side of the tie rod. The whole tie rod assembly along-with PVC coneshall be placed/fixed with special type of bolts on either side of the shuttering plates. Length ofthe tie rod along-with PVC cone shall be equal to the width / thickness of the element tobeshuttered.Scaffolding:
All scaffolding, hoisting arrangements and ladders, etc. required for facilitating ofconcreting shall be provided and removed on completion work by Contractor, at hisown expense. The scaffolding, hoisting arrangement, ladders etc.shallbestrongenoughtowithstandalllive,deadandimpactloadsexpectedtoactandshallbesubjecttotheapproval of the Architectand Engineer-in-charge. However, Contractor shall be solely responsible for the safetyof the scaffolding, hoisting arrangement, ladders, work and workmen, etc.The scaffolding, hoisting arrangements and ladders shall allow easy approach to thework spot and afford easy inspection.
Reuse : Before re-use, all forms shall be inspected by the Engineer-in-charge and their suitability shall be ascertained.If,anyoftheformsarefoundtobeunsuitable,theyshallbeimmediatelyremovedfromthesite.Theformsascertained for re-use, shall bescarred, cleaned, and joints gone over and repaired, wherever required. The inside surface shall be retreated to preventadhesion toconcrete.Mode of Measurements and Payment:Formwork shall be measured as an area in m2. of shuttering in contact with concrete except in the case of inclinedmembersandportionofcurvedpro-files,inwhichcase,onlyareaofundersideshallbemeasuredforpayment.Formwork to secondary beams shall be measured upto the sides of main beams but no deduction shall be made from theformwork of the main beam at the inner section point. No deduction shall be made from the formwork of a column at innersection ofbeams.The rate is applicable to all conditions of working and unsupported height between the slabs upto 4.5 m. The rate shallincludethecostofmaterials,itstransportationatsiteandlabourforvariousoperationsinvolvedsuchas:
(a) Splayed edges, notching, allowance for overlaps and passing at angles, battens centering, shuttering,strutting, propping, bolting, nailing, wedging, easing, striking andremoval.(b) Filleting to form stop chamfered edges or splayed external angles not exceeding 20 mm. width tobeams, columns and thelike.(c) Temporary opening in the forms for pouringconcrete.(d) Scarring, removal of rubbish, dressing with mould release agent to prevent adhesion of concrete withshuttering,(e) Raking or circularcutting.(f) Making necessary grooves, gishis, Architectural cut-outs, pockets and dripmoulds.
The rate is for the completed item.Therateshallbeforaunitofonem2.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
107
Title – Centering & Formwork Sheet 3 OF4
The false staging work for double height shall be designed by contractor so that it shall be able to resist forces like live load,dead load, impact load, lateral loads or any other incidental loads and get it approved by Engineer-inchargebeforestartingthecenteringwork.Vertical members shall be placed directly over those below or shall be so designed and placed that the load shallbe transmitted directly to them. Proper horizontal and diagonal bracing in both the directions and at both the stages shallbe provided. The completed false staging work for double height formwork shall be gotinspectedbyandgotapprovedbyEngineer-inchargebeforeplacingthereinforcementbar.If there is a failure of formwork or centering/staging, contractor shall be solely responsible for the damage of thework,injuryoflifeanddamagetoproperty.
Mode of Measurements andPayment:
Therateshallbeforaunitofonem2.3.02.b Extra for further additional height of propping and centering where the height of propping
andcentering exceeds 10.0 m. between supporting floor to ceiling including temporary brick or stonepillars for supporting asrequired(heightmorethan10.0mandupto25m)
The relevant specification of item no. 3.02.a shall be followed except that the height of propping and centeringexceeds from 4.5 m. upto 24 m. between supporting floor to ceiling and shall be done with H frames, channels,bracings etc.Extra for providing formwork for exposed concrete surface in desired pattern and size, using laminated shuttering
plywood, including neat cleaning the exposed concrete surface, as directed by the Architect. (Same kind of shutteringmaterial should be only used for standard andresidual sizes.)
(A) Flat surfaces (any thickness) such as soffits of slab, sill slabs, lofts, balconies, sloping slabs, landingetc.(B) Verticalsurfacesuchaswalls(anythickness),partitionsetc.(C) Columns, pillars, posts and struts, (any cross-sectional area), Square, rectangular, circular and multi-facedetc.(D) Beams, lintels, cantilevers, beam haunchings, girders, Arches, (any cross-sectional area), Sides andsoffits of the aboveetc.(E) Edgesofslabs,andbreaks/cut-outsinfloorsandwallsetc.(F) Small surfaces such as cantilever ends, brackets, ends of steps, caps, copings and bases to pillarsand columns including edgesetc.(G) Collar woods, weather sheds, chhajjas, cornice, corbellings, domes, vaults,etc.(H) Stair cases with sloping or steeped soffits, including risers, skingers, excluding landingetc.(I) Vertical fins and vertical sun breakersetc.
1.0 Materials and Workmanship: The relevant specification of item No.3.01 shall be followed except thatthelaminated shuttering plywood shall be used instead of ordinary shuttering plywood / steel sheathing, to obtaina desired smooth exposed surface finish. The surface shall be rendered and touched up to the satisfaction of theEngineer incharge.Theexposedsurfaceshallbeindesiredpatternandsizeasperthedrawing.Theshutteringshallhaverestrictedreuse toobtain good surface finish. Before re-use, all forms shall be inspected by the Engineer-in-charge and theirsuitability shall be ascertained. If, any of the forms are found to be unsuitable, they shall be immediately replaced.Only similar typeofmaterialshallbeusedfortheentirework.Thesurfaceshallbepresentable withoutfurthertreatment.For walls, columns and beams, the shuttering plates on either side shall be bolted with tie rods
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
108
Title – Centering & Formwork Sheet 4 OF 4
Therateshallbeforaunitofonem2.The rate shall include the rendering and touch upwork.Extra for providing formwork for exposed concrete surface in desired pattern and size, using best quality Steel plates
and steel sheeting, including neat cleaning the exposed concrete surface as directed by the Architect. (Same kind ofshuttering material should be only used for standard and residualsizes.)
(A) Flat surfaces (any thickness) such as soffits of slab, sill slabs, lofts, sloping slabs, landingetc.(B) Verticalsurfacesuchaswalls(anythickness),partitionsetc.(C) Columns, pillars, posts and struts, (any cross-sectional area), Square, rectangular, circular and multi-facedetc.(D) Beams, lintels, girders, Arches, (any cross-sectional area), Sides and soffits of beams, beam haunchings,cantilevers, girders and lintelsetc.(E) Edgesofslabs,andbreaks/cutoutsinfloorsandwallsetc.(F) Small surfaces such as cantilever ends, brackets, ends of steps, caps, copings and bases to pillars andcolumns including edgesetc.(G) Collar woods, weather sheds, chhajjas, cornice, corbellings, domes, vaults,etc.(H) Stair cases with sloping or steeped soffits, including risers, skingers, excluding landingetc.(I) Vertical fins and vertical sun breakersetc.
1.0. Materials and Workmanship : The relevant specification of item No.3.01 shall be followed except that theextrarate shall be paid for using best quality sheathing of steels and/or plates of steel instead of ordinary shutteringplywood/normalsteelsheathingandplates,toobtainadesiredsmoothexposedfinishofsurface.Thesurfaceshallberendered andtouched up to the satisfaction of the Engineer incharge. The exposed surface shall be in desired pattern and size asper the drawing. The shuttering shall have restricted reuse to obtain good surface finish. Before re-use, all forms shallbe inspected by the Engineer-in-charge and their suitability shall be ascertained. If, any of the forms are found to beunsuitable, they shall be immediately replaced. Only similar type of material shall be used for the entire work. Thesurface shall be presentable without furthertreatment.For walls, columns and beams, the shuttering plates on either side shall be bolted with tie rodsmade from spring coils on either side, welded with two nos. 8mm MS rods. PVC cone shall beplaced on either side of the tie rod. The whole tie rod assembly along-with PVC cone shall beplaced/fixed with special type of bolts on either side of the shuttering plates. Length of the tie rodalong-with PVC cone shall be equal to the width / thickness of the element to be shuttered.
Mode of Measurements and Payment:The measurement of formwork shall be taken for the formwork done with best quality steel sheathing, extra over the rate offormwork of the respective item of formwork done. The relevant specification of respective item No. 3.01 shall befollowed.Therateshallbeforaunitofonem2.The surface, which is shown exposed in the drawing, shall only be paidfor.The rate shall include the rendering and touch upwork.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
109
Title – Masonry Works Sheet 1 OF 3
(I) BRICKWORK:
Providing and laying Bricks masonry works using common burnt clay conventional building bricks confirming to IS1077-1986 of having crushing strength not less than 50 Kg/cm2. in foundation and plinth, in CM 1:6 (1 cement :6 findsand), in any shape & all depth, including curing, scaffolding, racking / flush jointingetc.complete,asdirected.Forallcivil,plumbing&electricalworks.a)Infoundationsandplinth,alllocationandshapes
i) C.M1:4ii) CM1:5iii) CM1:6
1.0 Materials : Water shall conform to M-1. Cement to M-3. Sand to M-6. Brick to M-15. Cement mortar toM-11.Workmanship :
Proportion : The proportion of the CM shall be as mentioned in the item description (cement : coarse sand), by volume.Soaking of bricks : The bricks required for masonry shall be thoroughly wetted with clean water for about 24 hours beforeuse or as directed. The cessation of bubbles, when the bricks are wetted with water is an indication of thorough wetting of bricks.Laying:Bricks shall be laid in English bond unless directed otherwise. Half or cut bricks shall not be used except when necessary tocomplete the bond; closer and in such case it shall be cut to required size and used near the ends of walls.A layer of mortar shall be spread on full width for suitable length of the lower course. Each brick shall first be properly beddedand set home by gently tapping with the handle of the trowel or wooden mallet. Its inside face shall be flushed withmortar before the next brick is laid and pressed against it. On completion of the course, the vertical joints shall befully filled from the top, withmortar.
The walls shall be taken up truly in plumb. All courses shall be laid truly horizontal and all vertical joints shall betruly vertical. Vertical joints in alternate courses shall generally be in one vertical plane. The thickness of brickcourse shall be keptuniform.The bricks shall be laid with the frog facing upwards. A set of tools comprising of wooden straight edges, manson'sspirit level, square half meter rub (right angle), pins, string, level pipe and plumb shall be kept on the site of work forfrequent checking during the progress ofwork.
Both the faces of walls, having thickness greater than 23 cm. shall be kept in proper plumb. All the connected brick work shall bekept not more than 1 m. over the rest of the work. Where this is not possible, the work shall be rakedbackaccordingtobond(andnotlefttoothed)atananglenotsteeperthan45O.Inadaybrickworkshallnotbelaidmore than 1m or 10 courses in height.Allthefixtures,pipeoutletsofwater,etc.which arerequiredtobebuiltinthewallshallbeembeddedinCM,asperthe drawings or asdirected. The frames of doors, windows, cupboards, etc. shall be housed into the brick work at the correct location and level, asdirected. The heavy steel doors, windows frames, etc. shall be built in with brick work, but for ordinary steel doors and windows,required opening for frames, hold-fasts, etc. shall be left in the wall and framesshallbeembeddedlateroninordertoavoiddamagetotheframes.Necessary scaffolding shall be provided by the Contractor. The supports of the scaffolding shall be sound and strong, tied
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
110
Sheet 2 OF 3Title – Masonry Works
joints shall be raked out as directed by raking tools daily, during the progress of work, when the mortar is stillgreen so as to provide key for plaster or pointing to be done, subsequently.Thefaceofbricksshallbecleanedeverydayonwhichthebrickworkislaidandallmortardroppingshallberemoved.At the end of day's work or on holidays the top of unfinished masonry shall be kept wet. If the mortar becomesdry, white or powdery, for want of curing, work shall be pulled down and re-built atContractor's expense.
Curing : Fresh work shall be protected from rain suitably. Masonry work shall be kept moist on all the faces forminimumperiodof7days.Thetopofmasonryworkshallbekeptwellwettedattheendoftheday'swork.Preparation of foundation bed : If the foundation is to be laid directly on the excavated bed, the bed shall be levelled,cleared off of all loose materials, cleaned and wetted before starting masonry work. If masonry is to be laid on concretefooting, the top of concrete shall be roughened, cleaned and moistened. The Contractor shall obtain approval of the Engineer-in-charge for the foundation bed, before foundation masonry is started. When pucca flooring is to be providedflush withthetopoftheplinth,theinsideoftheplinth wall shallbelowereddownhavinganoffsetofthesamethicknessoftheflooringwithrespecttotheoutsideplinthwalltoporasdirected.Mode of Measurements and Payment:
The measurement of this item shall be taken for the brick masonry fully completed in foundation upto plinth for alllevels, heights, shapes and locations as per the item description.. The limiting dimensions not exceeding those shownonthedrawingsorasdirectedshallbefinal.Battered,taperedandcurvedportionsshallbemeasurednet.No deduction shall be made from the quantity of brick work, nor any extra payment shall be made for embedding inmasonry or making holes in respect of following items:
(1) End of joists beams, posts, girders, rafters, purlins, trusses, corbel, steps etc. where cross sectional areadoes not exceed 500cm2.(2) Architectural openings in walls, parapet and compound walls, not exceeding 1.0 m2.area.(3) Wall plates and bed plates, bearing of slabs, chhajjas and the like whose thickness does not exceed 10cm. andthebearingdoesnotextendtothefullthicknessofwall.(4) Drainage holes, recesses for cement concrete blocks to embed hold fasts for doors, windows etc.,forming toothings, grooves etc. and providing cramps for holding stonelining.(5) Iron fixtures, pipes upto 300 mm. dia.; holdfasts and doors and windows built into masonry andsanitary and water supply pipes, etc., for concealed electrical wiring and any other fixtures orinserts.(6) Forming chases of section not exceeding 350 cm2. inmasonry.
Apertures for fire places shall not be deducted nor shall extra labour required to make splaying of jambs, throating andmaking arches over the aperture be paid for separately. The rate shall include for work of any shape e.g. pillars of any size andshape, curved or tapered walls, drip courses, projections, parapets, load bearing walls, sills, ottas, steps, tank walls, platformsand counter walls, ducts, channels and architectural mouldings like corbelling, pattas,etc.Therateshallbeforaunitofonem3.Providing and laying Brick masonry works using common burnt clay conventional building bricks confirming to IS1077-1986 of having crushing strength not less than 50 Kg/cm2., in Super Structure above plinth, for all floor / alllevels / all heights in any shape, in any position, in CM 1:4, including curing, scaffolding, racking ofthejointsetc.complete,asdirected.Forallcivil,plumbing&electricalworks.
The relevant specification of item no. 4.01 shall be followed except that the work to be carried out insuperstructure instead of Foundation and plinth. The rate shall include the cost of scaffolding apart fromthe item no. 4.01.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
111
Title – Masonry Works Sheet 3 OF 3 Sheet 3 OF 3
Relevant specifications of bricks, wetting and laying of brick, joints, curing, etc. shall conform to item no. 4.01 except that the brickwork of half bricks, 115 mm. thick shall be carried out, at all heights, levels, location, shapes etc. ThethicknessandtheC.Mshallbesameasmentionedintheitemdescription.All bricks shall be laid stretcher wise, breaking joints with those in the upper and lower courses. The wall shall be taken truly plumb.All courses shall be laid truly horizontal and all vertical joints shall be truly vertical. The bricks shall be laidwithfrogsupwards.Asetofmason'stoolsshallbemaintainedonworksiteasrequiredforfrequentchecking.MSbars,6mm.dia.,2nos.shallbeprovidedatevery3rdcourse.Theendofreinforcementshallbefullyembeddedin the main wall on bothsides as directed. Reinforcement shall be placed on top of the bottom most course and then on every3rdcourse.Lapshallbeof15cm.Inadaybrickworkshallnotbelaidmorethan1mor10coursesinheight.Thejointsincoursewherereinforcementisplacedshallallowsufficientmortarcovertothereinforcement.Mode of Measurements and Payment:
The half brick masonry work for all heights, levels, locations and shapes shall be measured under this item. The limiting dimensionsshall not exceed those shown in the plan or as directed. Any work done extra over the specified dimensions shall not be measured andpaid for. The rate shall include the reinforcement if it is given in the item description.Therelevantspecificationsofitemno.4.01shallbefollowed.Thelengthshallbemeasurednearesttoonecm.Therateshallbeforaunitofm2.
_
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
112
Title – Aluminum Works Sheet 1 OF 5
ALUMINIUM WORKS
SPECIFICATIONS SECTION `A'
GENERAL
1. DIMENSIONS: Figured dimensions are in all cases to be accepted in preference to scaled sizes. Large scaledetails take precedence over small scale drawings. In case of discrepancy the Contractor shall ask forclarification before proceeding with thework.2. CONTRACTOR TO INCLUDE IN HIS RATES: The Contractor shall include in his rates for all the items listedin thissection.3. CONTRACTOR TO INSPECT SITE: The Contractor shall visit and examine the construction Site and satisfyhimself as to the nature of the existing means of communication the extent and magnitude of the work andfacilities for obtaining materials and shall obtain generally his own information on all matters affecting thework. No extra charge made in consequence of any misunderstanding or incorrect information on any ofthese points or on the ground of Insufficient description will be allowed. All expense incurred by theContractor in connection with obtaining information for submitting this tender including his visits to the Siteor efforts in compiling the tender shall be borne by the Tenderer and no claims for reimbursement thereofshall be entertained.4. ACCESS FOR INSPECTION: The Contractor is to provide at all times during the progress of the works andthe maintenance period proper means of access, with ladders, gangways etc. and the necessary attendanceto move and adapt as directed for the inspection or measurement of the works by the Architects or theirrepresentatives.5. WATER SUPPLY AND ELECTRIC SUPPLY: The rates quoted shall be inclusive of necessary water charges aswell as electricitycharges.6. WATCHMEN: The Contractor shall make arrangements for Watch and Ward, lighting and protecting allmaterialsdayandnightonalldaysincludingSundaysandholidaysathisowncost.7. SHED FOR MATERIALS: The Contractor shall provide for all necessary sheds of adequate dimension forstorage and protection of materials including tools and equipment which are likely to deteriorate by theaction of Sun, Wind, Rain or other natural causes due to exposure in the open. The safe custody of thematerials shall be the sole responsibility of theContractor.
All such sheds shall be cleared away and the whole area left in good order in completion of the contract tothe satisfaction of the Architects or Engineer-in-charge.8. COST OF TRANSPORTING: The Contractor shall allow in his cost for all transporting, unloading, stackingand storing of supplies of goods and materials for this work on the Site and in the places approved from timeto time by the Architect of Engineer-in-charge. The Contractor shall allow in his price for transport of allmaterials controlled or otherwise to theSite.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
113
Title – Aluminum Works Sheet 2 OF 5
All such tradesman shall work under an experienced and properly trained Foreman, who shall becapable of reading and understanding all drawings, pertaining to the work.On completion the Contractor shall clean all the surrounding area of work to the satisfaction of theArchitects.
11. PROTECTION: The Contractor shall protect all doors, windows, curtain wall glazing, etc. work throughoutthe duration of work untilcompletion.12. PREPARATION OF BUILDING FOR OCCUPATION AND USE ON COMPLETION: The whole of the workshall be thoroughly inspected by the Contractor and all deficiencies and defects put right. On completionof such inspection, the Contractor shall inform the Architects or Engineer – in - charge in writing that hehas finishedtheworkanditisreadyfortheArchitect'sinspection.13. RATESTOINCLUDE:Theratesquotedshallbeforallheightsanddepthsandforfinishedwork.14. TESTING OF WORK AND MATERIALS: The Contractors shall if required by the Architects or Engineer –in - charge, arrange to test materials and or portions of the works at his own cost in order to prove theirsoundness and efficiency. If after any such test the work or portion of works is found in the opinion of theArchitects to be defective / Unsound, the Contractor shall pull down and redo the same at his own cost.Defective materials shall immediately be removed from theSite.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
114
Title – Aluminum Works Sheet 3 OF 5
ALUMINIUM DOOR & WINDOWS
Preamble:The rate for various items shall include the following:1. All Aluminium sections shall confirm to IS (India) Alloy Specification -63400.2. Providing &Fixing at all heights / all floors with all leads 25 micron anodized aluminium sections fordoors / windows / glazing manufactured from best extruded aluminium sections from Jindal / Indal andapproved manufactures from make list confirming to IS, cut to length and joints mitered, corners grindedwith joints, water proof the outer frame and shutter frame stiffined with corner angle cleats, stiffeningrod of 10mm provided for in the frame for fixing the frame to RCC columns / masonry sides, RCC lintelson top and PCC sills or floor, the frame work fixed with standard approved fastenings or hinges as perdetails shown in drawings and specifications with all the sections pretreated for removal of any rust andprevention of any furtherrustallcompleteasperspecificationsanddirectionbytheEngineer-in-charge.
The Contractor shall have to give a guarantee bond, for Powder Coating / anodizing, on appropriateStamp paper for a period of 10 years. In this period he shall attend to and rectify all complaints withoutcausing any inconvenience to the Owners/Client. The form of Guarantee Bond shall be as prescribedbelow:"I/We ............... (Contractor) hereby guarantee that work shall remain unaffected and shall not be in anyway damaged by atmospheric conditions, for a period of 10 years after the completion of the work ofPowder Coating / anodizing the aluminium doors as per the terms and conditions of the Contract andguarantees to redo the affected work without claiming any extra cost."
(b) In case of alteration items of M .S. windows standard "Z" sections, M. S. rolled or fabricated sections toany shape including bending as per requirement are to be used matching to the respective aluminiumsections. The windows shall be painted with minimum two coats of spray enamel paint (of approvedmake and shade) over zinc chromate yellow oxide and with steel putty etc. complete as per design,direction and approved sample.(c) The windows and doors are to be fixed with the External finished surface (either stone cladding /external plaster) and hence all the necessary EPDM rubber or wood packing / rough ground, fasteners offisher / hilti, polyurethane backer road of minimum 10mm size, neutral grade silicon weather sealantminimum 10 x 6mm (between the frame and wall or other surface all around) shall be provided withinthe rate quoted so as to makethejunctionsfullywatertight/airtightasperthedrawings.(d) Approved make selected clear glass (clear / frosted) / wired glass of specified thickness (5 to 12mm) asmentioned in the drawings shall be used in doors. Wired glass / frosted glass louvers shall be providedwherever shown in the drawings after grinding theedges.(e) Necessary hardware like locking arrangement with pin cylinder locks, dead locks, mortised locks, SS babylatch (occupied / vacant) SS push / pull or mortised handle, heavy quality hinges / pivot, concealed tower
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
115
Title – Aluminum Works Sheet 4 OF 5
weather or structural with ordinary gun or compressed air operated gun as per the requirement andmaking the joints around aluminium doors, windows curtain wall glazing etc. watertight, on the externalperiphery of thebuildingatthejunctionoftwodifferentmaterialsasdirectedbytheArchitectandsiteengineer.The Contractor shall have to give a guarantee bond, for water tightness, on appropriate Stamp paper fora period of 10 years. In this period he shall attend to and rectify all complaints without causing anyinconveniencetotheOwners/Client.Theform ofGuaranteeBondshallbeasprescribedbelow:"I/We ............... (Contractor) hereby guarantee that work shall remain unaffected and shall not be in anyway damaged by atmospheric conditions, for a period of 10 years after the completion of the work ofapplying sealant and making the joints around aluminium doors watertight, on the external periphery ofthe building at the junction of two different materials as per the terms and conditions of the Contractand guarantees to redo the affected work without claiming any extra cost."
(j) Necessary provision for rain water disposal shall be done in the bottom guides/frames as directed andapproved byArchitect.(k) Offer must be in accordance with detailed drawings with dimensions of aluminium sections in framesand shuttersasshownindrawing.It shallbeaccompaniedbythedetaileddrawingifanydeviationisproposed.(l) The quantities are provisional and may vary to any extent. No claim will be entertained on this accountfor any reason.(m) Double action hydraulic floor springs of approved make with minimum one year guarantee. The floorsprings shall be of least possiblethickness.
The Contractor shall have to give a guarantee bond, for the Hydraulic floor springs, on appropriateStamp paper for a period of 1 year. In this period he shall attend to and rectify all complaints withoutcausing any inconvenience to the Owners/Client. The form of Guarantee Bond shall be as prescribedbelow:"I/We ............... (Contractor) hereby guarantee that the floor springs shall remain unaffected and shall notbe in any way damaged by normal usage, pulls and pushes, for a period of 1 year after the completion ofthe work of supplying &fixing the Hydraulic Floor Springs to aluminium doors as per the terms andconditions of the Contract and guarantees to redo the affected work without claiming anyextra cost."
(n) Details/arrangements for after sales/maintenance services shall befurnished.(o) Workshallbecarriedoutinco-operationandincoordinationwithallotheragenciesworkingatSite.(p) The civil work as required for fixing of floor springs, hold fast or other works required for the erectionand completion of doors/windows etc. shall be done by the Contractor without any extracost.(q) Any damage, if caused to the existing work done by other agencies, shall be reinstated by the Contractorto its original condition without any extracost.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
116
Title – Aluminum Works Sheet 5 OF 5
The Contractor shall have to give a guarantee bond, for the Hydraulic door closer, on appropriate Stamp paper for a periodof 1 year. In this period he shall attend to and rectify all complaints without causing anyinconveniencetotheOwners/Client.Theform ofGuaranteeBondshallbeasprescribedbelow:"I/We ............... (Contractor) hereby guarantee that the hydraulic door closers shall remain unaffected and shall notbe in any way damaged by normal usage, pulls and pushes, for a period of 1 year after the completion of the workof supplying &fixing the Hydraulic Door Closers to aluminium doors as per the termsandconditionsofthecontractandguaranteestoredotheaffectedworkwithoutclaiminganyextracost.".(v) Work shall be measured in clear surface area of doors / windows/ glazing etc., in sq. mtrs and rates to include all costof all the materials including wastages like aluminium sections, glass, compact sheet, wire mesh, hardware likehandles, locks, hinges, aldrops, stoppers, EPDM rubber, silica gel, sealant etc., all complete as per the drawings,specifications & as per the direction of engineer-in-charge. Consolidated rate for materials, hardware &labour to bequoted. Only floor springs &hydraulic closer will be measured separately and paid in relevant tender item.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
117
Title – Plastering and Pointing Sheet 1 OF 4
7.01a Providing and laying average 10mm thick single coat cement finish cement plaster in CM 1:4 on ceilingsand stairsoffits at all floors, all shapes, all heights with necessary scaffolding, curing, making grooves, forming pattas,hacking properly RCC surface etc. complete, with floating coat of cement slurry as directed by the ArchitectandEngineer-in-charge.
1.0 Materials : Water shall conform to M-1. The cement mortar of proportion 1:3 shall conform toM-11.Workmanship :
Scaffolding: Wooden ballies, bamboo, planks, trestles and other Steel scaffolding shall be sound. These shall be properly examinedbefore erection and use. Stage scaffolding shall be provided for ceiling plaster, which shall beindependentofthewalls.Thesampleshallbeapprovedbyarchitectorengineer-inchargebeforestartingthework.Preparation of back ground:
The surface shall be cleaned of all dust, loose mortar droppings, traces of algae, efflorescenceand other foreign matter by water or by brushing. Smooth surface shall be roughened by wirebrushing if it is not hard and by dense hacking if it is concrete. In case of concrete surface, if achemical retarder or shuttering oil has been applied to the form work, the surface shall beroughened by wire brushing and all the resulting dust and loose particles shall be cleaned offand care shall be taken that none of the retarder is left on the surface. Trimming of projectionson brick/concrete surface wherevernecessaryshallbecarriedouttogetanevensurface.Raking of joints in case of masonry wherever necessary shall be allowed to dry out forsufficient period before carrying out theplasterwork.Scaffolding for carrying out plastering work shall be double scaffolding having two sets ofvertical supports so that the scaffolding is independent of thewalls.
Preparation of Surface:
All putlog holes in brickwork and junction between concrete and brickwork shall be properlyfilled in advance. Joints in brick work shall be raked about 10 mm. and concrete surface shallbe hacked to provide grip to the plaster. Projecting burrs of mortars formed due to gaps atjoints in shuttering shall be removed. The surface shall be scrubbed clean with wire brush/coirbrush to remove dirt, dust etc., and the surface thoroughly washed with clean water to removeefflorescence,greaseandoiletc.,andshallbekeptwetforaminimumoftwohoursbeforeapplicationofplaster.For external plaster, the plastering operation shall be started from the top floor and carrieddownwards. For internal plaster, the plastering operations may be started wherever thebuilding frame and cladding work are ready and the temporary supporting ceiling resting onthe wall of the floor have been removed. Ceiling plaster shall be completed before startingplaster towalls.
Applications of Plaster:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
118
Title – Plastering and Pointing Sheet 2 OF 4
2.4.4 Eachcoatshallbekeptdampcontinuouslytillthenextcoatisappliedorforaminimumperiodof7days. Moistening shall commence assoon as plaster is hardened sufficiently. Soaking of walls shall be avoided and only as much water as can be readily absorbedshall be used, excessive evaporation on the sunny or windward side of building in hot air ordryweathershallbepreventedbyhangingmatsorgunnybagsontheoutsideoftheplasterandbykeepingthemwet.Mode of Measurements &Payment:
The rates shall include for work at any height, position, and floor and for all necessary scaffolding, etc. as may be required. The ratesshall also include for hacking and/or bush hammering to form key for plaster and for spatter dash treatment, as specified, as andwherenecessary.The rates shall also include for all work in narrow width, arises, rounded angles, chamfered external angles, drip moulds,grooves and for making good after all trades.Therateshallalsoincludeforgroove with cementfinishupto12mm.x6mm.tobeformedinplasteratjunctionofslab and beam andslab and brick without any extra charge. The rate shall also include for similar grooves in plaster at the junction of masonry andwood or steel door/window/ventilator frame or at bottom of beam/lintels as drip moulds without extracharge.
All plastering shall be measured in m2, unless otherwise specified. Length, breadth or height shall be measured correct to acentimetre.Thickness of the plaster shall be exclusive of the thickness of the key i.e. grooved or open joints in brick work, stone work, etc. or spacebetween laths. Thickness of plaster shall be average thickness with minimum 10 mm., at any point on thesurface.
The measurement of wall plastering shall be taken between the walls or partitions (dimensions before plastering being taken) for lengthand from the top of floor or skirting to ceiling for height. Depth of cover of cornices if any shall be deducted.Soffits of stairs shall be measured as plastering on ceilings. Flowing/folding soffits shall bemeasured separately.For jambs, soffits, sills, etc., openings exceeding 0.5 sqm and not exceeding 3.0 sqm, area deductions and additions shall be made in thefollowing manner:-
(a) No deductions shall be made for end joints, beams, posts, etc. for openings not exceeding 0.5 sqm. each and no additionshall be made for reels, jambs, soffits, sills, etc. of these opening for finish to plaster around ends of joints, beams, posts,etc.(b) Deduction for openings exceeds 0.5 sqm. but not exceeding 3.0 sqm. each shall be made as follows and no addition shall bemade for reveals, jambs, soffits, sills, etc. of theseopenings.(i) Whenbothfacesofanywallareplasteredwithsameplaster,deductionshallbemadeforonefaceonly.(ii) When two faces of any wall are plastered with different types of plasters or if one faces is plastered and the other pointed,deductions shall be made from the plaster or pointing on the side of frame for door, windows, etc. on which width of reveals isless than that on the other side but no deductions shall be made on the other side. Where width of reveals on both faces of allare equal, deductions of 50% of area of opening on each face shall be made from area of plaster and/or pointing as the casemaybe.
For openings having door frames equal to projection beyond the thickness of wall, full deduction for opening shall bemadefromeachplasteredfaceofthewall.Jambs,soffitsandsillsshallbemeasuredseparatelyandpaidfor.In case of openings having area above 3.0 m2 each, full deduction shall be made for the opening but jambs, soffits, and sills shall bemeasuredadditionally.Therateshallbeforaunitofonem2.
7.01b Providing and laying average 10 mm. thick single coat smooth finishing using steel float (mala finish)plaster in CM
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
119
Title – Plastering and Pointing Sheet 3 OF 4
neat cement slurry, mala fininsh without applying neat cement slurry shall be carried out by rubbing aluminium patti and steel troweluntill cement slurry is seen on the surface evenly. Sample shall be got approved by the Engineer-incharge before starting the work. Themode of measurement shall be for a unit of sqm. The mode of measurement and payment shall be as per7.01a7.02a Providing and laying average 15mm. thick single coat cement finish cement plasterin CM 1:3 on sidesof masonry work, at
all floors, all shapes and all heights with necessary scaffolding, curing, making grooves, forming pattas and drip moulds, hackingthe RCC surface etc. complete, with floating coat of cement slurry as directed by the Architect andEngineer-in-charge.
1.0 Materials&Workmanship:Therelevantspecificationsofitemno.7.01ashallbefollowedsameexceptthatthe thicknessshallbe15mm.insteadof10mm.Thesurfaceshallbefinishedsmoothusingneatcementattheratioof2.2 kg/m2.2.2 Mode of Measurements &Payment:
Themodeofmeasurementandpaymentshallbethesameasinitemno.7.01a.Therateshallbeforaunitofonem2.
7.02b Providingandlayingaverage20mmthickdoublecoatsmoothfinishwithsteelfloat(malafinish)plasteron internal surfaces for allfloors / all levels / all heights / all shapes / jambs / sills / soffits / comprising of first coat / base layer of average 12-15mmthick in CM 1:4 (1 cement : 4 coarse river sand) and average 6mm thick uniform coat using steel trovel finish, in CM 1:3 (1cement : 3 sand), including scaffolding, forming grooves, pattas, drip moulds, hacking RCC Surfaces, curing etc. complete., usingspecial tools etc. complete as per specificationsanddirectionofEngineer-in-charge.forallcivil,plumbing&electricalworks.
The relevant specification of 7.01b shall be followed except that the thickness of the plaster shall be 20 mm instead of 10 mm, in two coatsas per the thickness specified in the BOQ.Extra over items of 20mm thick double coat mala finish plaster for interior plastering above floor two level for every additionalstorey height.The relevant specification of 7.02b shall be followed.
7.02c Extraoveritemof20mmthickmalafinishcementplasterforfinishingwithafloatingcoatofneatcementslurry.
1.0 Materials: Water shall conform to M-1. The cement mortar of proportion 1:4 shall conform to M-11. Limeshallconform to M-2. Otherwise,the relevant specifications of item no. 7.02a shall be followed except that the surface shall be finished smooth using lime @ 2.2 kg/m2. Theplastered surface shall be rubbed with small trowel asspecified.d Reductioninitemno.7.02aforprovidingwiredfinishinsteadoffloatingcoatofcementslurry.
The relevant specifications of item no. 7.02a shall be followed except that the surface shall not be finished smooth using cement @ 2.2kg/m2. The rate shall be reduction in the rate for providing wired finish instead of floating coat of cementslurry.Providing &laying average 20 mm. thick cement plaster in two coats at all heights, all shapes and all levels with first coat in CM 1:4 (1
Title – Plastering and Pointing Sheet 4 OF 4
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
120
2.2 Therateshallbeforaunitofonem2.Providing &laying average 18mm thick cement plaster for 230mm brick wall in single coat, CM 1:4 with cement finish cement plaster on
unfair side of brickwork (finished with floating coat of neat cement [email protected]/m2) at all floors, all shapes and all height including scaffolding, curing, making grooves, formingpattas and drip mould,etc. complete asdirected.
The relevant specifications of item no. 7.01a shall be followed except that the plaster is carried out in single layer of 18- mm. thickness, inCM 1:4.Providing &laying average 18mm thick cement plaster for 230mm brick wall in double coat, CM 1:3 with mala finish plaster on unfair
side of brickwork (finished with steel trowel) at all floors, all shapes and all height including scaffolding, curing, making grooves, formingpattas and drip mould, etc. complete asdirected.
The relevant specification of item no. 7.01b shall be followed. Before applying the second coat of plaster, the wall surface shall besprinkled/ sprayed with cement mortar 1:3 to cover the undulation of unfair face of the brickwork. The second coat shall be applied after3 days of curing. The cement mortar proportion of second coat shall be 1:3.7.04.a Providingandlayingaverage18-20mm.thickSandfacedcementplasteronwallsuptoanyheightaboveground level and for all shapes
/ jambs sills / soffits, consisting of first coat / base layer of average 12-15 mm. thick in CM 1:4 (1 cement: 4 coarse sand) andaverage 6 mm. thick uniform grained textured finish coat using wooden Gutka, in CM 1:2 (1 cement: 2 sand), includingscaffolding, forming grooves, drip moulds, pattas, closed hacking RCC surface, curing etc. complete as per specifications anddirection of engineer-in-charge. for all civil, plumbing &electricalworks.
1.0 Materials : Water shall conform to M-1. Cement mortar shall conform toM-11.Workmanship :
The work shall be carried out in two coats. The backing coat (base coat) shall be 12-15mm thick in CM 1:4 ( 1 cement : 4 coarse sand) and therelevant specifications of item no. 7.01a and 7.03 shall be followed. Before the first coat hardens its surface shall be beaten up by edges of wooden tapersand close-wired finish shall be made on the surface. The subsequent coat shall be applied after this coat has been allowed to set for 3 to 5 daysdepending upon the weather conditions. The surface shall not be allowed to dry during this period. Before applying the second coat neat cement slurryshall be applied on the wallsurface.The second coat shall be completed to average 6 mm to 8mm thickness in CM 1:2 as described above. Thesurface shall then be tapered touniform grained texture by using Wooden Gutka/ float only, as specified. The sample of sand face shall be got approved before the work is started. Thewhole work shall be carried out uniformly as per the sample approved.Curing : The curing shall be started overnight after finishing of the plasterwork. The plaster shall be kept wet for aperiodof7days.Duringthisperiod,itshallbeprotectedfromalldamages.Mode of Measurements and Payment:
The relevant specifications of item No.7.01a shall be followed. The rate shall be for all floors, all heights, all levels and allshapes.The rate shall be for a unit of one m2. no extra will be paid for painting of external paint on sand face plaster.(Ref. IS 1200 clause will notbeapplicable.)
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
121
Title – Water Proofing Works Sheet 1 OF 2
Providing and laying cement water proofing of average 115 mm. thick (average) for terraces, balcony and at all floorsusing water proofing compound of approved make in three layers first layer / base coat of 15mm cement mortar using CM 1:3(1 cement : 3 coarse sand) second layer of arranging brick bats in CM 1:3 according to the slope and third layer of 20mmthickness in CM 1:3 (1 cement : 3 coarse sand) including addition of water proofing compound and finishing the top with neatcement @ 2.75kg / m2 and wired finish, including laid to proper slope to drain of water entirely, including rounding of thejunctions and extending them upto 30 cm. including curing, scaffolding for all leads and lifts for all heights / all levels all asper specifications and direction of Engineer - in - charege. The contractor should give a guarantee bond for 10 years as per theformat. The work should be carried out through an approved specialized water proofing agency (unfinished wall to wallmeasurement will be considered only including vata. vata will not be measured and paidseperately).
Providing and laying cement water proofing of average 115 mm. thick for balcony, terrace and all the floors, cleaning andapplying cement slurry with water proofing chemical like Cico no. 1 or equivalent, arranging brick bats in cementmortar 1:5 according to the slope, adding suitable chemical for water-tightness and testing the same after 3 daysponding, providing on top cement mortar 1:3 including waterproofing compound and finishing the top with neatcement slurry @ 2.75kg/m2 as per the directions and instructions, complete at all levels and floors, includingfurnishing a guarantee bond for 10 years. The work should be carried out through an approved specializedagency like India Water Proofing Co. or equivalent (Wall to wall measurement will be considered only includingvata). For all civil, plumbing, electrical & infrastructureworks.
1.0 Materials: WatershallconformtoM-1.CementshallconformtoM-3.SandshallconformtoM-6.Stonegritshall conform to M-8.Brickbats shall conform to M-14. Cement mortar shall conform to M-11. Approved polymer based waterproofing compoundshall be added in cement mortar as per manufacturer's specification (Cico no.1 or equivalent) and shall conform toM-67Workmanship :
Unless otherwise specified proprietary waterproofing treatment shall be executed through M/s. India Waterproofing Co. or approvedequivalent. Contractor shall furnish a guarantee of 10 years on stamp paper to the employer directly and the tender rate shall be inclusive ofthesame.A guarantee bond on appropriately stamp paper shall be given by the contractor to the client in the manner formprescribed below:
FORM OF GUARANTEE BOND
"I/We ......................(Contractor) hereby guarantee that work will remain unaffected and will not be in any way damaged bywater or any other form of humid condition, for a period of 10 years after completion of the work of water-proofing as perthe terms and conditions of the contract and the Contractor hereby indemnifies and agrees to save the Client from any lossand or damage that might be caused on account of water and or other similar form of humid conditions andherebyguaranteestomakegoodanylossordamagesufferedbytheClientandfurtherguaranteestoredotheaffected work withoutclaiming any extracost."This guarantee shall remain in force for a period of 10 years from the completion of the work under the contract and itshallremainbindingtotheContractorforperiodof10years.While tendering the contractors should clearly stipulate the type of treatment proposed to be provided by them and thenameandparticularsoffirmthroughwhomtheyproposetocarryoutthetreatment.The surface shall be cleaned of foreign matter such as fungus, moss, dirt and dust by wire brushing and dusting. Any cracks which mayallow leakage of water shall be identified by ponding before starting the treatment. The slab surface shall be washed withwater and cement slurry with waterproofing compound @ 2.75 kg/m2.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
122
Title – Water Proofing Works Sheet 2 OF 2
Thetestingshallbedonebypondingforatleast48hours.Well defined cracks other than hair cracks in the treated structure shall be cut to `V' section, cleaned and thenfilled up flush with 1:1 cement sand mortar with polymer based waterproofingcompound.The surface under treatment, part of parapet (incase of balcony or terrace) and gutters, drain mouths etc. overwhich the water proofing treatment is to be applied, shall be cleaned of all foreign matter such as fungus, mossand dust by wire brushing anddusting.Drain outlet shall be suitably placed with respect to the surface gradient to ensure rapid drainage andprevention of local accumulation of water on the treated surface. Masonry drain mouth, shall be widenedsufficiently and rounded with cementmortar.Forcastirondrainoutlets,agrooveshallbecutallaroundtotouchthetreatment.When a pipe passes through a roof on which water proofing treatment is to be laid, a cement concrete anglefillet shall bebuiltrounditandthewaterproofingtreatmentshallbetakenoverthefillet.In case of masonry parapet wall over 450 mm. in height, for tucking in the water proofing treatment, ahorizontal groove75mm.wideand65mm.deepatminimumheightof300mm.aboveterracelevelshallbeleftintheverticalfaceatthetimeofconstruction,thehorizontalfaceofthegrooveshallbeshapedwithcementmortar1:4.In case of low parapet where the height does not exceed 450 mm., no groove shall be provided and the waterproofing treatment shall be carried right over thetop.In case of existing R.C.C. and stone wall cutting the chase for tucking in the water proofing treatment is notrecommended.At the junction between the terrace slab and vertical face of the parapet wall, a fillet 75-100 mm. in radius shallbe constructed.At the drain mouths the fillet shall be suitably cut back and rounded off for each application of water proofingtreatment for easy flow ofwater.Outlet at every low dividing wall about less than 300 mm. in height, shall be rounded smooth and cornersrounded off f or easy application of water proofingtreatment.The top surface shall be kept wired finish to receive the china mosaic. In case china mosaic is not to be provided,the surface shall be kept cement finished @ 2.75kg/m2 and marked with 300x300mm false square (withstring).
Mode of Measurements and Payment:
The rate shall include providing water proof cement concrete terracing of adequate thickness to give desired slope for drainage of rainwater fromterraces.The measurements for this item shall be taken asunder:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
123
Title – Paving Works Sheet 1 OF 5 Sheet 1 OF 5
Providing and laying in position, ceramic tiles, in dado, of approved make and colour, of first quality as per design, set incement slurry (3.3 kg. cement/m2.) over a minimum 10 mm. thick cement mortar 1:3 bedding on wired plaster fixed with 1:1cement mortar behind the tiles and laid to proper slope and level. Pointing should be done in white cement and jointed withwhite cement and pigment with residue as per drawing and approvedbyEngineer-in-chargeorArchitectcomplete.Thesizes,whichcanbeused,are:
for ceramic
a) 200 mm x 200mmb)300mmx300mmc) 400 mm x 400mmd) 450 mm x 450mm
The relevant specification of 9.05 shall be followed except that the ceramic tiles shall be used instead of glazed tilesProviding and laying in position, vitrified tiles, in dado, of approved make and colour, of first quality as per design, set in
cement slurry (3.3 kg. cement/m2.) over a minimum 10 mm. thick cement mortar 1:3 beddingon wired plaster fixed with 1:1cement mortar behind the tiles and laid to proper slope and level. Pointing should be done in white cement and jointed withwhite cement and pigment with residue as per drawing and approvedbyEngineer-in-chargeorArchitectcomplete.Thesizes,whichcanbeused,are:
a) 300 mm x 300mmb) 400 mm x 400mmc) 450 mm x 450mmd) 600 mm x 600mme) 900 mm x 900mm
The relevant specification of 9.05 shall be followed except that the vitrified tiles shall be used instead of glazed tiles.9.08.a Providing and laying average 25mm (20 to 30 mm) thick handdressed green polished kotah stoneof
approved quality, selected and sorted for uniform colour &texture, in floor, otta and skirting etc. of required sizesupto 600 X 600 mm as per design in normal pattern (square or rectangular) and residue as per drawing,including 1:6 (1 cement : 6 sand) cement mortar bedding of average 40mm thickness, jointed with grey cementand colour pigment as specified. Polishing (final polishing with oxalic acid &jute datta) shall be done to achievemirror finish surfaces by using different grades of Emery from 40 no (one coat) 60 no (two coats) 120 no , 220 nosynthetic emery, 320 no emery and buffing with tin oxide ,curing, daily moping with water &kerosene asdirected for at least 15 days after final polishing or upto the satisfaction of the Architect or Engineer-in-chargeetc. complete for all floors / all levels. (NO WAXING WILL BEPERMITTED).
1.0 Materials: Water shall conform M-1. Cement mortar shall conform to M-11. Polished kotah shall conform toM-49 andshall be of reasonably uniformcolour.Workmanship:
Eachslabshallbecuttotherequiredsizeandshapeandfinechisel,dressedatalltheedges.The sides thus dressed shall have full contact if laid along a straight edge. The sides shall be table rubbed with coarse sand,before paving. All angles and edges of the slabs shall be truly square and free form chipping and shall give a plane surface.The thickness of the slab shall be 25 mm. (average) as specified in the item but not less than 20 mm. at any place of theslab.Bedding for the kotah slab flooring shall be of cement mortar 1:6 (1 cement : 6 coarse sand) of average thickness 35 mm. as given in thedescription of the item. Sub grade shall be cleaned, wetted and mopped. Mortar of the specified mix and thickness shall be then be spreadon an area sufficient to receive one kotah slab. The slab shall be washedcleanbeforelaying.Itshallbelaidontoppressed,tappedgentlytobringitinlevel with theotherslabs.Itshallthenbe lifted and laid aside. Topsurface of the mortar shall then be corrected by adding fresh mortar at hollows or depressions. The mortar shall then be allowed to
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
124
Title – Paving Works Shee2 OF 5
While laying, any chiselling which may be required for making the skirting or dado flush with the plaster and/or other finishesshall be done. Necessary grooves of required size in cm., between plaster and/or other finishes, dado or skirting (if required) shallbe provided. Forming machine-cut/rounded edges, gutters, sills, platforms, channels,curbing,etc.ifany,ifrequired,shallbeprovidedasperthedrawinganddesign.In places where full tiles cannot be fixed, the tiles shall be cut to the size and smoothened at edge to give straight and truejoints.All necessary slopes, gradients and levels shall be truly maintained as required and directed by the Architect and Engineer-in-charge.
Thefloorshallbekeptwetforaminimumperiodof7days,sothatbeddingandjointssetproperly.Polishing shall be normally commenced after 14 days of laying the slab. Semi mirror finish polishing shall be done on surfaces withdifferent grades of Emery from 40 no (one coat) 60 no (two coats) 120 no (1coat), gutaka(1 coat),Black Chapadi(1 coat) and 1 coatof polishing with 120 no synthetic emery stone &buffing with tinoide shall be carried out.. Water shall be properly used duringpolishing. The flooring shall then be washed clean with oxalic acid. Daily moping for 15 days shall be done after polishing or up tothe satisfaction of client and engineer-in-charge. All works shall becarriedoutasdirectedbytheArchitectandasspecifiedintheitem,nowaxingwillbepermitted.Ifsemimirrorpolishis to be carriedout.
Ifanytileisdisturbedordamageditshallberefittedorreplaced,properlyjointedandpolished.TheholesrequiredforNahnitraps,pipesanyotherfittingsshallbemadewithoutanyextracost.MatchingPigmentshallbeaddedinthecementforjointstohaveparitywiththestonecolour.Mode of Measurements and Payment:Kotah slab flooring shall be measured in m2. for visible area ofwork done.No deductions shall be made or extra paid for any opening in the floor area upto 0.1 m2. Nothing extra shall be paid for use ofcut tiles or for laying the floors at different levels in the same room or courtyard. Kotah slabs laid in floor boarders and bands etc.shall be measured in the same item and nothing extra shall be payable on account of these or similar bands formed of half ormultiples of half size standard tiles/or other uncuttiles.The treads of stairs and steps paved with tiles without nosing shall also be measured under thisitem.The rate shall include the cost of all materials (inclusive of all taxes, levies, and delivery at site), labour &sundry involved in allthe operations, at all floors, at any height and level, as described above. It shall also include for breakage andwastage. Floating materials and margin of profit shall also be included. All material samples shall be approved bythe Architect/Engineer-in-charge before placingorders.No extra shall be paid for any small quantities like narrow widths, mitred &returned ends, rounds &cutting, fixing and makinggood upto &around pipes, fittings and fixturesetc.The rate shall include for fixing the flooring in composite pattern as per the drawings, using different materials and sizes. Themeasurements of the different materials shall be taken category-wise separately and paidaccordingly.Thebasicrate,ifatallprovidedoragreeduponincludescostofmaterial,alltaxes,levies&costofdeliveryatsite.The risers of steps, skirting or dado shall be measured in m2. Length shall be measured along the finished faces of risers,skirting or dado. Height shall be measured from finished level of treads or floor to top. Lining of pillars shall be measured underthisitem.Therateshallbeforaunitofonem2.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
125
Title – Paving Works Sheet 3 OF 5
1.0 Materials &Workmanship: The relevant specifications of item no. 9.08.a shall be followed except that the sizeofshall be upto 60x60 cm. only. Waxing shall not be permitted. The flooring shall be carried out in diagonal pattern, withorwithoutbandsofselectedbrownkotahetc.asperdetaileddrawingsandasdirectedbytheArchitect.2.0 Mode of Measurements and Payment: The relevant specifications of item no. 9.08.a shall be followed. Therateshallbeforanunitofonem2.
9.08c Providing and laying polished kota stone slab flooring over 75mm (average) th, base of cement mortar1:6 (1cement : 6 coarse sand) or L.M. 1:1.5 laid over and jointed with grey cement slurry including rubbing &Mirrorpolishing etc.complete.
1.0 Materials &Workmanship: The relevant specifications of item no. 9.08.a shall be followed except thatthethicknessofkotahshallbe75mm.andthekotahshallbedoublepolished.2.0 Mode of Measurements and Payment: The relevant specifications of item no. 9.08.a shall be followed. Therateshallbeforanunitofonem2.9.09.a Providing &laying 25 mm thick hand dressed/machine cut green polished kotah of approved
quality,selected and sorted for uniform colour, in floor, otta, sill, dado etc., in required sizes above 60 cm andupto 100 cm, in any pattern (square or rectangular) except diagonal pattern, and residue as per drawing,including cement mortar 1:6 bedding of required thickness, joints & pointing as specified, three or more coatsof polishing (with oxalic acid) upto mirror finish surfaces with different grades of Emery, curing, daily mopingwith water &kerosene as directed for atleast 15 days or upto the satisfaction of the Architect &Engineer-in-charge etc. complete. (NO WAXING WILL BEPERMITTED).
1.0 Materials &Workmanship: The relevant specifications of item no. 9.08.a shall be followed except that the sizeof thekotah shall be above 60 cm. Waxing shall not be permitted. The flooring shall be laid in normal pattern, with or withoutbends of selected brown kotah etc., as per thedetails.2.0 Mode of Measurements and Payment: The relevant specifications of item no. 9.08.a shall be followed. Therateshallbeforanunitofonem2.9.09.b Providing &laying average 25 mm. thick green polished kotah approved quality, selectedand sortedfor
uniform colour, in floor, otta, sill, skirting, dado etc., in required sizes above 60 cm and upto 100 cm. indiagonal pattern and as per design and drawings, including of cement mortar 1:6 bedding of 35 mm thk, joints&pointing as specified, three or more coats of polishing (with oxalic acid) upto mirror finish surfaces withdifferent grades of Emery, curing, daily moping with water &kerosene as directed for atleast 15 days or uptothe satisfaction of the Engineer-in-charge, with selected brown kotah to form bands etc. complete. (NOWAXING WILL BEPERMITTED)
1.0 Materials &Workmanship: The relevant specifications of item no. 9.08.a shall be followed except that the sizeofthekotahshallbeabove60cm.only.Waxingshallnotbepermitted.Theflooringshallbelaidindiagonalpattern,with or withoutbends of selected brown kotah etc. as per thedetails.2.0 ModeofMeasurementsandPayment:Therelevantspecificationsofitemno.9.08.ashallbefollowed.Therateshallbeforanunitofonem2.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
126
2.0 Mode of Measurement &Payment: The rate shall be paid on m2. basis for visible work done, alongwiththerelevantspecifications of item no.9.08.a.
Providing &laying, dressed single polished “AGRA RED" 30 mm. thick of size up to 15.00 Sft in flooring as per design anddrawing (with or without grooves), in mortar 1:6 bedding of 35 mm thickness, pointing with pigment and white cement injoints or grooves, curing etc. complete. The rate should also include for normal polishing (without scratches and marks ofemries) with different grades of emery, filling of grooves with 1:1 cement sand mortar etc. complete. The work shall be carriedout as per the approval of architect and engineer-in-charge.
The relevant specification of item no.9.19.a shall be followed except that Agra Red shall be used and the sample shall beapproved by the architect and engineer-in-charge.Providing and fixing in position, 25 to 38 mm. thick acid and alkali resisting Red Mandana stone of approved size
and shape, for flooring, skirting and dado, including two coats of acid and alkali preventive primer,fixing on average 37 mm. thick cement mortar bedding 1:3 (1 part of cement and 3 part of coarsesand) with acid proof powder, keeping the joints 6 mm. to 10 mm. wide all around and filling thesame with epoxy resin and hardner, including hand/machine polishing, wax polishing etc. complete,asdirected.
The relevant specification of item no. 9.08a shall be followed except that Red mandana stone shall be used instead of kotahas specified in the item. Approved quality of acid and alkali preventing primer shall be applied uniformly in two coats overthe slab or concrete surface on which the flooring is to be laid. Acid-alkali proof powder shall be mixed with cement as perthe manufacturer's specifications, to prepare the cement mortar for bedding. The cement-powder mix and sand shall bemixed in the proportion of 1:3 and the mortar shall be prepared. The stones of desired size shall be laid on the mortar bedof thickness 35 mm. for flooring and 15-20 mm. for dado/skirting, in proper line and level with joints of even thickness of6 to 8 mm., all around.The joints shall then be raked to 10 to 12 mm. deep and filled with epoxy-based resin. The resin shall be mixed with quickdrier and acid-alkali proof powder. The stones shall be either hand polished or machine polished and cleaned with oxalicacid and then wax polished.
Reductioninitemno9.20.afornotprovidingandfillinginpositionepoxyresinallaroundthejoints.
Relevant specification fo 9.20.a shall be followed except that the flooring shall be laid without groove. The rate shall be asper item no 9.20.a but after deducting the cost of providing and filling epoxy resin and hardner in the groove.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
127
Title – Paving Works Sheet 5OF 5
.c Providing & laying sandwich platform of maximum 700mm width a) Sandwich type platform oftopstone as18 mm thick Granite of approved shade and sample and bottom stone as 25 mm thick single side polished kota with25 mm thick screed of cement mortar 1:4 in between two stones. The stone shall be fixed by chasing in to the wall surfaceand providing necessary MS supports duly painted and embedded in between the two stones etc as per the instruction of EICcomplete and b) 75 mm raised platform (Otli) at floor level with polished kota laid on 50mm screed of (1:2:4) and skirting ofkota stone as per design and approved sample. The rate includes rounding, champhering and mirror polishing ofedges, facias of granite, including necessary bonding adhesive (if required) of approved make or equivalent. Rate shall bealso inclusive of making holes & cutouts for SS sink, Oval wash basin, Piller tap / Bib tap etc. as directed by engineer incharge. (Only finished single side granite work shall be measured & paidfor).
Relevant specifications of item no. 9.08.a shall be followed and work shall be carried out as perdrawinganddirectionofengineerincharge.Item shall be measured and paid in Rmt.
Providing and laying shot blasted interlocking/ Non- interlocking Colored paver blocks of high density 80 mm thick M-50grade for footpath, parking areas, Road, service lanes and other areas as mentioned in the drawing. Including providing andlaying 50 to 80 mm thick average bedding layer of coarse sand below paver block as per required grading and specification.Laid paver block shall be mechanically compacted. The work of the paving blocks shall be executed in line and level byskilled mason of flooring work only. It should be laid in such a way that the no cutting of the paver block to be necessary.Cutting of paver block by machine cut only and laying to be done by skilled flooring mason. The Finished surface of the PaverBlock shall have Coarse Sand Texture Finish. Paver blocks shall be compacted and shall be re-laid if necessary.
Material &workmanship:1) 50 mm to 80 mm thick average coarse sand shall be laid as cushioning layer for arranging the paver
blocks.Jointsofthepaverblocksshallbefilledwiththesand
The paver blocks shall be laid properly on the prepared sub-base as per manufacturer's specification and as per Engineer-in-charge'sinstruction.
Thestrengthoftheblocksshallbenotlessthan ForM35–45mmthick For M 40 – 60 mm thickFor M 50 – 80 mm thickThe variation in thickness shall not be less than 3 mm. Any undulations shall be leveled by the plate compactoror removing and relaying the same.The average abrasion value of the same shall not be more than 2.00mm & for individual shall not vary more than2.5mm.Thewaterabsorptionshallnotbemorethan5.%M40Blocksshallbeabrasionresistantformediumtrafficofpedestrians&vehicles.Theblocksshallbelaidincoarsesandbeddingasperdrawing&tothegradientinline&level.
Mode of Measurement –Therateshallbeinsqmts.clearvisibleareashallbemeasuredandpaidwithoutwastage.The rate shall be inclusive of cutting with cutting machine & filing the grooves between Blocks & curbing/wall as per sampleapproved etccomplete.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
128
Title – Iron & Steel Works Sheet 1 OF 9
Structural steel work in bolted or welded in built up sections, trusses and framed work including supplying, fabricating, cutting,assembling, hoisting and fixing in position at all heights of all shapes and size with all leads and lifts for the work of monkey ladder,spiral staircase, railing, gate, insert plate, cattle trap, rain water spout etc. It should be including necessary plates, rolled joists,channels, angles, tees, flats, square / rectangular / tubular hollow sections, position hip and jack lifters, purlins, etc. confirming tolatest IS 4923, IS 1161, IS 806 including cutting and welding the members as per detailed drawing and design. The rate shall include 2coat of zinc chromate yellow oxide primer and 2 coats of synthetic enamel paint of approved make over all the surfaces of the steelsections. (Only standard measurements will be paid for as actual cut lengthusedatsite).ShopdrawingsfortheconnectiondetailsshallbepreparedfortheapprovaloftheEIC.
Rate shall be inclusive of cutting, wastage, welding, bending (shop at site), bolting wherever necessary, in positionwelding of required length, grinding, finishing edges, filling the welded spots with metal putty. It should also includethe cost of approved ISI make and size zinc coated nut-bolt and Anchor fasteners of Hilti or Fisher as approved byengineer-in-charge.
a. Plates, flats, angles, tees, channels, beams etc b.RHSand SHSc. Tubular hollow sections
d. Foundationsbolts
Materials &Workmanship:
Steel supplied byOwner/Client:The Contractor shall sue steel supplied by the owner/client judiciously and to the best advantage so as to minimize splicingand wastage. All steel materials remaining after completion of the project, whether in the form of cut pieces or unutilizedprime steel, shall be returned to the owner’s/client’s stores by the contractor at his own cost. An unaccountable wastage upto a maximum of 1% of the fabricated steel will be allowed. This wastage does not include the balance cut lengths/pieces ofsteel returned to the purchaser.Prior to fabrication, all rolled sections shall be cold straightened and freed from twists, wraps etc. Hot working shall be done only after priorpermission of the Engineer-in-charge. The surface of the members to be welded shall even so that temporary fastening alignment should notallow passage of a 0.2mm. thick filler gauge more than 20mm.deepfromthemember'sedge.Allmembersshallbecutmechanicallybysaworshearorbyoxyacetyleneflame.
Welding shall generally be done by electric process. Gas welding shall be restored to using oxyacetylene flame with specificapproval. Gas welding shall not be permitted for structural steelwork.The work shall be done as shown in the shop drawings which should clearly indicate various details of the joints to bewelded, shop and site welded as well as type of electrodes to be used. Symbol for welding on plans and shop drawing shall beaccording to I.S. 813-1961. As far as possible every effort shall be made to limit the welding thatmustbedoneafterimproperweldingthatislikelytobedoneduetoheightsanddifficultpositiononscaffoldingetc.The welding work shall conform to I.S. 816-1969.
Preparation of surface : Surfaces which are to be welded together shall be free from loose mill scale, rust, paint, grease or other foreignmatter. A coating of boiled linseed oil shall bepermitted.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
129
Title – Iron & Steel Works Sheet 2 OF 9
(d) Proper care shall be taken while welding, for shrinkage and distortions, as the drawing dimensions are thefinished dimensions of thestructure.(e) Cutting of plates shall be profilecut.(f) Welding rod shall be of IshabCorporation.(g) The drilling is to be done with power drill or magneticdrill.
Thedefectiveweldswhichshallbeconsideredharmfultothestrengthshallcutoutandrewelded.Finished welds and adjacent part shall be protected with clean boiled linseed oil and after all stag has been removed welds andadjacent parts shall be painted after the same areapproved.All the members shall be thoroughly cleaned of rust, cakes, dust etc. and given a priming coat of red lead paint before fixing them inposition. All fabricated members shall be suitably packed to be protected from any damage while transportation, ifany.Grinding to the finished level is to be done, if directed by the Engineer in charge. All exposed weld shall be ground smooth. Weldswhich have not been ground shall be scrubbed with a 10% solution of Hydrochloric acid which shall be washed of with water beforepainting unless alkali resistant paint isused.Erection in general, of the entire/part structure shall be carried out as per the requirement and approval of the Engineer-in-charge. Positioning and levelling of the structure, alignment and plumbing and fixing every member of the structure shall be inaccordance with the relevant drawings and to the complete satisfaction of the Engineer-in- charge. The following checking andinspection shall be carried out before, during andafter erection :
- Damages duringtransportation- Accuracy of alignment ofstructures- Erection according to drawings and relevantspecifications- Progress and workmanshipPaintingFirstprimingcoatofzincchromateyellowoxideprimer/PUprimeristobeappliedonthefreshsteelarrivedatsite.Once the cutting and fabrication is completed second coat of primer and first coat of synthetic enamel / PU paint (asperthemanufacturer’srecommendedprocess-preferablylightshadeofthechosencolor)istobeapplied.Afterpainthasbeenalreadydried,erectionisdoneasspecifiedintheitemorasdirectedbyengineer-in-charge.Aftertheerectionfinalcoatorsecondcoatofpaint/PUpaintistobeappliedonthestructuralsteel.
Mode of Measurement andPayment
All work shall be measured on the basis of finished dimensions, as fixed on site and measured net unless specified otherwise.The weight of steel sections, steel strips in finished works shall be calculated from standard weight on the same basis on which steel issupplied to the Contractor by the Client or those given in relevant IS Codes, if steel is arranged by thecontractor.The weight of steel plates and strips shall be taken from relevant IS Codes, based on 7.85 kg/m² for every mm.sheetthickness,ifsteelissuppliedbytheContractor, otherwise,theweightshallbecalculatedonthebasisonwhichsteelissuppliedtotheContractorbytheClient.Unless otherwise specified weight of cleats, brackets, packing pieces, bolts, nuts, washers, distance pieces, separators, diaphragm gusset(taking over all square dimension) fish plates etc. shall be added to the weight of respectiveitems.In riveted work, allowance shall be made for weight of rivet heads. No deductions shall be made for rivet or bolt holes excluding holesfor anchor or holding downbolts.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
130
Project: - Construction of Dairy Building and ancillary works for Indor DudhSangh Ltd.
Sheet 3 OF 9Title – Iron & Steel Works
Weightofonlystructuralsteelisconsideredandweldingwillnotbeconsideredinmeasurement.The rate shall includes cost of all material, labour, erection, hoisting, scaffolding, safety measures and sundry required for proper completion ofthe item of work, at all heights. This shall also include conveyance and delivery, handling, loading, unloading and storing etc. required forcompletion the item described above including necessary wastageinvolved.
TherateshallbeforanunitofoneKg.
10.02 Providing,erectingandfixinginpositiontubularsteelsectionshavingnominalborelike32mm,50mm, 80mm, 100 mm,150 mm, etc. medium class conforming to IS:806:1968 and IS:1161:1979 for the work of sheds, canopy, spaceframe, railings, truss, gate, cattle trap, rain water spout, etc. including necessaryrolled joists, channels, angles, tees,flats, angle cleats, gusset plates, position hip and jack lifters, purlins, etc. including cutting, and welding themembers as per detailed drawing and design. The rate shall includeforapplyingthreecoatsofapprovedmakesyntheticenamelpaintoveracoatofzincchromateyellowoxideasprimer,asperinstructions.(Onlystandardmeasurementswillbepaidfor).
Materials &Workmanship:
Prior to fabrication, all tubular / rolled sections shall be cold straightened and freed from twists, wraps etc. Hot working shall be doneonly after prior permission of the Engineer-in-charge. The surface of the members to be welded shall even so that temporary fasteningalignment should not allow passage of a 0.2 mm thick filler gauge more than 20mm. deep from the member's edge. All members shall becut mechanically by saw or shear or by oxyacetyleneflame.Welding shall generally be done by electric process. Gas welding shall be restored to using oxyacetylene flame with specific approval. Gaswelding shall not be permitted for structural steelwork.The work shall be done as shown in the shop drawings which should clearly indicate various details of the joints to be welded, shop andsite welded as well as type of electrodes to be used. Symbol for welding on plans and shop drawing shall be according to I.S.813-1961. As far as possible every effort shall be made to limit the welding thatmustbedoneafterimproperweldingthatislikelytobedoneduetoheightsanddifficultpositiononscaffoldingetc.
The welding work shall conform to I.S. 816-1969.Preparation of surface:Surfaces, which are to be welded together, shall be free from loose mill scale, rust, paint, grease or other foreign matter.A coating of boiled linseed oil shall be permitted.Assembly for welding:Before welding is commenced, the plates shall be first be brought together and firmly clamped or spot welded at specifieddistance. The temporary connection in form of tack welding, has to be strong enough to hold the plates accurately in placewithout displacement and shall be done keeping in view the finished dimensions of the structure.Precautions: The operations connected with welding and cutting equipment shall conform to safety requirement given in I.S. 818- 1968.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
131
Project: - Construction of Dairy Building and ancillary works for Indor DudhSangh Ltd.
Sheet 4 OF 9Title – Iron & Steel Works
All the members shall be thoroughly cleaned of rust, cakes, dust etc. and given a priming coat of red lead paint before fixing them inposition. All fabricated members shall be suitably packed to be protected from any damage while transportation, ifany.Grinding to the finished level is to be done, if directed by the Architects and Engineer in charge. All exposed weld shall be ground smooth.Welds which have not been ground shall be scrubbed with a 10% solution of Hydrochloric acid which shall be washed of with water beforepainting unless alkali resistant paint isused.
Erection in general, of the entire/part structure shall be carried out as per the requirement and approval of the Engineer-in-charge.Positioning and levelling of the structure, alignment and plumbing and fixing every member of the structure shall be in accordance with therelevant drawings and to the complete satisfaction of the Engineer-in- charge. The following checking and inspection shall be carried outbefore, during andafter erection :- Damages duringtransportation- Accuracy of alignment ofstructures- Erection according to drawings and relevantspecifications- Progress and workmanship
Mode of Measurements and Payment:
(a)All work shallbemeasuredonthebasisoffinisheddimensions, asfixedonsiteandmeasurednetunlessspecified otherwise.(b) The weight of steel sections, steel strips in finished works shall be calculated from standard weight on the same basis onwhich steel is supplied to the Contractor by the Client or those given in relevant IS Codes, if steel is arranged by thecontractor.(c) The weight of steel plates and strips shall be taken from relevant IS Codes, based on 7.85 kg/m² for every mm. sheetthickness, if steel is supplied by the Contractor, otherwise, the weight shall be calculated on the basis on whichsteelissuppliedtotheContractorbytheClient.(d) Unless otherwise specified weight of cleats, brackets, packing pieces, bolts, nuts, washers, distance pieces, separators,diaphragm gusset (taking over all square dimension) fish plates etc. shall be added to the weight of respectiveitems.(e) In riveted work, allowance shall be made for weight of rivet heads. No deductions shall be made for rivet or bolt holesexcluding holes for anchor or holding downbolts.(f) Forforgedsteelandsteelcastings,weightshallbecalculatedonthebasisof7850kg/m3.(g) Unless otherwise specified an addition of 2.5% of the weight of structure shall be made for shop and site rivet heads inriveted steelstructure.(h) Dimensions other than cross sections and thickness of plates shall be measured to nearest 0.001m.(i) Mill tolerance shall be ignored when weight is determined bycalculation.The rate includes cost of all material, labour, erection, hoisting, scaffolding, safety measures and sundry required for propercompletion of the item of work, at all heights. This shall also include conveyance and delivery, handling, loading, unloading andstoring etc. required for completion the item described above including necessary wastage involved.Therateshallbeforaunitofonekg.Only standard sectional weight will be considered and welding will not be considered inweight.
Fabricating, Providing and fixing skylight of approved make and design and as per architect's instructiononskylightonlycleardimensionshouldbepaidfor.
The relevant specification of item no. 10.02 shall be followed same except that the work of fabricating and providing Skylightshall be carried out with rolled steel sections as specified in the item.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
132
Title – Iron & Steel Works Sheet 5 OF 9
box sections (square, rectangular hollow sections as per IS 4923).
The relevant specification of item no. 10.02 same shall be followed except that the work shall be carried out withrolled steel sections as specified in the item.Fabricating, supplying and fixing in position cattle trap, railings, gate etc. made from rolled steel sections (equal and
unequal angles, flats, channels, square tubes and plates of different sizes) as per detailed drawing and design including fillingthe welded spots with paint. The rate shall include for applying three coats of approved make synthetic enamel paint over acoat of zinc chromate yellow oxide as primer, as per instructions. (Only standard measurements will be paidfor).
The relevant specification of item no. 10.02 shall be followed same except that the work shall be carried out withrolled steel sections as specified in the item.Providing, erecting and fixing in position tubular steel sections of various sizes of medium class confirming to IS: 806:1968
and IS: 1161:1979 for the work of skylight, including necessary rolled joists, channels, angles, tees, flats, angle cleats, gussetplates, position hip and jack lifters, purlins, etc. including cutting, and welding the members as per detailed drawing anddesign. The rate shall include for applying three coats of approvedmake synthetic enamel paint over a coat of zinc chromateyellow oxide as primer, as per instructions. (Only standard measurements will be paidfor).
The relevant specification of item no. 10.02 shall be followed same except that the work shall be carried out withtubular steel sections as specified in the item.Providing, erecting and fixing in position tubular steel sections of various sizes of medium class confirming to IS: 806:1968 andIS: 1161:1979 for the work of monkey ladder, spiral staircase including necessary rolled joists, channels, angles, tees, flats,angle cleats, gusset plates, position hip and jack lifters, purlins, etc. including cutting, and welding the members as per detaileddrawing and design. The rate shall include for applying three coats of approved make synthetic enamel paint over a coat ofzinc chromate yellow oxide as primer, as per instructions. (Only standard measurements will be paidfor).
The relevant specification of item no. 10.02 shall be followed same except that the work shall be carried out withtubular steel sections as specified in the item.Providing, erecting and fixing in position tubular steel sections of various sizes of medium class confirming to IS: 806:1968 andIS: 1161:1979 for the work of cattle trap, railings, gate etc. including necessary rolled joists, channels, angles, tees, flats, anglecleats, gusset plates, position hip and jack lifters, purlins, etc. including cutting, and welding the members as per detaileddrawing and design. The rate shall include for applying three coats of approved make synthetic enamel paint over a coat ofzinc chromate yellow oxide asprimer,asperinstructions.(Onlystandardmeasurementswillbepaidfor).
The relevant specification of item no. 10.02 shall be followed same except that the work shall be carried out withtubular steel sections as specified in the item.Providing and fixing weld meshjali
1.0 Materials:Weld mesh jali shall conform to M-34
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
133
Title – Iron & Steel Works Sheet 6 OF 9
fastners. The rate shall include 2 coat of zinc chromate yellow oxide primer and 2 coats of synthetic enamel paint ofapproved make and shade over entire steel surfaces as directed by the EIC (Measurements considered forpaymentsshallbeclearsizeofopeningplusguidechannelsonboththesidesforwidthand 450mm on top fordrumheight.)
a) With push and pull arrangement(Manual).b)Withmechanicaldevicewithapairofhandles.c) shuttershallbepartlygrilledandpartlypanelled,andpullandpushtype(Manual).d)shutter shall be partly grilled and partly panelled, mechanically operated with a pairof handles.e) shutter shall be partly grilled and partly panelled, with Motorizedsystem.
1.0 Materials : Rolling shutter shall conform to M-32, Enamel paint shall conform toM-44.2.0 Workmanship : The top cover, spring, axles, tees, iron pulleys etc. shall be supported on strong MS / CIbrackets whichshall be fixed into the CC 1:2:4 of the lintel/beam as specified with rawl plugs, screws, bolts etc. The guide rails shall be fixedon to the sides of the opening as per the manufacturer's instructions. The lathe curtain (shutters)shallbelaidongroundandtheside-guiderailsshallbebound with it with ropesetc.Theshuttershallthenbeplaced in position andtop fixed with suspension shaft with bolts and nuts. The side-guide channels and the cover frame shall then be fixed to thewalls through the plate welded to the guides. These plates and brackets shall be fixed by meansofsteelscrewboltsand rawlplugsdrilledinthe wall. Theplatesandscrewboltsshallbeconcealedinplaster to make their locationinvisible.
Fixing shall be done accurately so as to ensure easy and smooth operation of the shutter.Mode of measurement and payment:Measurement considered for payment shall be clear size of opening, between the jambs plus guide channels on both the sides for widthand 450mm on top for drum height shall be added to the height of the opening, the clear distancebetweenthesillandthesoffitoftheopening.The rate shall include for all materials, its transportation at site, labour etc. involved in the operation described as above. It shall include2 coats of zinc chromate yellow oxide primer and 2 coats of synthetic enamel paint of approvedmakeandshadeoverentiresteelsurfacesasdirectedbytheEIC
Therateshallbeforaunitofonesq.m.Providing and fixing 1m high, 32mm dia. G.I `A' class pipe railing with verticals of 32mm dia. pipe with MS hold fast 25mm x 6mm x10cm long, grouted in floor with CC 1:2:4 blocks of size 15 x 15 x 23 cm., at 1M c/c or with anchor fastener with intermediate32mm dia. GI pipe welded at all junctions, grinding smooth the welded joints and ends, including 1 coat of zinc chromate yellowoxide primer and 2 coats of synthetic enamel paint of approved make etc. asdirected.
The relevant specification of item no. 10.02 shall be followed same except that the work shall be carried out with 32mmGI `A' class pipes as specified in the item.The rate includes cost of materials, labour, required for completion of the item.The relevant specifications of item no. 13.02 shall be followed for fixing the railing in CC 1:2:4 blocks of 15 x 15 x 23cm. size.The items of excavation and 1:2:4 C.C shall be measured according to relevant items and the detailed specifications for thesame.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
134
Title – Iron & Steel Works Sheet 7 OF 9
intermediate rails.The rate shall be for a unit of one running metre.
Providing, fabricating, erecting and fixing in position structural steel sections confirming to IS:806:1968 and IS:1161:1979 forthe work of sheds, canopy, space frame for height upto 20 mtrs etc including necessary RHS & SHS of TATA or equivalent, rolledjoists, channels, angles, angle cleats, gusset plates, chequred plate, position hips and jack lifters, purlins etc. including cutting andwelding the members as per the detailed drawings and design. The rate shall include sand blasting of the steel sections, plates,2 coat of surfaces of the steel sections (only standard measurements will be paid for). Shop drawings for the connection detailsshall be prepared for the approval of the architect. Gusset plates, corner plates, joiningplatesetcwillbeprofiledcuttingshallbeincludingintheratequoted.
The relevant specification of item no. 10.02 shall be followed same except that the work shall be carried out withstructural steel sections as specified in the item.Providing, fabricating and fixing MS Grills of required Pattern as per approved drawing, design and direction to window frameswith MS flats/square/round bars at required spacing and frame all around fixed with Screws to window frame including threecoats ofpainting etc. complete.
1.0 Materials:
The structural steel shall conform to M-22.Workmanship:
TheMSGrillshallbepreparedasperthedrawingsorasdirectedforfixingtowoodenframesofwindowsetc.The grill shall be fabricated to the designs and patterns shown in the drawings and the weight shall be as directed, and the jointsshall be riveted or welded as shown in the plan or as directed. The grill so framed shall be fixed in totheframesofthewindowsetc.beforetheyareerectedinposition.Theoutsidestripframeofthegrillshallbehoused to its full thickness into therecess cut into the frame of the windows etc. The grill shall be fixed to the frame with number of bolts and nuts of screws viz. boltnut/screw per 30 cm. of the length of outer strip subject to a minimum of2Nos.oneachsideoftheframeorasindicatedinthedrawingsorasdirected.The bolts and nuts or screws shall be counter sunk and shall be fixed with the top of their heads flush with the face of framestrips.Mode of measurement &payment:
No payment shall be made for weight of screws, bolts, nuts etc. Only weight of grill shall bepaid.TherateshallbeforunitofoneKg.
10.14 Providing, fabricating and fixing 18 gauge MS Perforated sheet with 3 mm hole dimension and ofstandard pitch,etc. complete including cutting, and welding the members as per detailed drawing and design. The rate shall
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
135
Project: - Construction of Dairy Building and ancillary works for Indor DudhSangh Ltd.
Sheet 8 OF 9Title – Iron & Steel Works
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
136
3.2 The rate shall be for unit of onesqm.10.15 FabricatingandfixingSSrailingof316grademadeoutofroundpipes,squareorrectanglesectionsin satin / brush
finish with supporting brackets made out of SS sections fixing with anchor fastener etc onconcretesurface,bricksurfacesorfloorincludingbendingandbendsasperthedrawingwithbest
quality finish as per the approval of Architect /EIC
1.0 Material:
Stainless steel of SS – 316 Guage to be used.Workmanship:
Argon welding for joints, L & key joints as approved, polishing, CNC cutting if required. The railing should be in true line andlevel, area where railing to be fixed should be cleared and neat workmanship manner. The other to be followed as per the item10.03.Mode ofMeasurement:
The rate shall be for unit of oneRmtProviding and fixing in position 40mm dia. G.I. Medium Duty pipe conforming to latest IS Codes with angle iron support at1.5 m c/c using 75 x 75 x 10 mm angles, 1 m long with three rows of pipes, angles to be welded with insert plate of size 150X 150 X 6mm thick, insert plate to be fixed with 4 nos of chemical type anchor fasterners of Hilti / approved make as per thedetails including necessary paintingwithtwocoatsofapprovedqualityzincpaintoveronecoatofapprovedprimerincludingnecessary
welding, grinding, bolting required, if any at any height / floor / level etc.,complete.
Relevant items specification 10.04 shall be followed except that the railing shall be prepared with GI pipesand as per the details. The rates quoted shall be as per the described details above and as per the drawingsand the same shall be per RMT.
Providing&placinginposition&curingGP-2Conbextagroutwith1:1cementinbetweenMSPlate&Concretesurfacesasgroutetc.,completeatallpositions/allfloors/alllevels/allheightsetc.,
complete.
Mode ofMeasurement:
Theworkwillbemeasureinonecum.Forallheights/allfloors/alllevelsatallpositionsetc.complete.10.18 Providing & placing in position & curing Shrink comb grout in between Nut and Bolt as grout etc.,complete
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
137
Project: - Construction of Dairy Building and ancillary works for Indor DudhSangh Ltd.
Sheet 9 OF 9Title – Iron & Steel Works
Mode ofMeasurement:
TheworkwillbemeasureinoneNos.Forallheights/allfloors/alllevelsatallpositionsetc.complete.Providing and fixing in position Mechanical anchor fastener of Hilti or equivalent approved make with HST Mechanicaltype, including drilling holes in RCC elements at all floors / all levels / all heights / all places as per the drawings anddirection of Engineer-in-charge. The rates quoted shall be inclusive of drilling holes, providing anchors, fixing, tightening,etc complete including cost of scaffoldingcomplete.
a) HSTM10X130/50-MechanicalAnchor–10mmdia&130mmlongb) HSTM12X185/90-MechanicalAnchor–12mmdia&185mmlongc) HSTM16X215/100-MechanicalAnchor–16mmdia&215mmlong
Mode ofMeasurement:
TheworkwillbemeasureinoneNos.Forallheights/allfloors/alllevelsatallpositionsetc.complete.10.21 Supplying and tying G.I. Barbed wire consisting of 2 ply line wire having nominal diameter of 2.5mm(Tolerance
+ OR - 0.8mm), point wire (Barbs_ of nominal diameter 2mm (Tolerance + OR - 0.8mm) with the barbs havingfour points, including tying in between fencing posts, stretching wires and providing diagonals, including tyingto posts with G.I. wire of dia 1.6mm (16g) and fixing the wires to nib in the posts, etc complete all as perdrawing and specifications. Note: 1. The G.I. barbed wire shall weigh minimum 10.8kg / 100mtr andmaximum 12.5 kg/100mtr with barbs placed at 75mm c/c (Tolerance + OR - 12mm) and the barbed wireshall conformtoIS278-1978.2.Thelengthofeachrowandeachdiagonalrowofbarbedwirewillbemeasuredinrunning metre for payment. G.I. binding wire will not be measured for payment. Rate quoted should includecostofbindingwirealso).Otheritemssuchasangles,concreteshallbepaidinrelevantitems.
Material &workmanship;The relevant specification of item 10.01a shall be followed for fabrication &erection of MSposts
1.1 The post shall be fabricated &erected in line level &plumb veryprecisely.2.0 Mode ofmeasurement;
The length of each row and each diagonal row of barbed wire will be measured in running metre for payment the wire shall bemeasured in rmt.
MS post as per drawing shall be fabricated &erected as per specifications of item no 10.01a &shall be measured andpaid under same item separately inkg.10.22 Providing,Fabricatingandfixing50x50mmsizeSSangle3mmthk.(316grade)forEdgenosingof
columnatallheights/allfloors/allshapes/allpositionsandallasperspecifications&directionof
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
138
Title – Painting and Polishing works Sheet 1 OF 11
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
139
3.2 Therateshallbeforaunitofonem2.11.02.a Providing and applying (minimum 3 coats with primer &putty) with oil bound / Acrylic washabledistemperof
approved manufacturer like Asian, Berger, ICI or equivalent and of approved colour &shade, on newly dryinterior plastered surface at all heights and levels to give and even shade, including priming coat of primer /cement (water or solvent based) primer and applying required coats (min two coats) of white cement based puttyof birla or equivalent after throughly brushing the surfaces free from mortar dropping and other foreign matterand also including preparing the surface even and sand papered smooth etc., after applying everycoatofputty,completeasdirected sampletobeapprovedbeforestartingofthework.Theratesshallinlcudethecostoffillerforfillingthecracksonsurface.
Materials:
Oil bound washable distemper and cement primer shall be of approved brand and manufacture. The distemper shallbeofrequiredcolourandshadeandthesameshallconformtoIS:428-1969.PaintshallconformtoM-44.Workmanship:
Scaffolding:
Where scaffolding is required, it shall be erected in such a way that as far as possible, no part of scaffolding shall restagainst the surface to be distempered. A properly secured strong and well tied suspended platform (Zoola) may be usedfor distempering. Where ladders are used, pieces of old gunny bags shall be tied at top and bottom to prevent scratches tothe walls and floors. For distempering to ceiling, proper stage scaffolding shall be erected where necessary and the floorarea shall be covered with plastic so that the flooring is not spoilt.Preparation ofsurface:
The relevant specification of item no. 11.01.a shall be adopted and in addition,The undecorated surface to be distempered shall be thoroughly brushed from dust, dirt, grease, mortar dropping and other foreign matterand sand papered smooth. New plaster surface shall be allowed to dry for atleast 2 months before applications of distemper or one coat ofwhite wash with white cement shall be done prior to painting with distemper.All unnecessary nails, hooks etc. shall be removed. Pitting in plaster shall be made good with plaster again and papered with a fine gradesand paper and made smooth. A coat of distemper shall be applied over the patches. The surface shall be allowed to dry thoroughly beforethe regular coat of distemper is applied. The surface affected by moulds, moss, fungi, algae lichens, efflorescence etc. shall be treated inaccordance with IS : 2395 (Part-1)-1966. Before applying distemper, any unevenness shall be made good by applying putty made out ofplaster of paris mixed with water,onentiresurface,includingfillinguptheundulationandthensandpaperingthesameafterithasdried.
A priming coat of water based/solvent based cement primer of approved manufacture shall be applied over the papered surface in case ofnew work or undecorated surface. If the distemper priming is done after the plastered wall surface dries completely, the cement primershall beavoided.Application of primer and putty shall be done asunder:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
140
Title – Painting and Polishing works Sheet 2 OF 11
Primingcoat:
On any surfaces, after the primer coat has dried for atleast 48 hours, the surface shall be lightly sand papered to make itsmooth for receiving the distemper, taking care not to rub out the priming coat. All loose particles shall be dusted off afterrubbing. Minimum two coats of distemper shall be applied with brushes in horizontal strokes followed immediately byvertical strokes, which together shall constitute one coat. The subsequent coats shall be applied after a time interval of at least24 hours between 2 consecutive coats to allow proper drying of the preceding coat. The finished surface shall be even anduniform without patches, brush marks, distemper dropsetc.Sufficient quantity of distemper shall be mixed to finish one room at a time. The application of a coat in each room shall befinished in one operation and no work shall be started in any room, which cannot be completed on the same day.15-cm. double-bristled distemper brush shall be used. After a day's work, brushes shall be thoroughly washed in hot waterwith soap solution and hung down to dry. Old brushes, which are dirty and caked with distemper, shall not be used onthework.
Protectivemeasure:
The surface of doors, windows, ventilators, floors, articles of furniture etc. and such other part of the buildings which are notto be distempered shall be protected from being splashed upon. Such surfaces shall be cleaned of distemper splashes, if any.Mode of Measurements andPayment:
Priming coat of distemper primer, scraping of surface spoiled by smoke soot, removal of oil and grease spots, treatment for infection ofefflorescence, mould, moss, fungi, algae and lichen and patch repairs to plaster shall be included in this item for which nothing extra shallbepaid.All the work shall be measured net in this item as in place subject to the following limits unless otherwise stated hereinafter:
(a) Dimensions shall be measured tothe nearest 0.01 m.(b) Areainindividualitemsshallbeworkedouttothenearest0.01m2.Allworkshallbemeasuredinm2.Nodeductionsshallbemadeforendsofjoints,beams,postsetc.andopenings,not exceeding 0.5 m2.each and no addition shall be made for reveals, jambs, soffits, sills etc. of these openings nor for finish around ends of joints,beams postsetc.
Deductions of opening exceeding 0.5 m2 but not exceeding 3.0 m2, each shall be made as follows and net addition shall be made for reveals,jambs, soffits etc. of theseopenings:(a) Whenboththefacesofwallsareprovidedwithsamefinish,deductionsshallbemadeforonefaceonly.(b) When each face of is provided with different finish, deduction shall be made for that side of frame for doors, windowsetc. on which width of reveal is less than that of the other side but no deduction shall be made on the other side. Where thewidth of reveals on the both the faces of wall are equal, deduction of 50% of area of opening on each face shall be made fromarea offinish.(c) When only one face of wall is treated and the other face is not treated, full deductions shall be made if the width oftherevealontreatedsideislessthanthat on untreated sidebut ifthe widthoftherevealis equalormorethanthat on untreated sideneither deductions nor additions to be made for reveals, jambs, soffits, sillsetc.
In case of opening of area exceeding 3.0 m2, each, deduction shall be made for actual size of the openings andjambs, sills and soffits shall bemeasured and paidseparately.Nodeductions shallbemadeforattachments suchascasings,conduits,pipes,electric wiringandthelike.Corrugated surfaces shall be measured flat as fixed and not girth. The quantities measured shall be increased by the
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
141
Title – Painting and Polishing works Sheet 3 OF 11
The rate includes cost of all materials, labours, scaffolding, protective measures etc. involved in all the operations described above, carried outat all floor heights, in any position, at all levels. This shall also include conveyance, delivery, handling, unloading, storing worketc.Therateshallbeforaunitofonem2.Distempering (3 coats) with oil bound washable distemper of approved manufacturer like Asian, Berger, Nerolac or equivalent
and of required shade, on newly dry plastered surface at all heights and levels, to give an even shade, including a priming coat withalkali resistant primer/cement(water or solvent based) primer after thoroughly brushing the surface free from mortar droppingand other foreign matter ,complete, as directed and to the satisfaction of architect andengineer-in-charge.
The relevant specification of 11.02.a shall be followed except that the putty shall not be used.Distempering (3 coats) with water bound washable distemper of approved brand and manufacture and of required shade, on
any surface to give an even shade, including a priming coat with alkali resistant primer and applying one coat of putty afterthoroughly brushing the surface free from mortar dropping and other foreign matter and also including preparing the surface evenand sand papered smooth etc. complete, as directed.
Materials:
Water bound washable distemper and primer shall be of approved brand and manufacture. Further the relevant specifications forworkmanship and mode of measurements and payment, of item no. 11.02.a shall be followed except that water bound distemper dilutedwith water or any other prescribed thinner shall be used instead of oil bound distemper. It shall conform to M-44.7.(G). no extra will be paidfor painting of external paint on sand face plaster.(Ref. IS1200clausewillnotbeapplicable.)11.03 Providing &applying three coats of External Cement paint like Snowcem or equivalent withbrush on exterior
surfaces at all heights &all places including scaffolding to give even shades including thoroughly brushing thesurfaces free from mortar dropping and other foreign matter and sand papered smooth etccompleteasperthemanufacture'sspecification&tothesatisfactionofEngineerinchargeor Architect
Materials:
The water shall conform to M-1. Cement water proofing paint shall conform to IS : 5410-1969, M-44.8.(H) and shall be of approvedshade.Workmanship:
Scaffolding: The relevant specifications of item No. 11.01.a shall befollowed.Therelevantspecificationsofitemno.11.01.ashallbefollowedexceptthattheworkwhitewash,colourwashshallbe substitutedwith water proofing cement paint. The surface shall be thoroughly wetted with clean water before cement water proofingpaint isapplied.
Preparation of paint: cement paint shall be prepared by adding paint powder to water and stirring to obtain a thick paste, which shall thenbe diluted to a brushable consistency. Generally, equal volumes of paint powder and water make a satisfactory paint. In all cases, themanufacture's instructions shall be followed. The paint shall be mixed in such quantities as can be used up within an hour of mixing asotherwise the mixture will set and thicken, affecting flowingandfinish.Thelidsofcementpaintdrumsshallbekepttightlyshutwhennotinuse.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
142
Title – Painting and Polishing works Sheet 4 OF 11
Preparation ofsurface:Thefinishedsurfaceshallbeevenanduniforminshade, without patches, brushmarks,paintdrops etc.The cement paint shall be applied with a brush with relatively short stiff hog or fibre bristles. The paint shall bebrushed in uniformthickness and shall be free from excessively heavy brush marks. The lumps shall be well brushed out.
Water proof cement paint shall not be applied on surfaces already treated with white wash, colourwash,distemperdryoroilboundvarnishes,paintetc.Itshallnotbeappliedongypsum,woodandmetalsurfaces.For smooth surfaces approved bonding agent by thesupplier/manufacturer shall be used at no extra cost.Curing: Painted surfaces shall be sprinkled with water two or three times a day. This shall be done between coats and for atleast twodays following the final coat. The curing shall be started as soon as the paint has hardened so asnottobedamagedbythesprinklingofwatersayabout12hoursaftertheapplication.Protection measures shall be taken as per item No. 11.02.a para2.6.Mode of Measurements andPayment:
The relevant specifications of item No. 11.01.a shall befollowed.The rate shall be for a unit of one m2. no extra will be paid for painting of external paint on sand face plaster.(Ref. IS 1200 clause will notbeapplicable.)
11.04.a. Providing &applying External 100% Acrylic Paint "Apex"of desired shade from Asian paint or equivalent in minimumthree coats (first coat with external primer &balance two coat with apex or equivalent paint as per supplier'sspecification) with brush on exterior sand faced plastered surfaces / mala plastered surfaces with a minimumone coat of external cement based putty of birla or equivalent at all heights &all places including scaffolding togive even shades including thoroughly brushing the surfaces free from mortar dropping and other foreign matterand sand papered smooth etc complete as per the manufacture's specification & to the satisfaction of Engineerincharge Newly plastered surfaces requires minimum three coats -first coat with exterior primer with 1 :1 ratio(as per supplirer's specifications)&balance coats with with 40% dilution). The rate shall also include the cost offiller for cracks on the surfaces.
1.0 Materials:WatershallconformtoM-1andacrylicpaintshallconformtoitssupplier’s specificationWorkmanship:
General
The materials required for work of painting work shall be obtained directly from approved manufacturers or approveddealerandbroughttothesiteinmaker'sdrums,cageetc.withsealunbroken.All materials not in actual use shall be kept properly protected, lid of containers shall be kept closed and surface of paint in open orpartially open containers covered with a thin layer of water to prevent formation of skin. The materials, which havebecome stale or flat due to improper and long storage shall not be used. The paint shall be stirred thoroughly in itscontainer before pouring into small containers. While applying also, the paint shall be continuously stirred in smallercontainer. No left over paint shall be put back into stock tins when not in use. The paint shall be stirred thoroughly in itscontainer before pouring into smallcontainers.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
143
Title – Painting and Polishing works Sheet 5 OF 11
Application:Before pouring into small containers for use of applying, the paint shall be stirred thoroughly in its container. Also, the paint shall becontinuously stirred in the smaller container, sothat its consistency is kept uniform.The paint shall be laid on evenly and smoothly by means of crossing and laying off. The crossing and laying off consists of covering thearea over with paint, brushing the surface hard for the first time over and then brushing alternately in opposite directions two or threetimes and then finally brushing lightly in direction at right angles to the same. In this process, no brush marks shall be left after thelaying off is finished. The full process of crossing and laying off will constitute one coat. No hair marks from the brush or clogging ofpaint puddles in the corners of panels, angles of moldings etc. shall be left on thework.On the newly plastered surface, the first coat shall be applied with 100% dilution and second and third coat shall be applied with 40 %dilution or as per the supplier’s instructions The second or subsequent coat shall not bestarted untiltheprecedingcoathasbecomesufficientlyhardtoresistmarkingofthebrushbeingused.Precautions:
(a) Old brushes if they are to be used with paints, shall be completely dried of turpentine or oil paint by washing inwarm soap water. Brushes shall be quickly washed in water immediately after use and shall be kept immersed inwaterduringbreakperiodstopreventthepaintfromhardeningonthebrush.(b) Inthepreparationof wallsforplasticemulsionpainting,nooilbaseputtiesshallbeusedinfillingcracks,holesetc.(c) Splashesonfloorsetc.shallbecleanedout withoutdelay,astheywillbedifficulttoremove after hardening.(d) Washing of surfaces treated with emulsion paint shall not be done within 3to 4 weeks of application.
2.6 Protectivemeasure:The surface of doors, windows, ventilators, floors, of furniture etc. and such other parts of the building not to bewhite/colour washed shall be protected from being splashed upon. Such surfaces shall be cleaned of white/colourwash splashed, if any, immediately after completing the painting, at no extra cost.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
144
Title – Painting and Polishing works Sheet 6 OF 11
and well-tied suspended platform shall also be provided. Where ladders are used, piece of old gunny bags shall betied at top and bottom to prevent scratches to the floors and walls.Preparationofsurface:TherelevantspecificationsofitemNo.11.02.aPara2.2shallbefollowed.
1) Thepaintingshallstartonly2-3monthsaftertheplastering(newlyplastered)ofthesurface.2) The surface to be finished should be free from chalking, dust, grease, loose paint, loose powdery particles, fungus/algaeetc.Thesurfaceshallbethoroughlycleaned,broomedtoremoveallforeignparticlesetc.3) Oil or grease spots, algae or other foreign matter shall be removed by suitable chemical or water, by vigorous wirebrushing. If the surface is cleaned with water then, it shall be allowed to dry before application of paint. IN NOCASETHEFINISHINGSHALLBEALLOWEDONDAMPSURFACE.4) Cracksonthesurfaceifanyshallbefilledwithacementandsandmortarintheratio1:2.
Preparation of Mix: This shall be done as per the manufacture's instructions. The dry flakes are mixed with flakes bonding agent withrecommended amount of water. The dough is then trowelled onto the substrate to be coated with average dry film in the range of 0.8-1.2mm.
Application:
1) ThesampleoftheheritagesurfaceworkshallbeapprovedbytheArchitectorEngineer-in-charge.2) Samples shall be carried out for various finishes (granules, roller coat, flakes etc) as per instruction and satisfactionof the Architect or Engineer-incharge.3) One coats of paint shall be applied on the surface with the help of trowel to give a uniform thickness of 0.8 to 1.2mmNoconventionalprimerorputtyshallbeappliedontheexteriorsurface.4) Tomaintaintheuniformmixtureandtopreventsegregation,thepaintshallbestirredfrequentlyinthebucket.5) A gap of twenty-four hours shall be kept between two subsequent coats, if required for uniform finish. The finishedsurfaceshallbeevenanduniforminshape,withoutpatches,brushmarks,paintdropsetc.6) The surfaces of door, windows, floors, etc and other parts of the buildings shall be protected from paint beingsplashedupon.Suchsurfacesshallbecleanedproperlyafterthecompletionofthework.7) The application shall be done by trained applicators as per the manufacture’s instruction and as per the approvalofarchitect.8) The application shall not be carried out in the rainy/ cloudy season. When rain is expected, the work shall not becommenced. Also the relevant specifications of item no. 11.01.a para 2.4 shall befollowed.9) An additional top coat available in both glossy and matt finishes, is recommended for high traffic area
applications like lifts, lobbies, corridors etc. this shall be measured and paid in relevant items.
Also the relevant specification of item no 11.01.a shall be followed..
Mode of Measurements andPayment:
The relevant specifications of item No. 11.01.a shall be followed. It shall be noted that the rate is inclusive of priming and puttycoat.Therateshallbeforaunitofonem2.11.05.b Extra for providing &applying an additional top coat either in glossy, semi glossy or matt finishes onanytype of
Heritage surface (granule/flakes/granite/roller etc) of or approved Bakelite Hylam Ltd., on interior/Exteriorsurfaces, at all heights to give an evenshade.
1.0 Materials:. Topcoat of Bakelite Hylam or appoved by BakeliteHylam.Workmanship:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
145
Title – Painting and Polishing works Sheet 7 OF 11
Applying priming coats (min one coat) to the satisfaction of engineer-in-charge/consultant over new steel and other metalsurfaces after and including preparing the surface by thoroughly cleaning oil, grease, dirt and other foreign matter and securedwith brushes, fine steel wood scrapes and sand paper, with ready mixed priming paint of Asian, Berger ,Nerolac, ICIorequivalent
a) Redleadb) Zinc chromate redoxidec) Zinc chromate yellowoxide
1.0 Materials:Thereadymixedprimershallmatch withtherelevantIScode.1.2 Thethinner(linseedoil)shallconformtoIS:75-1973,if,foranyreason,thinningisnecessary.Incaseofreadymix paint, thebrand of thinner recommended by manufacturer shall beused.
Workmanship:
Preparation of surfaces: The surfaces to be painted shall be cleaned of all rust, scale, dirt and other foreign matter sticking to it withwire brushes, steel wool, scrapers, sand paper etc. This surface shall then be wiped finally with mineral turpentine, which shall alsoremove grease and perspiration of hand marks. The surface shall then be allowed todry.Application ofprimer:
After the preparation of the surface, the priming coat shall be applied immediately. The brushing operations are to be adjusted to thespreading capacity advised by the manufacturer of the particular primer. The paint shall be applied evenly and smoothly by means ofcrossing and laying off. The crossing and laying off consists of covering the area over with paint, brushing alternately in oppositedirections, two or three times and then finally brushing lightly in a direction at right angles to the same. In this process, no brush marksshall be left after the laying off is finished. The full process of crossing and laying off will constitute onecoat.During painting, every time after the priming coat has been worked out of the brush bristles or after the brush has been unloaded of theprimer, the bristles of the brush shall be opened up by striking the brush against portion of the unpainted surface with the end of thebristles, held at right angles to the surface, so that bristles thereafter will collect the correct amount of paint when dipped again into apaint container. The primary coat shall be allowed to dry completely before painting isstarted.Nohairmarksfromthebrushorcloggingof paint puddles inthecornerorpanelsanglesofmouldingsetc.shallbeleft on thework.Special care shall be taken while painting over bolts, nuts, rivets overlapsetc.Thecontainer when not inuseshallbekeptcloseandfreefromairsothat paint does not getthickenedandalso shall be kept guarded fromdust.Mode of Measurements andPayment:
Thenewsteelandothermetalsurface(girthxlength)shallbemeasuredinsqmunderthisitem.Allthe workshallbemeasurednet,inthedecimalsystem asexecuted,subjecttothefollowinglimitsunlessotherwise stated hereinafter:
(a) Dimensions shall be measured tothe nearest 0.01 m.(b) Areasshallbeworkedouttothenearest0.01m2.No deductions shall be made for openings not exceeding 0.5 m2 each and no addition shall be made for painting to beading, mouldings,
if priming coat and oil paint is not included in structural steel item for providing fabrication and erection item then it shall be
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
146
measured in m2. Compound girders, stanchions, lattices, girder and similar work, actual area shallbemeasuredinm2andnoextrashallbepaidforpaintingonbolts,heads,nuts,washersetc.Noadditionshallbemade to the weight calculated for the purpose of measurements of steel and iron works for paint applied on shop or at site.Thedifferentsurfacesshallbegroupedintoonegeneralitem,areasofunevensurfacebeingconvertedinto
equivalentplainareasinaccordancewiththerelevantI.S.codeforpayment.
The rate shall include the cost of all materials, labour, scaffolding, protective measures etc. required for the above specified operation, at allfloors, at any height, in any position. Scrapping of surface, washing etc. of surfaces spoiled by smoke, soot, removal of oil and grease spots,treatment for infection with efflorescence, moulds, moss, fungi, algae and lichen shall not be paid extra. This shall also include conveyance,delivery, handling, unloading, storing worketc.3.6 Therateshallbeforanunitofonem2.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
147
Title – Painting and Polishing works Sheet 8 OF 11
metal surfaces to the satisfaction of engineer-in-charge at all heights and all levels with premium enamel paint –Glossy/Pearl lustre (Semi glossy)/ Matt of approved manufacturer like Asian or equivalent as desired, brushing,to give an even shade, including cleaning the surface of all dirt, dust and other foreign matter.
1.0 Materials: The enamel paint shall conform to M-44B. or as approved byarchitect/engineer-in-charge.Workmanship:
General
The materials required for work of painting work shall be obtained directly from approved manufacturers or approved dealer and broughtto the site inmaker's drums, cage etc. with seal unbroken.All materials not in actual use shall be kept properly protected, lid of containers shall be kept closed and surface of paint in open orpartially open containers covered with a thin layer of turpentine to prevent formation of skin. The materials, which have become stale orflat due to improper and long storage, shall not be used. The paint shall be stirred thoroughly in its container before pouring into smallcontainers. While applying also, the paint shall be continuously stirred in smaller container. No left over paint shall be put back into stocktins when not in use. The paint shall be stirred thoroughly in its container before pouring into smallcontainers.Ifforanyreasons,thinningisnecessary,thebrandofthinnerrecommendedbythemanufacturershallbeused.The surface to be painted shall be thoroughly cleaned and dusted. All rust, dirt and grease shall be thoroughly removed before painting isstarted. No painting on exterior or other exposed parts of the work shall be carried out in wet, damp or otherwise unfavourable weatherand all the surfaces shall be thoroughly dry before painting work is started.For Glossy, Flat, Pearl lustre and Matt finish, painting of same specification shall be followed except that the type ofpaintshallbechangedasperthedirectionofArchitectandEngineer-in-charge,togivethedesiredfinish.Application:
Brushing operation are to be adjusted to the spreading capacity advised by the manufacturer of particular paint. Thepaintshallbeappliedevenlyandsmoothlybymeansofcrossingandlayingoff.Thecrossingandlayingoffconsistsof covering the area over withpaint, brushing the surface hard for the first time over and then brushing alternately in opposite directions two or three times and thenfinally brushing lightly in direction at right angles to the same. In this process, no brush marks shall be left after the laying off is finished.The full process of crossing and laying off will constitute onecoat.Each coat shall be allowed to dry completely and lightly rubbed with very fine grade of sand paper and loose particles brushed off beforenext coat is applied. Each coat shall vary slightly in shade and shall be got approved from Architect &Engineer-in-charge before next coatisstarted.Each coat shall be lightly rubbed down with sand paper of fine pumice stone and cleaned off dust before the next coat is applied. No hairmarks from the brush or clogging of paint puddles in the corners of panels angles of mouldings etc. shall be left on thework.Special care shall be taken while painting over bolts, nuts, rivets, overlapsetc.Approved best quality brushes shall beused.
Mode of Measurements andPayment:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
148
Title – Painting and Polishing works Sheet 9 OF 11
a. Solventbasedb. Waterbased
1.0 Materials: Silicone paint shall be of approved quality like Wacker, GE silicon, Pidilite, Dow Corning,orequivalent(waterrepellentpaint)asapprovedbytheArchitectandEngineer-in-charge.ItshallconformtoM-74.Workmanship:
The silicone paint shall be diluted with water/solvent (benzene or toluene) in proportion as per manufacturer’sspecifications;Thepaintshallbesprayedwithspraygunasdirected.Asfaraspossiblereadymixpaintshallbeused.Concentration of silicon content shall be in proportion so that after the application, surface is clear and as it is. The sample shallbe approved by architect.Normally 5% concentration is sufficient for not to have change in parent color.Before applying silicon paint, the brick surfaces should be thoroughly cleaned of dust, dirt, concrete slurry or anyotherforeignmaterialorefflorescencefromwithinthebrickifany,usingmethodlikepressurizedwaterjetsorrubbing withgunny bags and soft brush etc. as approved by the EIC. Pressurized water jet shall be applied in such a waythatthesurfaceonwhichitisapplieddoesnotgetdamaged.The concrete surfaces should also be thoroughly cleaned of dust, dirt, rust, concrete slurry or any other foreignmaterial using appropriate method so as not to damage the RCC work, as approved by the EIC.Rate shall be inclusive of moping, cleaning, masking the door windows/floor/plants etc during and after the executionforprotectionA guarantee bond on appropriate stamp paper, shall be given by the Contractor to the Client in the manner formprescribedbelow:
FORM OFGUARANTEEBOND
"I/We ......................(Contractor) hereby guarantee that work will remain unaffected and will not be in any way damagedby water or any other humid conditions, for a period of 5 years after completion of the work of Silicone painting as perthe terms and conditions of the contract and Contractor hereby indemnifies and agrees to save the Client from anyloss and or damage that might be caused on account of exposure to water and hereby Guarantees to make good anyloss or damages suffered by the Client and further guarantee to redo the affected work without claiming any extracost."This guarantee shall remain force for the period of 5 years from the completion of the work under the contract and it shall remainbinding to the Contractor for period of 5years.
Mode of Measurements andPayment:
The relevant specification of 7.01 shall befollowed.The deposit at the rate of 50% of the cost of this item from the running and final bills shall be recovered and retainedforthefirstoneyearaftercompletionoftheworkand10%ofshallberetainedforthebalanceofdefectsliabilityperiodandshallberefundedonlyafterthecompletionofthedefectsliabilityperiod.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
149
Title – Painting and Polishing works Sheet 10 OF 11
The rate shall include the cost of all materials, labour, scaffolding, protective measures etc. required for the abovespecifiedoperation,atallfloors,atanyheight,inanyposition.Therateshallbeforaunitofonem2.
Providing &applying three coats with brush, of ‘Suraksha’ from Nerolac or ‘Ace’ from Asian or equivalent on exteriorsurfaces, at all heights to give an even shade, including thoroughly brushing the surface free from mortar droppings and otherforeign matter and sand paperedsmooth.
The relevant specification of 11.04 shall be followed, except that semi acrylic paints shall be used instead of100%acrylicpaints.Firstcoatisof100%dilutionandsecondandthirdcoatisof40%dilution.Powder coating with Powder paints such as Berger, Hawcoplast or equivalent, as approved by the Architect,
onallmetalsurfacesofminimum50micron,includingalloperationsrequiredforsatisfactorywork.
1.0 Materials: Powder paints shall conform toM-91.Workmanship:
Powdercoatingshallbeprovidedusingpowderpaints,withanElectrostaticspraygunorbyFluidizedbed,asperthemanufacturer'sinstructions.Theworkshallbecarriedoutinthebestworkman-likemanner.Mode of Measurements andPayment:
The relevant specifications of item no. 11.09.a shall befollowed.Therateshallbeforaunitofonem2.Providing and applying two coats with brush, of Sandtex matt paint from Snowcem or equivalent on exterior surfaces,
at all heights to give even shades, including thoroughly brushing the surface free from mortardroppingandotherforeignmatterandsandpaperedsmoothetc.complete.
The relevant specification of item no. 11.03 shall be followed except that sandtex matt paint shall be used instead ofcement paint.Providing and applying oil and water finish polish to all wood and wood based surfaces as specified, directed and
approved by theEIC.
Material and Workmanship : All wood and wood based surfaces to e polished shall be properly grinded withsand/roll paper of required no.The grinded surface shall be cleaned with cotton and applied with first coat of double boiled CAT brand linseed oil andwater in proportion of 1:1.5 or linseed oil and turpentine in equal proportion as approved by architect/engineer-in-charge. After 24 hrs the surface shall be grinded again with roll paper/ sand paper of no 100. The second coat shall besame as mentioned above. Last coat shall be applied after 48 hrs. The surface shall be cleaned with cotton so that the
Title – Painting and Polishing works Sheet 11 OF 11
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
150
`
Materials:PlasticEmulsionpaintshallconformtoM-66.Workmanship
ScaffoldingRelevant specifications of item no. 11.02.a to be followed.Preparation ofsurfaceRelevant specifications of item no. 11.02.a to be followed.Preparation ofMixThisshallbedoneaspermanufacture’sspecifications.ApplicationBefore pouring paint into small containers for use of applying, it shall be stirred thoroughly in its container. Also, the paint shall becontinuously stirred in the smaller container, sothat its consistency is kept uniform.
The paint shall be laid on evenly and smoothly by means of crossing and laying off. The crossing andlaying off consists of covering the area over with paint, brushing the surface hard for the first time overand then brushing alternately in opposite directions two or three times and then finally brushing lightlyin direction at right angles to thesame.Inthisprocess,nobrushmarksshallbeleftafterthelayingoffisfinished.Thefullprocessofcrossingandlaying offwillconstituteonecoat.Nohairmarksfromthebrushorcloggingofpaintpuddlesinthecornersofpanels,anglesof moldings etc. shall be left on thework.The paint shall be applied with brush for two coats and final coat shall be done with roller only. Thesurface shall be treated with minimum two coats of water/ solvent basedprimer.The surface on finishing shall present relevant flat, velvety, smooth, pearl luster (semi gloss) /matt andglossy finish, asspecifiedintheitem.Itshallbeevenanduniforminshadewithoutpatches,brushmarks,paintdropsetc.complete.Thenumberofcoatsshallbeasspecifiedintheitem.Thepaint willbeappliedintheusualmanner withbrush,sprayor roller. The paint dries by evaporation of the water content and as soon as the water hasevaporated the film gets hard and the next coat can be applied. The time of drying varies from one houron absorbent surfaces and 2 to 3 hours on nonabsorbentsurfaces.The surface on finishing shall represent a flat velvety smooth finish. If necessary more coats will beapplied till the surface presents a uniformappearance.
PrecautionsOld brushes if they are to be used with emulsions paints, shall be completely dried of turpentine or oil paint by washing in warm soapwater. Brushes shall be quickly washed in water immediately after use and shall be kept immersed inwaterduringbreakperiodstopreventthepaintfromhardeningonthebrush.Inthepreparationof wallsforplasticemulsionpainting,nooilbaseputtiesshallbeusedinfillingcracks,holesetc.Splashesonfloorsetc.shallbecleanedout without delayastheywillbedifficulttoremoveafterhardening.Washingofsurfacestreated withemulsionpaintshallnotbedonewithin3to4weeksofapplication.ProtectivemeasuresThe surface of doors, windows, ventilators, floors, furniture etc. and such other parts of the building not to be white/colour washed shall be
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
151
Title – Roofing Works Sheet 1 OF 8
12.01 Tiled roofing with Mangalore pattern roof tiles, including teak reapers of size 50 mm. x 25mm.
1.0 Materials:MangalorePatternrooftilesshallconformtoM-25andIS:730.TeakwoodshallconformtoM-29.Workmanship:
Laying : The maximum distance between center to center of rafters shall not be more than 600 mm. Teak wood reapers 50 mm. x25 mm. size, shall be nailed to each rafter at center to center distances, suited to the size of the tiles, by means of nails, 50 mm. long. Thereapers shall be made from well seasoned teak wood and shall be straight pieces of uniform size and colour and not shorter than thelength necessary to cover at-least 4 rafters. The under face and sides of the reapers shall be planed before fitting. Joints shall come overthe rafters. The joints of two adjacent rows of reapers shall not come over the same rafter. At the caves, there shall be two reapers ofsuch thickness and shape, that the uniformity of the top slope of the roof shall bepreserved.The work of valleys shall be executed asunder:
Galvanized iron sheet, 1200 mm. wide and 1.25 mm. thick, shall be used for valleys. The sheet shall be extended by about 450mm. under the tiles on either side, with a depth of 100 mm. at center. The sheet shall be carried 75 mm. into the wall and setwith cement mortar unless flashing is specified. The laps, if any, on the slope, shall be 300 mm. The sheets shallbelaidoverthereapersandnailed.Tworeapers,50mm.x25mm.each,shallbefixedoverthegalvanizedironsheet,150 mm. awayfrom the centre line of the valley, on either side, to keep the tiles and mortar from falling into the gutter of the valley.The tiles shall be laid from the caves towards the ridges after fitting of the reapers id done. The rebate of the tiles shall rest fullyagainst the reapers. The joints of the hip and ridge tiles and also those between them and the plain tiles shall be set watertight and wellgrouted with lime mortar and the mortar surface shall be painted and finished off with a mixture of red paint and Portland cement tomatch the colour of the tiles. The finished slope of the roof shall be uniform from ridges to caves. The cave line shall be perfectlystraight, horizontal and parallel to each other. The end over gables shall be protected by line borders and neatlyfinished.At the side of the valleys and for 230 mm. on either side of the roof at valleys, cement plastering, 12 mm. thick shall bedonetopreventtherainwatercollectedintheguttertoleakbythesideofthevalleys.
At the caves, wind tie shall be placed over the ends of the last tiles and secured by means of galvanised iron washers andscrews, 25 mm. deep into the rafter, to prevent tiles from being blown off. Care shall be taken to put the screws in the ridgesand not in the gutter of the tiles. Where full tiles are not necessary, half tiles manufactured for the purpose, shall be used.Mode of Measurements andPayment:
The measurements of the roof shall be taken for the finished work, for the superficial area, flat in the plan of the roof and not girth.Laps shall not bemeasured.No deduction in measurements of roof shall be made for openings of area upto 0.40 m2. And no any extra be paid for labour andwastage in forming suchopenings.
Therateincludesthecostofallmaterialsandlabour,includingformingridges,hips,cavesandbattens.Therateshallbeforaunitofonem2.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
152
Title – Roofing Works Sheet 2 OF 8
Workmanship:
Spacing of the purlins shall be provided such that one purlin rests at the ridge and one at the eaves. The other purlins, for 18 gaugethick aluminum sheet, shall not exceed a distance of 1.80 m., center to center. The purlin shall coincide with thecenterlineoftheendlap.Theridgepurlinsshallbeplacedinsuchawaythattheridgescanbefixedproperly.Theportionoverhangingthewallsupportshallnotbemorethanonefourthofthespacingofpurlins.Thetop surface ofthe purlins shall bepaintedbeforethesheetsare fixedoverthem.Embeddedportionsofpurlinsshallbe finished withtwo coats ofcoal-tar.
Laying ofSheets:
2.4.1 The sheets shall be laid on purlins to a true plane with the line of corrugations truly parallel or normal to the sides of area to becovered. The sheets shall not generally be built into gables and parapets. They shall be bent up along their side edges close tothe wall, and the junction shall be protected by suitable flushing or by projecting drip course.2.4.2. The laps at the end shall be provided, 150 mm. minimum for roof slopes of 1 in 2 (1 vertical: 2 horizontal) and steeper but a lapof 200 mm. shall be provided for flatter slopes than those above. The side lap shall be provided between two ridges of thecorrugations, at each side.2.4.3 The sheets shall be cut to the dimensions and to the shape of the roof, either along their lengths or their width or in slant acrossthe line of corrugations, at hips and valleys. The sheets shall be cut carefully cut with a straight edge and chisel, to give astraight finish. The sheets shall be laid such that the laps are turned away, from the usual direction of local heavy rain.Fixing ofSheets:
Sheets shall be fixed to the purlins or other roof members such as hips and valleys, rafter etc., with `J' or `L' galvanized hook boltsand galvanized nuts, 8 mm. dia., with bitumen limpet washers and G.I. washers. Limpet washers with white lead shall be used. Length ofhook bolt shall be varied to suit the site requirement. Bolts shall be sufficiently long so that after fixing, they project above the top oftheir nuts by not less than 12 mm. The grip of `J' or `L' hook bolts on the side of purlins shall not be less than 25 mm. There shall beminimum of 3 hooks bolts, placed at the ridge of corrugations in each sheet, on every purlins, and their spacing shall not exceed 300mm. Coach screws shall not be used for fixing the sheets to purlins, where the slopes of roof are not less than 1:.2 (1 vertical and 21/1.2horizontal). Sheets shall be joined together at the sidelaps,bygalvanizedironboltsand nuts,25mm.x6mm.size,eachboltsshallbefixed withbitumenandG.I.limpet washer filled with white lead. Where overlaps at the sides extend to two corrugations, these bolts shall be placedzig-zag over the two overlapping corrugations, so that the ends of the overlapping sheets are drawn tightly towards each. Thespacingoftheseboltsshallnotexceed600mm.alongeachofthestaggeredrows.Holes for all bolts shall be drilled and not punched in the ridges of the corrugations from below, while the sheets are on the ground.The holes in the sheets shall be at-least 50 mm. from the edge. Sheets drilled wrongly shall be rejected. The holes in the washers shall beof the exact diameter of hook, bolts or the seam bolts. The nuts shall be tightened from above to give a leak-proofroof.Theroofwhencompleteshallbetruetolinesandslopesandshallbeleak-proof.Cementconcretevatashallbedone,asandwheredirected,aspertherelevantspecificationprovidedunderitemno.7.14Aluminium sheet shall be painted with approved shade of aluminum paint, over a coat of aluminum primer. The paintingshallbedonewithspraygunonly.Thesampleofthesameshallbegotapproved.Therelevantspecificationofitemno.
Title – Roofing Works Sheet 3 OF 8
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
153
includes the cost of provision, erection and removal of the scaffolding, benching, ladders, templates and tools required for theproper erection and completion of the work. The rate excludes the cost of purlins, rafters and trusses. The rate shall be inclusiveof making vata at the junction of aluminium sheet with wall/concrete surface. The rate shall be inclusive of cost of painting.3.4 Therateshallbeforaunitofonem2.12.04 Providing corrugated G.I. sheet roofing, fixed with galvanized iron `J' or `L' hook bolts and nuts, 8 mm. dia., with
bitumen and G.I. limpet washers filled with white lead etc. complete, excluding the cost of purlins, rafters andtrusses.
1.0 Materials: Corrugated G.I. Sheets shall conform toM-23.Workmanship:
Spacing of the purlins shall be provided such that one purlin rests at the ridge and one at the caves. The other purlins for0.8mm.thickG.I.sheetshallnotexceedacentertocenterdistanceof1.80m.Thepurlinshallcoincidewiththecentreline of the end lap.The ridge purlins shall be placed in such a way that the ridges can be fixed properly. The portionoverhangingthewallsupportshallnotbemorethanonefourthofthespacingofpurlins.Thetop surface ofthe purlins shall bepaintedbeforethesheetsare fixedoverthem.Embeddedportionsofpurlinsshallbe finished with twocoats ofcoal-tar.
Laying ofSheets:
2.3.1 The sheets shall be laid over the purlins, to a true plane with the line of corrugations truly parallel or normal to the sides of area tobe covered. The sheets shall not generally be built into the gables and parapets. They shall be bent up along theirsideedgesclosetothewallandthejunctionshallbeprotectedbysuitableflushingorbyprojectingdripcourse.2.3.2. The laps at the end shall be provided, 150 mm. minimum, for roof slope of 1 in 2 (1 vertical:2 horizontal) and steeper but a lap of200 mm. shall be provided for flatter slopes than those above. The side lap shall be provided between two ridges ofcorrugations, at each side.2.3.3 The sheets shall be cut to the dimensions and to the shape of the roof either along lengths or width & in slant across the line ofcorrugations, at hips and valleys. The sheets shall be cut carefully with a straight edge and chisel, to give a straightfinish.Thesheetsshallbelaidsuchthatthelapsareturnedaway,fromtheusualdirectionoflocalheavyrain.Fixing ofSheets:Sheets shall be fixed to the purlins or other roof members such as hips and valleys, rafters, etc., with `J' or `L' galvanized hookbolts and galvanized nuts, 8 mm. dia, with bitumen impact washers and G.I. washers. Limpet washers with white lead shall beused. Length of hook bolt shall be varied to suit the site requirement. Bolts shall be sufficiently long so that after fixing theyproject above the top of their nuts by not less than 12 mm. The grip of `J' or `L' hook bolts on the side of the purlins shall not beless than 25 mm. There shall be minimum of 3 hooks bolts placed at the ridge of corrugations, in each sheet, on every purlin, andtheir spacing shall not exceed 300 mm. Coach screw shall not be used for fixing the sheets to purlins, where the slopes of roof arenot less than 2 horizontal, (1 vertical:2 horizontal). Sheets shall be joined together at the side laps by galvanized iron bolts andnuts, 25 mm. x 6 mm. size, each bolts shall be fixed with bitumen and G.I. limpet washer filled with white lead. Where overlaps atthe sides extend to two corrugations, these bolts shall be placed zig-zag over the two overlapping corrugations, so that the endsof the overlapping sheets are drawn tightly towards each other. Thespacingoftheseboltsshallnotexceed600mm.alongeachofthestaggeredrows. Nor extra be paid for extra labour in cutting and forwastage, etc., in forming such openings.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
154
Title – Roofing Works Sheet 4 OF 8
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
155
The rate shall include the cost of all materials and labour involved in all operations described above. The rate also includesthecostofprovision,erectionandremovalofthescaffolding,benching,ladders,templatesandtoolsrequiredforthepropererectionandcompletionofthework.Therateexcludesthecostofpurlins,raftersandtrusses.Therateshallbeforanunitofonem2.12.05.a Providing Asbestos cement corrugated sheet roofing, fixed with G.I. plain and bitumen washers etc. complete and
excluding the cost of purlins, rafters and trusses.
1.0 Materials: Corrugated Asbestos cement sheets shall conform toM-24.Workmanship:The maximum spacing of purlins shall be 1.6 m. in case of 7 mm. thick A.C. sheets and 1.35 m. for 6 mm. thick A.C. sheets.2.2. Laying and fixing of sheets: The sheets shall be laid on the purlins and other roof members, as indicated on the drawings and asdirected, as per the code of practice. Top bearing surfaces of all purlins and other roof members shall be in oneplanesothatthesheets when beingfixedshallnotbeforceddowntorestonthepurlins/roofmembers.Thesheetsshallbe laid with thesmooth sideupwards.The finished roof shall present a uniform slope and the line of corrugations shall be straight and true. The sheets shall be laid,starting at the eaves either from left to right or right to left, depending upon the direction of wind, which shall be checkedbefore actual laying of the sheets is started. The purlin spacing and the size of sheets shall be checked to ensure that thearrangements shall provide the laps required and the specified overhang at the eaves. In case the sheets are laid from right toleft, the first sheet shall be laid uncut but the remaining sheets in the bottom row shall have the top left hand corners cut ormitered. The sheets in the second and other immediate rows shall have the bottom right hand corner of the first sheet cut. Allother sheets except the last sheet shall have both bottom right hand corners and top left hand corners cut. The last sheet shallhave only top left hand corner cut. The last of the top row sheets shall have the bottom right hand corner cut with exceptionof the last sheet which shall be left uncut, if the sheets are laid from left to right, the first sheet shall be laid uncut and theremaining procedure shall bereversed.The free overhang of the sheets, at the caves shall not exceed 400 mm. in case of 7 mm. thick sheets and 300 mm. in case of 6 mm.thicksheets.The mitering described above is necessary to provide a snug fit. Where 4 sheets meet at a lap the length of miter shall be150mm.andthe width ofmitershallbeequalthe width ofthesidelap.Thecuttingmaybedone with ordinarywood sawatsite.Catladdersorplanksshallbeusedwhilelayingandfixingthesheetstoavoiddamagetothesheets.Laps : The sheet shall be laid with an end lap of 150 mm. minimum, in case of roof with a pitch flatter than 1 vertical to 2.5horizontal (Approx. 22O) and for roofs flatter than mentioned above or for very exposed situation, end lap shall be 225mm.The side lap shall be sheltered from the prevailing wind direction. The sheets shall be laid with side lap of half a corrugation.FixingAccessories:2.6.1 The sheets shall be secured to the purlins and other roof members by means of 8 mm. dia. galvanized iron bolts `J' type hookbolts, in case of angles, iron purlins and `L' type bolts, incase of R.S. joists, precast concrete or timber purlins, and nuts, bearingon the galvanized iron washers and bitumen washers. The grip of `J' or `L' bolts on the side of purlins shall not be less than 25mm. Each galvanized iron `J' or `L' hook bolts shall have a bitumen washer and galvanized iron washer placed over the sheetsbefore the nuts are screwed down from above. On each purlin there shall be one hook bolt, on the crown adjacent to the sidelap, on either side. Bitumen washer shall be of approved quality. The G.I. flat washer shall be 25 mm. in diameter and 1.60 mm.thick and bitumen washer shall be 35 mm. in dia and 1 mm. thick with a hole to suit the required size of fixing accessory.Each nut shall be screwed lightly at first. After a dozen or more sheets are laid, the nuts shall be tightened to ensure a leak-proof joint and the nuts shall be tightened only to an extent so as to prevent damage to the sheets. The length of the `J' boltsor crank bolts shall be 75 mm. more then the depth of purlins for single sheets fixing and 90 mm. more, where two sheetsoverlap or where ridges or other accessories are to be fixed. The minimum length of coach screw for timber purlins shall be110mm.
Holes: The holes for fixing the sheet shall be drilled and never punched in the crown of the corrugations, to suit thepurlinsi.e. on the centre line of the purlins, if these are of timber and square head coach screws are used, or as close as possible tothe back of purlins if `J' or `L' bolts are used, as with steel angles or precast concrete or timber purlins. Holes for hook bolts,etc. shall be 2 mm. more than the diameter of the fixing bolts. No holes shall be nearer than 40 mm. to any edge of
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
156
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
157
Title – Roofing Works Sheet 6 OF 8
3.2 Therateshallbeforaunitofonem2.12.07 Providing and fixing Fibre glass in skylights and other structures for roofing etc., of approved make and design as per
Architect'sinstruction.
1.0 Materials: Fiberglass translucent roofing sheets shall conform to M-79. The sheets shall be corrugated or semi- corrugated, itscorrugations matching with Asbestos cementsheets.2.0 Workmanship : The sheets shall be fixed to the purlins as per the Manufacturer's instructions and as per the relevant specificationsof A.C sheets, item no. 12.05.a and b. Care shall be taken to make the joints leak proof. The sheets shall be drilled with the helpof a hand drill or power drill and shall be cut with Hacksaw blades. Holes shall never be punched but only drilled through thecrowns of the corrugations.3.0 Mode of Measurements and Payment: The relevant specification of item no. 12.05.a and b shall be followed. The rate shall be aunit of onesqm.12.08 Providing and fixing Polycarbonate sheets in different structural roofing structures, of approved make and design as
per Architect's instructions.
1.0 Materials: Polycarbonate sheets for roof glazing shall conform toM-80.2.0 Workmanship: The sheet shall be fixed as per the manufacturer's instructions using silicone sealant and dry rubber profiles orsetting blocks, asinstructed.
Mode of Measurements andPayment:The relevant specifications of item no. 12.04 shall befollowed.Therateshallbeforanunitofonem2.12.09.a Providing and fixing 0.55 mm thick SMP Top coated and alkyd backer coated, trapezoidal profile of metacolour or
equivalent, fixed with SDST bolts - Self Drilling Self Tapping Bolts of HILTI and necessary overlaps (minimum 150 mm)including cutting, erecting at all levels, providing openings, all fixtures and fixing accessories with EPDM seals, forend laps silicon sealant profiled foam fillers etc. at ends below ridge and valleys, including all materials labourscaffolding wastage, tools, tackles, equipment, transportation, preparation of shop drawing, and excluding the cost ofpurlins, rafters etc. all complete as per specifications drawings and as directed by architect/engineer- in-charge. Rateshall include end laps, side laps, bolts etc complete excluding the cost of purlins, rafters and trusses. The sheets shallbe supplied in custom lengths upto 12.0 m. All overlaps shall be sealed with silicone sealants. For sloped roofing.
1.0 Materials: Pre-coated 0.55 mm thick SMP top coated and alkyd backer coated Meta colour sheet with trapezoidal profile and asper the supplier’s specifications. The colour and length shall be approved by the Architect/Engineer-in-charge. The shape ofsheet shall be as shown in thedrawings.Workmanship:
Spacingofthepurlinsshallbeprovidedsuchthatonepurlinrestsattheridgeandoneatthecaves.Theotherpurlinsfor0.55mm.thickMetacolorpre-coatedsheetshallnotexceedacentertocenterdistanceof1.40m.Thepurlinshallcoincide withthecentrelineoftheend lap.Theridgepurlinsshallbeplacedinsucha waythattheridgescanbefixedproperly.Theportionoverhangingthewallsupportshallnotbemorethanonefourthofthespacingofpurlins.The bottom surface of the purlins shall be painted before the sheets are fixed to them. Embedded portions of purlins shall befinished with two coats ofcoal-tar.Laying ofSheets:
2.3.1 The sheets shall be fixed to the purlins from underside, to a true plane with the line of corrugations truly parallel or normal to
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
158
Title – Roofing Works Sheet 7 OF 8
The sheets shall be cut to the dimensions and to the shape of the roof either by their lengths or width or in slant across the line ofcorrugations, at hips and valleys. The sheets shall be cut carefully with a straight edge and chisel, to give a straightfinish.Thesheetsshallbelaidsuchthatthelapsareturnedaway,fromtheusualdirectionoflocalheavyrain.Rateshallbeinclusiveofmobileplatform,scaffolding,forfixingthecladdingandsheetsfrominside/undersideoftheshed.Fixing ofSheets:
Sheets shall be fixed to the purlins or other roof members such as hips and valleys, rafters, etc., with SDST bolts with EPDM sealscomplete as per supplier’s specifications. As far as possible they shall be fixed over the ridges. The fixing of ridge with the sheets shall bedone with GI seambolts.Theroofwhencompleteshallbetruetolinesandslopesandshallbeleak-proof.Mode of Measurements andPayment:
The measurements of the sheets, both at their ends and along the side edges shall be measured. The overlaps of the sheets overthe valley piece and their under lap under the ridge, hip and flashing piece shall be included in the measurements.No deductions in measurements shall be made for openings like chimney stacks, sky-light, etc., having area upto 0.40 m2.Norextrabepaidforextralabourincuttingandforwastage,etc.,informingsuchopenings.The rate shall include the cost of all materials and labour involved in all operations described above. The rate also includesthecostofprovision,erectionandremovalofthescaffolding,benching,ladders,templatesandtoolsrequiredforthepropererectionandcompletionofthework.Therateexcludesthecostofpurlins,raftersandtrusses.
3.3 Therateshallbeforaunitofonem2.Providing and Fixing flashing, ridge or hips 0.8 mm thick in plain pre-coated meta colour sheet fixed with SDSTbolts/GIseamboltsandbitumenorEPDMwasherincludingsidelaps,bendingthesheetsasperthedrawingand fixingthesameasperthematerialusedforroofingetc.complete.Aspertheinstructionsofarchitect/Engineer-in- charge.
The relevant specification of 12.09 shall be followed. It shall be measured and paid in sqm.Providing, fabricating and Fixing Gutter 900 mm wide and 0.8 mm thick from the same materials of roofing including endlaps, side laps, bending, making the joints water tight and construction of gutter as per the profile in the detail drawing. Theclear visible area of the gutter sheet will be considered for the calculation of measurement. Rate shall also inclusive themaking any cutout in the gutter for rain water disposal, fixing arrangement on the structural steel support system. Structuralsystem will be measured and paid under the relevantitem.
The relevant specification of 12.09 shall be followed. It shall be measured and paid in RMTProviding and fixing Polycarbonate sheets 3 mm thick embossed of profile equivalent to Meta colour pre-coated sheets as apart of trapezoidal pre-coated meta colour sheets with SDST bolts or as recommended by the manufacturer of polycarbonatesheets, of approved make and design as per Architect's instructions. Structuralfabricationshallbeasperdrawinganddesignandshallbemeasuredandpaidunderrelevantitemofwork.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
159
Title – Roofing Works Sheet 8 OF 8
/ Engineer-in-charge.
a. 450mmdiaclearopeningb. 600mmdiaclearopeningc. 900mmdiaclearopening
1.0 Materials:Polycarbonate domes shall be as per the supplier’s specification and Item description and as approved byArchitect/Engineer-in-charge.2.0 Workmanship :The dome shall be fixed as per the manufacturer's instructions using brass screws/anchor fastners with PVC grip from thesides to RCC, neutral grade silicone sealant and dry rubber profiles or setting blocks, as instructed.
Mode of Measurements andPayment:
Therelevantspecificationsofitemno.12.04shallbefollowed.Therateshallbeforaunitofoneno.Providing, fixing &commissioning600mmdiaTurboVentilatorofspecifiedmakeinlinelevelandplumbontopof roof / slab at allheights as per drawing, over the cut outs provided in roof slab etc. complete as per the suppliers specifications andinstructions of Architect / Engineer-in-charge. The rate shall include the cost of FRP collar withallthenecessaryprovisiontoinstall/fixinginpositionthesame.
Turbo ventilator shall be of approved make and shall be fixed as per the manufacturer’s specifications. Care shall be taken toavoid water leakage from the junction of turbo ventilator with roof/ slab, rate shall be inclusive of / EPDM/Neoprene rubber,brass/SS screws/anchor fasteners, silicone sealant etc. complete. Rate shall be for per no. The rate shall also include the costof FRP collar with all necessary provision to install / fixing in the position the same.Coordination charges for getting fixed Proflex roofing system including providing required platform / workable space forfixing proflex roof, timely coordination with the agency according to the progress of civil works, taking adequate measures tomake roof leakproof from the edges, path for taking in hydra machine, taking due care of material at site and if required toprovide storage & working pacing as required by supplier etc., all complete as per the direction of supplier. System details are- Providing &fixing 0.8mm thick BMT of colored galvalume (LOCAL) proflex or equivalent systems roofing of desired color attop according to manufacturer specifications &guidelines etc complete upto the satisfaction of engineer in charge. Rates shallbe inclusive of careful unloading by hydra or crane &safe storage erection, fixing bolts / anchor fasteners at the ends&cleaning the site as per drawing and or directed by engineer in charge etc complete. The contractor should furnishguarantee for 10 years of waterleakage.
Coordination charges shall be quoted for as described above.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
160
Title – Miscellaneous Works Sheet 1 OF 14
13.01.a Providingandfixingwoodenplanksceilingwithtonguedandgroovedjointingandwoodscrews(frameworkandcoverfilletstobemeasuredandpaidintheitem):IndianTeakWood.
1.0 Materials: The Indian teak wood shall conformM-29.Workmanship:
General : The planks shall be clean sawn in the direction of the grain, cut, square and straight. Each plank shallhavetonguedandgroovedjointing.Onexposedfaces,itshallbeplanedforfullface.The frame for supporting the ceiling may be wooden or metal and the size and other details of frame work shall be as directed.Suspenders of M.S. angles or other sections may be used for suspending the frame. Use of wooden suspenders shall be permitted. Thebottom surface of the frame shall be checked and corrected to true surface and slope.Fixing : Planks of specified timber and thickness shall be used. The width of the planks shall not be more than 100 mm. forthickness upto 20 mm. and 150 mm. for planks above 20 mm. thick and length shall not exceed 3 m. The planks shall be of uniformwidth except in the first and last lines of planks, adjacent to the walls, where remaining additional odd width shall be adjusted equally onboth sides. The minimum length of planks in finished work shall be such that it will span at-least two spacing of the supporting framework except where shorter lengths are unavoidable. The planks shall be planed true on the exposedsides.Thelongitudinaledgesoftheplanksshallbejointedwithtonguedandgroovedtypejoints,asdescribedintheitem.The outer lines of planks shall be accurately fixed parallel and close to the wall. Each subsequent plank shall becarefullyjointedup.Theplankshallbefixedtotheframeabove,withtwoscrewsateachendjointofframeandone, at every intermediate joint.(The screws shall not be thinner than designation 8 and of a length not less than twice the thickness of the boards). The screws shall becounter sunk and the screw holes filled with putty or sloping out way. The unexposed face of planks shall be treated with woodpreservative before the board isfixed.
Mode of Measurements and Payment:
Thesupportingframe,coverfilletsandsuspendersshallbeincludedinrateofceiling.No deductions in measurement shall be made for opening not exceeding 0.40 m2. and no extra payment shall be made for formingsuchopenings.
Every work in ceiling shall be measuredseparately.Therateshallbeforaunitofonem2.
13.01.b Providing and fixing 12 mm. thick, fibre insulation board lining with butt jointing and nails.Theframeworkandcoverfilletsshouldbeprovidedasperthedesignanddrawing,ofsecondclassteakwood.
Materials:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
161
Title – Miscellaneous Works Sheet 2 OF 14
and cornices etc. Necessary cutouts, grooves etc. for lighting arrangements shall be provided through intermediatesupports and properly framed.Planked battens of second class teak wood 40 mm. x 20 mm. size, shall be used for grounds on solid walls. The batten shall beplunged to wall as described under. The batten shall be fixed on tapering plugs with 50 mm. long wood screws. The tapering plug shall betrapezoidal in shape having base 50 mm. x 50 mm. at bottom and 38 mm. x 38 mm. at top with depth of 50 mm. Plugs shall beembedded in C.M. 1:3 and shall be placed at 450 to 500 mm. centers. The plugs shall be treated with coal tar and battens shall be treatedwith wood preservative before use. On uneven wall faces, the battens shall be plugged and fitted with packing pieces at the back,wherever necessary. The frame shall be treated with wood preservative before boards are nailedon.Screwing shall be done by brass screws of required size, as per requirement. The screws shall be placed at supports, at 100 mm. x150 mm. center, in center and edges, 75 mm. centers. Minimum clearance for nails from edges shall be 10mm.Mode of Measurements and Payment:
The supporting frame, cover fillets and suspenders shall be paid under this item. No deduction shall be made for opening notexceeding 0.40 m2. and no extra payment shall be made for forming such openings. Each type of work in ceiling shall bemeasuredseparately.Therateshallbeforaunitofonem2.
13.01.c.1 Providing and fixing 12 mm. thick, Thermocole lining with butt jointing and nails. The frameworkandcoverfilletsshouldbeprovidedasperthedesignanddrawing,usingsecondclassteakwood.
Materials:
TheThermocoleofspecifiedthicknessshallconformtotherelevantI.S.andshallconformtoM-70.Wood shall conform toM-29.6.
Providing and fixing 12 mm thick, Thermocole lining with butt jointing and nails. The frame work and cover fillets should beprovided as per the design and drawing, using aluminiumchannels.
The relevant specifications of item no. 13.01.c.1 shall be followed same except that aluminium channels shall beused and in addition -Providing and fixing 5 mm thick, Compact sheet lining with butt jointing and nails. The frame work andcoverfilletsshouldbeprovidedasperthedesignanddrawing,usingsecondclassteakwood.
The relevant specifications of item no. 13.01.b shall be followed except that Compact sheet shall be used instead ofFibre insulation board.Providing and fixing [] mm thick, Thermoseal lining with butt jointing and nails. Theframe work and coverfilletsshouldbeprovidedasperthedesignanddrawing,usingsecondclassteakwood.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
162
Title – Miscellaneous Works Sheet 3 OF 14
Mode of Measurements and Payment:
The relevant specifications of item no. 13.01.b shall befollowed.Therateshallbeforaunitofonem2.
Providing and fixing water-proof ply lining with butt jointing and nails. The frame work and cover filletsshouldbeprovidedasperthedesignanddrawing,usingsecondclassteakwood.
The relevant specifications of item no. 13.01.f.1 shall be followed except that water-proof ply shall be fixed in lining.Providing and fixing commercial ply lining with butt jointing and nails. The frame work and cover filletsshouldbeprovidedasperthedesignanddrawing,usingsecondclassteakwood.
The relevant specifications of item no. 13.01.f.1 shall be followed except that commercial plywood shall be fixed in lining.Providing and fixing pre-laminated standard laminate lining with butt jointing and nails. The frame workandcoverfilletsshouldbeprovidedasperthedesignanddrawing,usingsecondclassteakwood.
The relevant specifications of item no. 13.01.f.1 shall be followed except that pre-laminated standard laminate shall be fixedin lining.Providing and fixing pre-laminated veneered ply lining with butt jointing and nails. The frame work andcoverfilletsshouldbeprovidedasperthedesignanddrawing,usingsecondclassteakwood.
The relevant specifications of item no. 13.01.f.1 shall be followed except that pre-laminated veneered ply shall be fixed inlining.13.01.g.1 Providingandfixing[]mmthick,craftpapercoatedPhenothermliningwithbuttjointingandnails.The frame work and
cover fillets should be provided as per the design and drawing, using second class teak wood.
1.0 Materials : Phenotherm of specified variety shall conform to M-71. Teakwood shall conform toM-29.6.Providing and fixing [] mm thick, decorative paper coated Phenotherm lining withbutt jointing and nails. The frame work and cover fillets should be provided asper the design and drawing, using second class teakwood.
The relevant specifications of item no. 13.01.g.1 shall be followed except that decorative paper coated Phenotherm shall beused.Providing and fixing [] mm thick, laminated Phenotherm lining with butt jointing
The relevant specifications of item no. 13.01.b shall be followed except that the plain Acrylic sheets shall be fixed in lining.In fixing acrylic sheets, care shall be taken to avoid rigid fixing as this may cause cracking if the supporting structure expands or shrinks.The sheets shall be fixed with wood screws and the screw holes shall be drilled slightly longer than the screws. The screwsshall be fixed at 150 mm. to 200 mm. centers, at supports. The sheets shall be fitted with wooden cover fillets, as describedin theitem.
Mode of Measurements and Payment:
The relevant specifications of item no. 13.01.b shall befollowed.Therateshallbeforaunitofonem2.13.01.i.2 Providingandfixing[]mm.thick,decorativeAcrylicsheetsliningwithbuttjointingandnails.Theframe
workandcoverfilletsshouldbeprovidedasperthedesignanddrawing,usingsecondclassteakwood.
The relevant specifications of item no. 13.01.i.1 shall be followed except that decorative Acrylic sheet shall be used.13.02 Providingandfixing1.20m.highfencingwith2m.longM.S.angleposts,40mm.x40mm.x6mm.size and oil painting in 3
coats, fixed at 2.5 m. C/C., with five horizontal lines and two diagonals of galvanised steel barbed wire, weighing9.38 Kg. per 100 m. (Min.), strained and fixed to posts with G.I. staples, including fixing the post in ground with 0.5 x0.5 x 0.5 m. block of C.C. 1:5:10 (1 cement : 5 sand : 10 graded brick aggregate, 40 mm. nominal size) etc.,complete.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
163
Title – Miscellaneous Works Sheet 4 OF 14
postsandoilpaintingin3coats,fixedat2.5m.C/C.,withthreehorizontallinesandtwodiagonals,oneach side of the boxand two diagonals at top of box, of galvanized steel barbed wire weighing 9.38 Kg. per 100 meter (Min.), strainedand fixed to posts with G.I. staples, including fixing the posts in the cement concrete coping above the 9" or 14" brickwall, at the height of 6', as per the drawings and instructions given by the Architect and Engineer-in-charge, etc.complete. The rate shall be only for the M.S. angles and barbedwiresonly.Therateshallincludeforpaintingofthefencing.
1.0 Materials : Structural steel conform to M-22. Oil paint shall conform to M-44. Barbed wire shall conform toM-65. Watershall conform to M-1. Cement shall conform to M-3. Sand shall conform to M-6. Bricks bats aggregate shall conform toM-14.
Workmanship:
All excavation, foundation concrete &brick work, refilling the trenches, brick work above G.L., coping, plastering andpaintingetc.workshouldbecarriedoutaccordingtorelevantitemsandthedetailedspecificationsforthesame.
Thetwoverticalpostof0.45m.height,ofM.S.angle40mm.x40mm.x6mm.shallbeplacedovertheconcretein true line and plumb, at the time ofconcreting the coping, with R.C.C. 1:2:4 (1 cement : 2 sand : 4 graded stone aggregates of 20 mm. nominal size). Necessary curing for theconcrete shall be done as per the relevant specifications.
The barbed wire shall be stretched and fixed in three horizontal rows and two diagonals, on each side of the box. The bottom row shall be150 mm. above the top of the finished surface of the coping/ground and the rest at 150 mm. center to center. The diagonal shall be stretchedbetween adjacent posts from top wire of one post to the bottom wire of the next post. The wires shall be fixed to posts by means of staples. Twodiagonals at the top in plan shall alsobe stretched betweenthe fourcornerpointsoftheboxandthesameshallbefixedtothepostsbymeans ofstaples.
TheM.S.anglepostsshallbepaintedwith3coatsofoilpaintofapprovedtintandshade.
Mode of Measurements and Payment:
All excavation, foundation concrete &brick work, refilling the trenches, brick work above G.L., coping, plastering and painting etc. work shallbe measured according to relevant items and the detailed specifications for the same. Thesameshallbepaidundertheheadoftherelevantitemsandasperrespectiveunit.
The M.S. angle box and peripheral barbed wires shall be measured as a whole unit in rmt. which includes the costofalllabourandmaterialsinvolvedforthesame.
Therateshallbeforaunitofonermt.
13.04 Providing and fixing, chain link fencing of 50 x 50 x 10 g G.I. chain link, width of the fabric shall be asper drawingwith G.I. tension wire at top and bottom, 8 g and with necessary accessories like nut &bolt etc. complete. Includingthe cost of 2 coats of zinc chromate (yellow) and 2 coats of best quality enamel paint as approved by Architect andEngineer-in-charge. Cost of vertical post and necessary fixing arrangement to M.S. post by M.S. flat, Cement concrete(1:2:4) and shuttering shall be paid separately as per relevant tenderitem.
1.0 Materials: WatershallconformtoM-1.CementshallconformtoM-3.SandshallconformtoM-6.Bricksbats aggregate shall conformto M-14. Oil paint shall conform to M-44. G.I. wire shall be of bestquality.
Workmanship:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
164
Title – Miscellaneous Works Sheet 5 OF 14
chain link shall be stretched between adjacent posts from top wire of one post to the bottom wire of the next post. The wiresshall be fixed to the posts by means of staples.2.4 TheM.S.anglepostsshallbepaintedwith2coatsofzincchromateand2coatsofbestqualityenamelpaintof approved tint andshade.Mode of Measurements and Payment:
The work shall be measured for the finished work from center to center of the posts. The items of excavation,1:2:4C.C and MS support system shall be measured according to relevant items and the detailed specifications for the same.3.2 The rate shall include the cost of all labour and materials (its taxes, levies, transportation etc.) involvedinthe operationsdescribedabove..3 The rate shall be for a unit of one smt. Excavation, C.C 1:2:4 and MS support system shall be paid extra undertheheadoftherelevantitemsandasperrespectiveunit.13.05.a Demolition and disposal of unserviceable materials with all leads and lifts: Lime Concrete,includingfinishing the
broken surfaces to match the surroundings, etc.complete.
1.0 Workmanship :1.0 Thedemolitionshallconsistofdemolitionofoneormorepartsofthebuildingasspecifiedorshowninthedrawings. Demolition impliestaking up or down or breaking up. This shall consist of demolishing whole or part of work including all relevant item asspecified or shown in thedrawings.The demolition shall always be planned before hand and shall be done in reverse order of the one in which the structure was constructed.This scheme shall be got approved from the architect before starting the work. ThishoweverwillnotabsolvetheContractorfromtheresponsibilityofproperandsafedemolition.Necessary dropping, shoring and under pinning shall be provided for the safety of the adjoining work or property, which is to be left intact,before dismantling and demolishing is taken up and the work shall be carried out in such a way that no damages is caused to theadjoiningproperty.Wherever required, temporary enclosures or partitions shall also be provided. Necessary precautions shall be taken to keep the dustnuisance down as and wherenecessary.Dismantling shall be commenced in a systematic manner. All materials which are likely to be damaged by dropping from a height ordemolishing roof, masonry etc. shall be carefully dismantled first. The dismantled articles shall be properly stacked, asdirected.All materials obtained from demolition shall be the property of the Client unless otherwise specified and shall be kept in safe custody untilhanded over to theArchitect.Any serviceable materials, obtained during dismantling or demolition shall be separated out and stacked properly as directed, with all leadand lift. All unserviceable materials, rubbish, debris etc. shall be stacked as directed by Architect, within thesite.Oncompletionofwork,thesiteshallbeclearedofalldebrisrubbishandcleaned,asdirected.Mode of Measurements and Payment:
Measurements of all work except hidden work shall be taken before demolition or dismantling and no allowance for increase in bulk shall be
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
165
Title – Miscellaneous Works Sheet 6 OF 14
disposingtheunserviceablematerialswithallleadandlift.Theratealsoincludesfortemporarystoringforthesafety of the portionnot required to be pulled down or of adjoining property and providing temporary enclosures or partitions whereconsiderednecessary.2.4 Therateshallbeforaunitofonem3.13.05.b Demolition and disposal of unserviceable materials with all leads and lifts. Plain cementconcrete.
1.0 Workmanship : The relevant specifications of item 13.05.a shall be followed except that the Plaincementconcrete work isto be demolished instead of limeconcrete.Mode of Measurements and Payment:
The relevant specifications of item no. 13.05.a shall befollowed.Therateshallbeforaunitofonem3.
13.05.c Demolition including stacking of serviceable materials and disposal or unserviceable materialswithall leadsand lifts - R.C.C work, including cutting the reinforcement and finishing the broken surfaces to match thesurroundings etc.complete.
1.0 Workmanship:Therelevantspecificationsofitemno.13.05.ashallbefollowedexceptthatdemolitionofR.C.C work is to bedone.Mode of Measurements and Payment:
The relevant specifications of item no. 13.05.a shall be followed except that the demolition of reinforced concrete structure is to bemeasured. The unserviceable materials shall be disposed of at all leads and lifts. The rate excludes scraping straightening of reinforcementbut includes cutting ofreinforcement.Therateshallbeforaunitofonem3.
13.05.d Demolition of brickworkandstonemasonryincludingbothsideplasteringorcladdingifanyonitstackingofserviceablematerialsanddisposalofunserviceablematerialswithallleadsandliftsetccomplete.
1.0 Workmanship : The relevant specifications of item no. 13.05.a shall be followed except that demolition of brickor stonemasonry in cement mortar is to bedone.Mode of Measurements and Payment:
The relevant specifications of item no. 13.05.a shall be followed except that the wall and independent piers of columns of brick or stonemasonry shall be measured in cubic meters. All copings, corbels, cornices and other projections shall be included with the
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
166
Title – Miscellaneous Works Sheet 7 OF 14
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
167
of item no. 13.05.a shall be followed. The rate shall include stacking the unserviceable materials as directed willleadandlift.2.2 Therateshallbeforanunitofonem2.13.05.f Dismantling doors, windows, ventilators etc (wood or steel) shutters including
chowkhatsarchitraves,holdfastsandotherattachmentsetc.completeandstackingthemwithinallleadandlifts.
1.0 Workmanship : The relevant specifications of item no. 13.05.a shall be followed except that the doors,windows,ventilators etc (wood or steel) shutters including chowkhats, architraves, holdfasts and other attachments etc. are tobedismantled.Mode of Measurements and Payment:
The relevant specifications of item no. 13.05.a shall befollowed.The doors, windows, ventilators etc. not exceeding 3 sq mt. in area (each) including shutters and chowkhats, architraves, holdfastsand other attachment to grams etc. will be dismantled and measured under thisitem.Therateincludesstackingserviceablematerialsasandwheredirectedwithallleadsandlifts.Therateshallbeforaunitofonenumber.
13.05.g Dismantling glazed tiles dado / flooring etc. and as directed including taking the materialsanddisposalofunserviceable material at nonobjectionable place to all leads andlifts.
Workmanship
The relevant specifications of item no. 13.01.a shall be followed except that the dismantling work of glazed tiles dado andflooring work to bedone.Mode of measurement andpayment
Therelevantspecificationsofitemno.13.01.ashallbefollowed.The rate shall be for a unit of one sq.meter.
13.05.h DismantlingofalltypesofPlaster,rakingoutjointsandcleaningthesurfacefornewplasteratallheights,
including disposal of unserviceable material at nonobjectionable place for all leads and lifts. Site shall be
selected bycontractor.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
168
Title – Miscellaneous Works Sheet 9 OF 14
13.05.i Dismantling of sanitary fitting like washbasin, Water closet pan indian & european type, flushingtank
including stacking the materials with all lead andlift.
2.0 Workmanship:
1.1 Therelevantspecificationsofitemno.13.05eshallbefollowedexceptthatthedismantlingworkofsanitaryfittingssuchaswashbasin,W.C.Pan(alltypeofpans),Flushingtanksetc.shallbecarriedout.3.0 Mode of measurement andpayment:
2.1 The rate shall be for a unit of onenumber.13.05.j Demolition of terrace covering like tiles / IPS / china mosaic with under layers of BBCC, BBLC, Brickbatkoba etc
of any thickness, upto the top of concrete of terrace slab, including stacking of servicable materials and disposalof unserviceable materials with all lead andlift.
Materials:
The relevant specifications of item 13.05(a) shall be followed except that the demolition of terrace tiles / any covering is to bedone.Mode of measurement andpayment:
The relevant specifications of item 13.05 e shall be followed except that the tiles / any covering of terrace shall bemeasuredinsq.mt.Theunserviceablematerialsshallbestockedasdirectedatallleadsandlifts.The rate shall be for a unit of onesq.meter.
13.05.k Dismantling of sheet roofing including ridges, hips, valley, gutters etc, stacking of serviceablematerialsanddisposal of unserviceable materials with all leads and lifts G.I. Sheetroofing.
Materials:
The relevant specifications of item No. 16.01 (I) shall be followed except that G.I. sheet roofing shall be dismantled instead ofconcretework.Mode of measurement andpayment:
The area of G.I. Sheet roofing shall be measured in sq. meter, Ridge, hips and valley shall be girthed andincludedwithroofarea.Corrugatedandsemi-corrugatedsurfacesshallbemeasuredflatandnotgirthed.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
169
Title – Miscellaneous Works Sheet 10 OF 14
extra shall be paid.In farmed steel gate, the weight of any covering materials of filling such as iron sheets and expanded metal shallbeaddedtotheweightofthemainarticlesifsuchcoveringisnotorderedtobetakenoutseparately.
Therateincludesstackingthematerialsasandwheredirectedwithallleadsandlifts.The rate shall be for a unit of onekg.
13.05.m DismantlingC.I/GIpipes,G.S.WpipesandA.Crainwaterpipeswithfittingandclampsincludingstaking
the material with all lead & lift (for any diapipe).
Workmanship:
Therelevantspecificationsofitemno.16.23shallbefollowedexceptthatthedismantlingworkofpipelinesofC.I.G.S.W & A.C. pipes with fittings shall be carried out.Mode of measurement andpayment:
TherelevantspecificationsofitemNo.16.01(i)shallbefollowed.Water pipe lines, including rain water pipes, with clamps and specials, sewer pipe lines (Salt glazed ware orconcrete)etc.shallbemeasuredinrunningmeterinclusiveofjoints(Themeasurementsshallbetakenalongthe centre line of pipes and fittings).2.2 The rate shall be for a unit of one runningmeter.Dismantling, demolition of platform (raised / kitchen) of any kind (Kota Stone / Granite / Cement concrete / sandwich) etc.,including removing of stone slab, concrete, screed mortar, brickwork and making good the same including filling the jariwork. Rate shall be inclusive for all heights at all floors, width, dimension etc. complete. The rate shall also be inclusive ofremoving / dismantling of sink (SS / Chinaware) etc. etc. complete as directed and instructed including stacking of serviceablematerials and disposal of unserviceable material with all leads andlifts.
Relevant specifications of items to be followed. The rate shall be for a unit of one Sq. Mtr.Dismantling of A.C. including all disconnection of electrical & drain provisions made & depositing thesame
to the concern authority as directed by EIC. The rates shall be inclusive of carrying out the work at all
floors / all levels / allheights.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
170
Title – Miscellaneous Works Sheet 11 OF 14
3.0 ModeofMeasurementsandPayment:TherateshallbeforaunitofonermtofPVCwaterstopprovided.Lap length shall bepaid.
Making weep holes upto 10 cm. diameter size, in R.C.C. work and filling the same with P.C.C. (1:2:4) andfinishing the same as per surrounding, including scaffolding, cutting and reinforcement bars, curingetc. complete, as perdirection.
Workmanship:
The PVC pipe shall conform to the relevant specification of item no. 1.23 of plumbing section, except the pipelength shall be of required length work providing water spout in R.C.C. retainingwalls.
The pipe shall be provided as per detail drawing and as directed during concreting of R.C.C. work.The surroundingofthePVCpipeshallbemadegoodbyfinishingwithcementmortar1:2.
Mode of Measurements and Paymnet:
The rate includes cost of all materials, labour, scaffolding, tools and plants required for satisfactory completion oftheitem.
Therateshallbeforaunitofonenumber.
Making Weep holes upto 15 cm. diameter size in R.C.C. work and filling the same with P.C.C. 1:2:4 andfinishing the same as per surrounding, including scaffolding, cutting, and reinforcement bars curingetc. complete, as perdirection.
The relevant specification of item no. 13.07.a shall be followed except the diameter of P.V.C. pipe shall be of 150 mm.
Providing and fixing PVC Grating, with locking provision, of size 375mm x 500 mm of Supreme or equivalent approvedmake set in concrete / on the supporting frame made out of metal sections as per drawing and asapproved by the Engineer in charge. (Concrete and MS fabrication items shall be paid in relavant civil itemsof thetender.)
The rate shall be for a unit of Rmt.
Providing and fixing at all height in all floor with all lead seamless type M/F suspended False ceiling of India Gypsum orequivalent using GI perimeter channel of size .55 mm thick(having one flange of 20 mmandanotherflangeof30mmandwebof27mm)alongwithperimeterofceiling,screwsfixedtobrickwall/ partitionwith the help of nylon sleeves and screws at 610mm centres. Then suspendeing GI intermediate channelsof size 45mm (.9mm thick with two flanges of 15mm each) from the soffit at 1220mm centres with ceilingangle of width 25mmX10mmX.5mm thick fied to soffit with GI cleat and steel expansion fasteners. Ceilingsection of .55mm thickness having knurled web of 51.5mm and two flanges of 26mm each withlips of10.5mm are than fixed to the intermediate channel with the help of connecting clip and in direction ofperpendicular to the intermediate channel at 5/457 mm centres. 12.5mm tapered edge gypboard (confirmingto IS 2095-1982 ) is then screw fixed to ceiling section with 25mm dry wall screws at 230mm centres.Screws fixing is done mechanically either with screw driver or drilling machine with suitable attachment.Finally the boards of 12.5mm thick gyp board are to be jointed and finished so as to have a flush lookwhich includes filling and finishing the tapered and square edges of the boards with jointing compound,joint paper tape and two coats of drywall topcoat suitable for gypboard including providing scaffoldingexecuting the work at all heights. (Please refer drawing for details and recommended practices of IndiaGypsum or equivalent) NOTE : For lighting fittings, grills diffuses and cutouts etc. have to be made with theframe of perimeter channels of size 20mm X 27mm X 30mm X .55mm thick supported suitable and shouldbe considered as perdrawing
In addition to above supplier’s specification is to be referred.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
171
13.09.a Providing and fixing at all heights in all floors ply wood ceiling (openable &fixed) using 12mm thickplywood confirming to IS 710 on MS box section (60 X 40 X 2.9mm) frame work (at every 600mm c/c cross direction andadditional members where openings - opening size of maximum 900mm x 1200mm) to support / suspend, seating anglesthrough the pheriphery of the false ceiling using equal angle of 40 X 40 X 5mm fixed to the surface (brick wall / concrete)using mechanical anchor fasters, on site welding, including
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
172
Title – Miscellaneous Works Sheet 12 OF 14
applying zinc chromate yellow primer to the box section, cutting as requried, wood frame for openable shutter(using Indian Teak wook - seasoned and treated for termites), Shutter of 12mm thick ply with beadings ofIndian teak work and hinges, providing locking arrangement with open stopper (powder coated), painting theceiling and shutter with enamel paint (glossy / matt finish) with primer coat, fixing the ply sheets to the MSwork by using SDST bolts of Hilti or Fisher, making grooves, wastages etc. etc. complete all as per the directionof Engineer-in-charge and as per the design and drawings
Revelent Material Specification is to be referred.13.10 ProvidingandFixingof19mmthickplywoodconfirmingtoIS710forraisedplatformworkinsandwich (2X19mm
thick plywood and providing filler material between two ply woods on MS structural framing work and civilwork as per design and drawing. Rate should include the cost of material at site, cutting, jointing (ply woodsandwich to MS structural work using HILTI self drilling screw (S-MD 03K 5.5X63) or equivalent etc to makesturdy, jointing the ply wood to filler material. Approximate 6 nos. of self drilling screws per sqm to beconsidered.) and also painting the same, filler material. The surface should be such prepared torecievethetilesfloorfittedwithchemicalabovethesame,etc.etc.completeasperthedetailsanduptothe satisfactionof engineer-in-charge / Architect. The surface prepared to be used as raised floor. The rateshallincludethecostofworkinplanareaaswellasrisersfortheraisedplatformwork.
Material:
The 19mm thick ply shall conform toM-37A.For filler material having sound insulating material supplier’s specification is to bereferred.To fix the plywood with MS structural work specification of HILTI self drilling screw (S-MD 03K 5.5X63) is to be referred.Workmanship :
19 mm thick ply confirming to IS 710 in sandwich with filler material having sound insulating properties in between on MSstructuralwork.HILTIselfdrillingscrewstobeprovidedtojoint19mmthickplywoodandfillermaterialtoMSstructuralwork.Mode of Measurement andPayment
The rate includes cost of all materials, labour, scaffolding, tools and plants required for satisfactory completion of theitem.2.2 TherateshallbeforaunitofsqmProviding and fixing 0.55 mm thick SMP Top coated and alkyd backer coated, trapezoidal profile of meta colour or equivalent,fixed with SDST bolts - Self Drilling Self Tapping Bolts of HILTI and necessary overlaps (minimum 150 mm) including cutting,erecting at all levels, providing openings, all fixtures and fixing accessories with EPDM seals, for end laps silicon sealantprofiled foam fillers etc. at ends below ridge and valleys, including all materials labour scaffolding wastage, tools, tackles,equipment, transportation, preparation of shop drawing, and excluding the cost of purlins, rafters etc. all complete as perspecifications drawings and as directed by architect/engineer- in-charge. Rate shall include end laps, side laps, bolts etccomplete excluding the cost of purlins, rafters and trusses. The sheets shall be supplied in custom lengths upto 12.0 m. Alloverlaps shall be sealed with silicone sealants.
a) Cladding. Fixed from innerside.b) Curved Portion. Fixed frombottom.c) Sloped Roof. Fixed frombottom.d) Flat Roof. Fixed frominside.
Project: - Construction of Dairy Building and ancillary works for Indor DudhSangh Ltd.
Sheet 13 OF 14Title – Miscellaneous Works
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
173
portion overhanging the wall support shall not be more than one fourth of the spacing of purlins.The bottom surface of the purlins shall be painted before the sheets are fixed to them. Embedded portions of purlins shall be finishedwith two coats ofcoal-tar.Laying of Sheets:
2.3.1 The sheets shall be fixed to the purlins from underside, to a true plane with the line of corrugations truly parallel or normal to thesides of area to be covered. The sheets shall not generally be built into the gables and parapets. They shall be bent up along theirside edges close to the wall and the junction shall be protected by suitable flushing or by projecting drip course.2.3.2. The laps at the end shall be provided, 150 mm. minimum, for roof slope of 1 in 2 (1 vertical:2 horizontal) and steeper but a lap of 200mm. shall be provided for flatter slopes than those above. The side lap shall be provided between two ridges of corrugations, ateach side.
The sheets shall be cut to the dimensions and to the shape of the roof, either along their lengths or their width and in slant across theline of corrugations, at hips and valleys. The sheets shall be cut carefully with a straight edge and chisel, to giveastraightfinish.Thesheetsshallbelaidsuchthatthelapsareturnedaway,fromtheusualdirectionoflocalheavyrain.Rateshallbeinclusiveofmobileplatform,scaffolding,forfixingthecladdingandsheetsfrominside/undersideoftheshed.Fixing of Sheets:
Sheets shall be fixed to the purlins or other roof members such as hips and valleys, rafters, etc., withSDST bolts with EPDM seals complete as per supplier’s specifications. As far as possible they shall befixed over the ridges. The fixing of ridge with the sheets shall be done with GI seambolts.Theroofwhencomplete,shallbetruetolinesandslopesandshallbeleak-proof.
Mode of Measurements and Payment:
The measurements of the sheets, both at their ends and along the side edges shall be measured. The overlaps of the sheets over thevalley piece and their under lap under the ridge, hip and flashing piece shall be included in the measurements.No deductions in measurements shall be made for openings like chimney stacks, sky-light, etc., having area upto 0.40 m2.norextrabepaidforextralabourincuttingandforwastage,etc.,informingsuchopenings.The rate shall include the cost of all materials and labour involved in all operations described above. The rate also includesthecostofprovision,erectionandremovalofthescaffolding,benching,ladders,templatesandtoolsrequiredforthepropererectionandcompletionofthework.Therateexcludesthecostofpurlins,raftersandtrusses.
3.2 Therateshallbeforanunitofonem2.13.12 Providing and fixing structural wall cladding using 2.5mm thick powder coated aluminium box sections 65mm X
55mm size for frame work and cladding with 4mm thick precoated ALUCO BOND aluminium composite panel ofdifferent sizes as specified and fixed using approved quaility gum tape, silicon sealent , etc; complete includingscaffolding, tools, plants, fixing materials, etc; complete all as per specifications and directions of EIC at all height for:panel size of 1200mm X 600mm OR 600mm X 600mm/300mm/150mm or smaller size of panels.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
174
Title – Miscellaneous Works Sheet 14 OF 14
Mode of Measurements and Paymnet:
Therateincludescostofallmaterials,labour,scaffolding,toolsandplantsrequiredforsatisfactorycompletionoftheitem.
TherateshallbeforaunitofoneNos.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
175
Title – General Development and Road Works Sheet 1 OF 45
15.01 Box cutting the road surface, to proper slope and camber as per drawing, for making a base for roadwork,including rolling with vibratory roller of 8 to 10 ton capacity with plain or pad foot drum or pneuamatic tyredroller of adequate capacity capable of acheiving required compaction in required camber, dry and wet rolling etc.complete as directed., removing the excavated stuff and depositing on road side etc. complete, as directed, upto 50m.lead.
Workmanship :The land width required for road way, gutter side slope and catch water gutter shall be cleared off all trees, having a girth of 30 cm.and less. The loose stones, vegetation, bushes, stumps and other objectionable materials shall also beremoved.Therootsofthetreesandstumpsshallberemovedupto30cm.belowthegradeformation.Allthematerials cleared will be the propertyof the Client. Useful material shall be arranged in convenient stacks, along the road boundary or as directed, at places within 50 m. leadand handed over to the Client, in convenient sections. Unsuitable materials shall be burnt or otherwise disposed off by the Contractor, athis own cost without causing any nuisance, inconvenience or damage to the work, property or the people in the neighbourhood. If thematerial is disposed off outside the road length, necessary permission of private land owner shall be taken by the Contractor and royaltyetc. if any,shallbepaidbyhim,withoutclaiminganycompensation.Allthematerialshallbedisposedoffinneatmanner.After clearing the site, the alignment of the road shall be properly set out, true to lines, curves, grades and sections shown on the planor as directed by the Architect and Engineer-in-charge. The Contractor shall provide all labours and materials such as lime, string, pegs,nails, bamboos, stones, mortar, concrete etc. required for setting out, establishing bench mark and giving profiles. The Contractor shall beresponsible for maintaining bench mark's profile, alignments and other stacks and marks, as long as they are required for the work, in theopinion of the Engineer-in-charge. If the Contractor defaults in this respect even after the direction of the Engineer-in-charge, within thespecified time, they may be restored by the Engineer-in-charge, at the cost of the Contractor. Levels and the sections of the ground shallbe taken and recorded in the presence of the Contractor or his authorized representative before the excavation is started, so as to serve asthe basis of measurement. The Contractor or his representative shall sign the field book in token of his acceptance of the levels, etc. Ifthere is any disagreement, the Contractor shall inform it in writing to the officer concerned, with specific representation before startingfurther work. Once the work is started, no cognizance of anycomplainshallbetaken.Merelynotsigningshallnotbedeemedasadisagreement.Profileofsectionsincludingtheroadsidegutterstobeexcavated,shallbelinemarkedattheintervalof10m.to15m. or as directed by theArchitect &Engineer-in-charge, to conform the curved or straight alignments, sections, grade and side slopes. The center line shall clearlybe marked and profile of embankment shall be set-up with the line marked on each side. The roadway section shall first be excavated withvertical side for each lift and the side slope for that lift shall be excavated in steps. The steps shall be smoothened to the required slope,when the excavation reaches the road formation. Contractor shall on no account excavate beyond the slope or below the specified gradeunless so directed by the Architect &Engineer-in-charge. If the excavation is done below the specified level or outside the specifiedsections, it shall not be paid for and the Contractor shall be required to fill up at his own cost such extra excavation in the road portion,with approved materials of the embankment grade in layers, watered and fully compacted, so as to obtain the maximum density laid downfor the embankment. The Contractor may require to keep the measurement, ridges and dead man to be left, at specified intervals or placesand kept intact, till ordered by the Engineer-in-chargetoremove,forthepurposeofcheckingthemeasurements.Theexcavationshallbefinishedneatly, smoothly and evenly to the correct lines,curves, grades, sections and side slopes as shown on the plans or directed by the Engineer-in-charge. The sub-grade if loose, shall bescarified, watered and compacted to the same density as that of embankment. The section, side slopes and catch water gutter shall bemaintained by the Contractor at his own cost in such a way that the formation of the gutter will be well drained by providing necessarydiversion, etc. Necessary passages shall be provided for leading away seepage, springs, surface flow or rain water safely without damagingthe work. Ifanydamageoccurs duetodefaultoftheContractorinthisrespect,heshallmakegoodthedamageathisown cost. If it is necessary inthe excavation of the work to interrupt existing surface drain, sewer or under drainage, temporary arrangements shall be provided till suchtime as and when necessary or as directed. The Contractor, at his own cost shall make the interrupted drainage and sewer etc. unlessseparately specified in the tender. Any damage to the existing work or work in hand caused as a result of his operations or negligence, shallbe made good by the Contractor at his own cost. Road side gutters shall be excavated to the specified sections and shall be measured alongwith the main cutting inm3.Care shall be taken to see that excavation is carried out in a safe manner so that, there will not be any risk to the work or workman,by landslides or falling material, boulders and collapsing sides,etc.If a landslide occurs in the cutting, it shall be removed as directed by the Engineer-in-charge. If the finished slopes,slidesintothe roadwaybeforefinalacceptanceofthe work, suchslideshallberemovedbytheContractorandshallbe paid extra for,at the contract rate for the class of excavation involved, provided the slides are not due to anynegligenceoftheContractor.Theclassificationofthematerialinslidesshallconformtoitscondition. removal and payment shallbe made accordingly regardless of its prior condition
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
176
Title – General Development and Road Works Sheet 2 OF 45
If there is a traffic nearby or if there are villages or towns in the neighborhood barricades, the traffic signals shall be providedfordayas wellasnightforthe duration ofthe work, insucha wayto prevent accidents. Warningsignalsshall be displayed on both sides, 7.0 m. away from thepoint of danger, giving sufficient warning. Necessary signalers shall be stationed at each end to regulate traffic wherever necessary or asdirected. Measure shall be taken to see that the excavation does not affect to the adjoining structures or properties. If there is any damageto the adjoining property, injury to workers, the public, animals, etc. due to the negligence of the Contractor, he will be responsible andliable to all the consequences, includingcompensation.All the excavated materials shall be the property of the Client. When the useful excavated materials is to be reused in the embankment,within a lead of 200 m., it shall be directly deposited in the required location, in specified layers. No handling or conveyance charges shallbe paid, if material is temporarily deposited elsewhere and subsequently conveyed to the site of deposition. The sequence of the operationshall be arranged properly. Material required for the item other than the bank shall be arranged in neat stacks at convenient places withoutinterfering with the drainage, in any way. If no area of land is available on site and the excavated useful stuff is to be stacked temporarilybefore being reused under the same agreement, the Contractor shall make his own arrangement for stacking of these materials temporarilyon private land by paying rents, etc., without claiming any compensation. Surplus materials not required for reusemaybeusedofhis own,touniformlywidened theembankment, toflattentheslopeandtofilllowerplacesinthe road land, if so permitted by the Engineer-in-charge.Materials not required for the reuse, whatsoever, may be disposedoffbytheContractor,athisowncostinmannerapprovedbytheEngineer-in-charge.IftheContractor doesnot wish toutilise thequantityofcutting within thespecifiedleadforanyreason,thenhemaydo the embankment work withthe earth brought from the other sources. But in that case, the full or the part of acceptable quantity of stuff for which payment is made orto be made will be deducted from net quantity of the earth work in embankment arrived at within chainage measured asabove.The contract rate shall be for an unit of one m3. Excavation shall be measured in its original position by taking cross section before thework starts and after its completion. The quantity shall be worked out by the average area method. When the classification of the stratachanges, the Contractor shall bring this to the notice of the Engineer-in-charge,whowillthenverifyandifnecessary,takelevelsforthechangedstrataforthepurposeofthemeasurement.
Extra for disposing of the surplus excavated material on site, including loading at site, transporting&disposal,unloading,spreadinganddressingetc.complete,withinaleadof50m.to500m.,asdirectedbythe Engineer-in-charge..
The relevant specifications of item no. 1.14.a shall be followed.Extra for disposing of the surplus excavated material on site, including loading at site, transporting &disposal, unloading,
spreading and dressing etc. complete, within a lead of 500 m. to 1.0 km., as directed by theEngineer-in-charge.
The relevant specifications of item no. 1.14.b shall be followed.Supplying and spreading of large size hand broken graded (rubble) stone aggregates 90 mm. to 63 mm. size for soling and
Water Bound Macadam Surface including spreading the same in required grade and camber in two layers of 90 mm. thick each toobtain compacted thickness of 115 mm. filling the hollows with smaller size stone aggregates, spauls, spreading good qualitymurrum to fill up the interstices and voids to make plain surface, spreading of blindage, profusely watering includingconsolidating by power driven roller of 8 to 10toncapacityinrequiredcamber,dryandwetrollingetc.completeasdirected.Materials:Hand broken metal 90 mm. to 63 mm. size shall be collected by the Contractor to the site of work. Stacking shall be done in systematic wayso as to allow easy inspection and in such a place as will not cause any loss. The metal shall be collected from approved quarry situatedaround Sevalia (black trap)or place near to the site as approved by the Architects andEngineer-in-charge.Murrum or selected earth brought from outside shall be clean, of good binding quality, and of approved quality obtained from approvedpots/quarries of disintegrated rocks which contain silicones materials and natural mixture of clay of calcareous origin. The size of murrumshall not be more than 20 mm. and shall be approved by the Engineer- in-charge beforeuse.ThecontrolonqualityofmaterialshallbeexercisedbytheEngineerbycarryingouttherequiredtestsatthe
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
177
Title – General Development and Road Works Sheet 3 OF 45frequencies as per IS norms from time to time as directed by the Engineer-in-chargeThe sample of the metal collected shall be got tested at Govt. recognised laboratory or as approved by the Architect andEngineer-in-charge.ThecostofthesameshallbebornbytheContractor.Materials for the purpose shall be of approved quality. Any material which is found of inferior quality shall be rejected and the Contractorshall remove such rejected material from the site at his own cost immediately. The material shall be collected from quarries approved bytheEngineer-in-charge.The material shall be got approved by Engineer-in-charge prior to collection on site. It shall be free from all rubbish, dust and any organicmaterials as well as clods of black cotton soil. Material shall not be allowed to be collected within the road boundary. Material to be used ascrust and for side shoulders shall have a C.R.B.I's report and that to be used as blindage in W.B.M. road construction shall have P.I. Value ofless than 6, as determined in accordance with IS:2720(Part-V).
Workmanship :Regular stacks shall be done by the Contractor on a fairly level ground. Stacking of the metal shall be done in amannerasdirectedbytheArchitectandEngineer-in-charge.Stacking of material as per requirement shall be carried out. The metal stack shall be checked by the Engineer-in- charge beforespreading. The collection shall always commence at one end of the road and carried out continuously towards the other end unless theArchitect and Engineer-in-charge shall directotherwise.It shall be spread evenly on the prepared surface in required grade and camber by using camber broads etc. so as to ensure that thesurface is in true camber and grade. At least two camber boards shall be in use on site. The surfaceshallbecheckedatevery50ft.bymeansoftemplates,while thecorrectnessofthecamberinbetweenshallbetested by strings and corrected asrequired. Between the straight lengths and the curves and the meeting points of the convex and concave portions of reverse curves thechange in camber of the road and super elevation shall be made very gradually as directed by the Architect andEngineer-in-charge.Metal shall not be spread without permission of the Architect and Engineer-in-charge. Metal should be spread under carefulsupervision and by trained collies only. Contractor shall see that uniform spreading as per collection of metal is done. The Contractor shallspread the metal fully from the stacks without keeping any balance unless directed by the Architect and Engineer-in-charge to keep somestacks in balance for making unevenness or depressions good during rollingwork.To ensure that the materials are spread to the required thickness, the road surface shall be marked out on to the length over whichthe contents of heaps are to be spread. The bounds of earth or murrum (one on either side) shall be made along the outer edge ofmetalling simultaneously with spreading of metal. These bounds shall be laid with a distance equal to the width of the road to be metalledand shall be enough to prevent the loose metal from spreading outduringconsolidationandtoretainwaterusedforconsolidationaswell.The spreading of metal shall proceed only 200 m. (maximum) advance of the rolling operations. At the time of rolling, all surfaceirregularities hollows, depressions, humps, shall be set right. The spreading of metal in required layer shall be done by theContractor.Immediatelyafterthespreadingofthestonerollingshallbestartedwiththreewheeledpowerroller8to12toncapacity or tandem roller orequivalent vibrator roller. The weight of the roller shall depend upon the type of the aggregate andasindicatedbytheArchitectandEngineer-in-charge.Except on super elevated portions where the rolling shall proceed from inner edge to outer, rolling shall begin from the edgesgradually progressing towards the center. First the edge/s shall be compacted with roller running forward and backward. The roller shallthen move inward parallel to the center line of the road, in successive passes uniformly lapping preceding tracks by at least one halfwaywidth.Rolling shall continue until the aggregate is thoroughly keyed and the creeping of the aggregate ahead of the roller isnolongervisible.Duringrollingslightsprinklingofwatermaybedone.Ifnecessary,rollingshallnotbedone.Whenthe sub-gradeissoftoryieldingorwhenitcausesawavelikemotioninthesub-gradeorsub-basecourse.The roller surface shall be checked transversely and longitudinally with templates and any irregularities corrected by loosening thesurface, adding or removing necessary amounts of aggregate and rerolling until the entire surfaceconformstodesiredcamberandgrade.Innocaseshallbeuseofscreeningbepermittedtomakeupdepressions.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
178
Title – General Development and Road Works Sheet 4 OF 45
The blindage material where it is required to be used shall be applied, successfully in two or more thin layers at a slow and uniformrate. After each application, the surface shall be continuously sprinkled with water, the resulting slurry shall be swept in with handbrooms or mechanical brooms to fill the voids properly and rolled, during which water shall be applied to the wheels of the rollers ifnecessary to wash down the binding materials sticking to them. These operations shall continue until the resulting slurry after filling ofvoids, forms a wave ahead of the wheels of the moving roller.After the final compaction of water bound macadam course, the road shall be allowed to dry overnight. Next morning hungry spotsshall be filled with screening of binding materials as directed, lightly sprinkled with water if necessary, and rolled. No traffic shall beallowed on the road until the macadam has set. The Architect and Engineer-in-charge shall have the discretion to stop hauling traffic fromusing the completed water bound macadam course if in his opinion it would cause excessive damage to thesurface.Mode of Measurement and Payment:Payment shall be made on m3 basis without deduction forvoids.The rate includes digging the murrum, supplying, conveying with all lead and lift on the road side and stacking the same in regularstacks and making side shoulders. Material shall be collected in required quantity only at any stage of work.The contract unit rate for collecting, carting and spreading shall include:
1. Obtaining metal and murrum from approvedquarry.2. Transporting atsite.3. Storing, stacking, protecting andspreading.4. Keeping record of supply anduse.5. Rolling the metalled surface with 8 to 10 toncapacity power driven roller.6. Testing the samples in the approvedlaboratory.
Supplying and spreading of largesizehandbrokengradedstoneaggregates63mm.to40mm.sizeincluding spreading the same inrequired grade and camber in two layers of 90 mm. thick each to obtain compacted thickness of 115 mm. filling the hollowswith smaller size stone aggregates, spauls, spreading good quality murrum to fill up the interstices and voids to make plainsurface, profusely watering including consolidating by power driven roller of 8 to 10 ton capacity in required camber, dry andwet rolling etc. complete as directed.
The relevant specification of item no. 15.03 shall be followed except the size of the hand broken stone aggregate shall be 63mm. to 40 mm. instead of 90 mm. to 63 mm.Providing, stacking and laying rubble soling, 23 cm. thick(compacted thickness), in a compact manner torequiredcamber&gradientasperdrawing,insubbaseforroadusing150to230mm.handbrokenblackhard stones, covering andlevelling the surface with a layer of murrum after filling the voids with smaller sized stones or stone chips, including watering,rolling well with power roller of 8 tio 10 ton capacity and consolidating each layer, asdirected.
Materials:Stone and stone chips shall conform to M-16 and Murrum brought from outside shall be clean, of good binding quality, and ofapproved quality obtained from approved pots/quarries of disintegrated rocks which contain silicones materials and natural mixture ofclay of calcareous origin. The size of murrum shall not be more than 20 mm. and shall be approved by theEngineer-in-charge.Rubble stones 150 mm. to 230 mm. size shall be collected by the Contractor to the site of work. Stacking shall be done in systematicway so as to allow easy inspection and in such a place as will not cause any loss. The rubble shall be collected fromapproved quarry situated around Sevalia (black trap) or from quarry approved by the Architects and Engineer-in-charge.and the Contractor shall remove such rejected material from the site at his own cost immediately.The control on quality of material shall be exercised by the Engineer by carrying out the required tests at thefrequenciesasperISnormsfromtimetotimeasdirectedbytheEngineer-in-charge.The sample of the rubble collected shall be got tested at Govt. recognised laboratory. The cost of the same shall be born bytheContractor.Materialsforthepurposeshallbeofapprovedquality.Anymaterialwhichisfoundofinferiorqualityshallberejected
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
179
Title – General Development and Road Works Sheet 5 OF 45
1.6 The materials shall be got approved by Engineer-in-charge prior to collection on site. It shall be free from allrubbish, dustand any organic materials as well as clods of black cotton soil. Material shall not be allowed to be collected within the roadboundary. Material to be used as crust and for side shoulders shall have a C.R.B.I's report and that to be used as blindage inW.B.M. road construction shall have P.I. Value of less than 6, as determined in accordance with IS:2720 (Part-V). The materialto be used should be got tested prior to use in road construction. Testing charges shall be borne by theContractor.Workmanship :The first layer of stone, of average size 150 to 230 mm. shall be laid in roads, pavings etc. Thereafter, the voids between the stones laidin the first layer shall be filled by hand packing the stones of smaller size or stone chips of the same stones, as directed. The voids shall befilled with largest possible stones. The layers then shall be rammed well andconsolidated.The surface of the stone layer then shall be covered and levelled with a layer of murrum. This then shall be watered and wellconsolidated using power driven rammers or rollers as directed. The consolidated thickness of the above layers totally should be average 23cm.thick.Collection of the materials shall be completed in whole, campus wise, as per the final requirement and measurement shall be recorded.Until the quantity of materials as per the final requirement is not collected work shall not be started and payment shall not bedone.Stacking of material as per requirement shall be carried out. The collection shall always commence at one end of the road and carriedout continuously towards the other end unless the Architect and Engineer-in-charge shall direct otherwise.It shall be spread evenly on the prepared surface in required grade and camber by using camber broads etc. so as to ensure that thesurface is in true camber and grade. At least two camber boards shall be in use on site. The surface shallbecheckedatevery50ft.bymeansoftemplates,whilethecorrectnessofthecamberinbetweenshallbetested by strings and corrected as required. Between the straight lengthsand the curves and the meeting points of the convex and concave portions of reverse curves the change in camber of the road and superelevation shall be made very gradually as directed by the Architect andEngineer-in-charge.Rubble shall not be spread without permission of the Architect and Engineer-in-charge. Rubble should be spread under carefulsupervision and by trained collies only. Contractor shall see that uniform spreading as per collection of rubble is done. The Contractor shallspread the rubble fully from the stacks without keeping any balance unless directed by the Architect and Engineer-in-charge to keep somestacks in balance for making unevenness or depressions good during rollingwork.To ensure that the materials are spread to the required thickness, the road surface shall be marked out on to the length over which thecontents of stacks are to be spread. The bounds of earth or murrum (one on either side) shall be made along the outer edge of soilingsimultaneously with spreading of rubble. These bounds shall be laid with a distance equal to the width of the road to be metalled and shallbe enough to prevent the loose rubble from spreading outduringconsolidationandtoretainwaterusedforconsolidationaswell.Atthetimeofrolling,allsurfaceirregularitieshollows,depressions,humps,shallbesetright.Mode of Measurement and Payment:
Payment shall be made on m3 basis after deduction for voids at 75% of the recorded measurements, at 75% of the rate quoted by theContractor and remaining 25% shall only be released after the spreading of rubble and murrum inlayerwiseiscompletedasdirectedbytheArchitectandEngineer-in-chargeoraspertheactualworkdone.The rate includes the cost of collecting, carting stones and murrum, with all leads, lifts and labour for laying, hand packing andconsolidating the same for roads, pavings,etc.The contract unit rate for collecting, carting and stacking shall include:
1. Obtaining rubble from approved quarry at Himmatnagar or nearby place as approved by the Architect and Engineer-in-charge.2. Transporting atsite.3. Storing, stacking andprotecting.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
180
Title – General Development and Road Works Sheet 6 OF 45
4. Keeping record of supply anduse.5. Testing the samples in the approvedlaboratory.The rate includes digging the murrum, supplying, conveying with all lead and lift on the road side and stacking the same in regularstacks of the required dimensions, spreading, etc. complete. Material shall be collected in required quantity at any stage ofwork.Therateshallbeforaunitofonem3andincludesalltheaboveoperationswithallleadandliftexceptconsolidation.
15.06.a Supplying and spreading of murrum/binding material for any work like make up of ground, filling, etc. includingspreading the same in required grade and camber, in 15 cm. thick layers to obtain required compacted thicknessto make plain surface, profusely watering including consolidating by power driven roller of 8 to 10 ton capacityor suitable means as directed in required camber, dry and wet rolling etc. complete asdirected.
Materials and Workmanship:
Materials for the purpose shall be of approved quality. Any material which is found of inferior quality shall be rejected and theContractor shall remove such rejected material from the site at his own cost immediately. The material shall becollectedfromquarriesapprovedbytheEngineer-in-charge.Thematerialshallbegranularandgritty.The material shall be got approved by Engineer-in-charge prior to collection on site. It shall be free from all rubbish, dust and anyorganic materials as well as clods of black cotton soil. Material shall not be allowed to be collected within the road boundary. Material to beused as crust and for side shoulders shall have a C.R.B.I's report and that to be used as blindage in W.B.M. road construction shall have P.I.Value of less than 6, as determined in accordance with IS:2720 (Part-V). The material to be used should be got tested prior to use in roadconstruction. Testing charges shall be borne by theContractor.River or nala or sea sand required for the work shall be clear, sound, properly graded, free from organic material, siltclayetc.andshallbegotapprovedfromtheArchitectandEngineer-in-charge.ThesandshallbeobtainedandbroughtfromthesourceapprovedbytheArchitectandEngineer-in-charge.Thesandshallbewellgraded.Itshallbestackedonroadlandbeyondthetopofthebankandonalevelground.Mode of Measurement and Payment:
The payment shall be made onm3 basis.The rate includes digging the murrum, supplying, conveying with all lead and lift on the road side and stacking the same in regularstacks of the required dimensions. Material shall be collected in required quantity only at any stage of work.
15.06.b Supplying and spreading good quality coarse river sand for any work like make up of ground, filling, preparing sub-base for soling, mettaling etc. including spreading the same in required grade and camber, in
15 cm. thick layers to obtain required compacted thickness to make plain surface, profusely watering includingconsolidating by suitable means as directed in required camber etc. complete as directed.
1.0 Materials:SandshallconformtoM-6andshallbefromthesourceapprovedbytheArchitectandEngineer-in-charge. It shall bescreened and free from rubbish, dust, grassetc.Workmanship :Spreading of sand shall be started after the full quantum is collected, measured and recorded in the measurement books. Permissionof the Architect and Engineer-in-charge shall be obtained before spreading of sand is allowed. Before spreading, it shall be seen that theformation is dressed to the required camber and grade. The spreading of sand shall be uniform and as it has to act as a binding surface. Itshall be forming a smooth running surface, as far as possible.Therateisforgrossmeasurementsandnodeductionofvoidsshallbemade.
If the sand is to be spread on lower earthen embankment as a sub-base or for side shoulders, it shall be spread in a manner as directed bythe Architect and Engineer-in-charge and as per required width and thickness. The Contractor shall make good all unevenness,depressions, projections, etc. during consolidation work and rate of this item includes all these operation exceptconsolidation.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
181
Title – General Development and Road Works Sheet 7 OF 45
3.2 The rate includes cost of collecting, carting good quality sand, with all lead, lift and labour for spreading thesame. Therateshallbeforanunitofonem3.15.07 Supplyingandlayingofmetal125mmthk.incompactmannerintwolayersof75mmand50mmeach,using
40 mm down machine cut graded aggregate in required camber and slope as per drawing, including, providingand spreading murrum in first layer and bitumen in second layer for semi grouting at 1.5 kg/sq.m. Providing andspreading the kapchi/Grit at the rate of 0.013 cmt. Per sq. mt. with rolling with 8 to 10 T roller etc. completely asdirected for 80/100 grade..
1.0 Materials : The Rubble shall be from quarry approved by the Architect and Engineer-in-charge. Rubble stones150mmto230mmsizeshallbecollectedbythecontractortothesiteofwork.Workmanship :
It shall be spread evenly on the prepared surface, in required grade and camber by using camber broads, etc. so as to ensure thatthe surface is in true camber and grade. Atleast 2 camber boards shall be in use on site. The surface shall be checked at every 50 ft. bymeans of templates, while the correctness of the camber in between shall be tested by strings and corrected as required. Between thestraight lengths and the curves and the meeting points of the convex and concave portions of reverse curves the change in camber of theroad and super elevation shall be made very gradually,asdirectedbytheArchitectandEngineer-in-charge.Rubble shall not be spread without permission of the Architect and Engineer-in-charge. Rubble should be spread under carefulsupervision and by trained collies only. Contractor shall see that uniform spreading as per collection of metal is done. The Contractorshall spread the metal fully from the stacks without keeping any balance, unless directed by the Architect and Engineer-in-charge tokeep some stacks in balance for making unevenness or depressions good during rollingwork.To ensure that the materials are spread to the required thickness, the road surface shall be marked out on to the length over whichthe contents of heaps are to be spread. The bounds of earth or murrum (one on either side) shall be made along the outer edge ofmetalling simultaneously with spreading of metal. These bounds shall be laid with a distance equal to the width of the road to bemetalled and shall be enough to prevent the loose metal from spreading out during consolidation and to retain water used forconsolidation as well. Payment for bounds will be made in the respectiveitem.The spreading of rubble shall proceed only 200 m. (maximum) advance of the rolling operations. At the time of rolling, all surfaceirregularities hollows, depressions, humps, shall be set right. The spreading of rubble in required layer shall be done by theContractor.
3.0 Mode of Measurements and Payment : The rate for this item shall be paid on m3. basis and includes all the aboveoperations with all lead and lift exceptconsolidation.15.08 Rolling and consolidating water bound macadam surface, soling, metalling etc. (except laterite andkankar),
thickness not exceeding 230 mm. (main layer including binding material) including watering, rectifyingdepressionswhichoccurduringtheprocesswithpowerroller8tonto12ton.
Workmanship :Immediately after the spreading of the coarse aggregate, rolling shall be started with three wheeled power roller 8 to 12 toncapacity or tandem roller or equivalent vibrator roller. The weight of the roller shall depend upon the type of theaggregateandasindicatedbytheArchitectandEngineer-in-charge.Except on super elevated portions where the rolling shall proceed from inner edge to outer, rolling shall begin from the edgesgradually progressing towards the center. First the edge/s shall be compacted with roller running forward and backward. The roller shall
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
182
Title – General Development and Road Works Sheet 8 OF 45
The blindage material where it is required to be used shall be applied, successfully in two or more thin layers at a slow and uniform rate.After each application, the surface shall be continuously sprinkled with water, the resulting slurry shall be swept in with hand brooms ormechanical brooms to fill the voids properly and rolled, during which water shall be applied to the wheels of the rollers if necessary towash down the binding materials sticking to them. These operations shall continue until the resulting slurry after filling of voids, forms awave ahead of the wheels of the moving roller.After the final compaction of water bound macadam course, the road shall be allowed to dry overnight. Next morning hungry spots shall befilled with screening of binding materials as directed, lightly sprinkled with water if necessary, and rolled. No traffic shall be allowed on theroad until the macadam has set. The Architect and Engineer-in-charge shall have the discretion to stop hauling traffic from using thecompleted water bound macadam course if in his opinion it would cause excessive damage to thesurface.3.0 Mode of Measurement and Payment : Payment will be made on m² basis of the finished work and shall includeofwatering, rent of mechanically driven roller, cost of fuel, wages of drivers and cleaners, earthen and murrum boundetc.Rolling and watering of sub-grade including filling in depression which occur during the process with power roller 8 to 12ton.The relevant specification of item no. 15.08 shall be followed except that rolling work shall be carried out on sub-grade.
Providingandfilling12mm.thickpremouldedexpansionjointasperdrawingetc.completeasdirected.The relevant specification of item no. 4.21 shall be followed except that the thickness of joints shall be 12 mm. and the joints shall beprovided in C.C. road.Supplying, stacking and heating 60/70 or 80/100 asphalt at 350 F temperature including grouting at the rate of 3 kg/m² as perdirection ofEngineer-in-charge.The relevant specification of item no. 15.13 shall be followed except that work shall be carried out for heating and spreading ofasphalt for semigrout surface. The rate shall be for a unit of one m².Supplying, stacking and spreading 6 mm. down size grit of approved quality at the rate of 1.5 m3/100 m² etc. complete asdirected including rolling with 8 to 10 tonroller.The relevant specification of item no. 15.14 and 15.06.a shall be followed except that work shall be carried out for spreading 6 mm.grit for semigrout road. The rate shall be for a unit of one m².Providing and laying 37 mm. thick consolidated carpet course by heating and mixing asphalt and aggregate with continuousbatching hot mix plant, spreading the same by paver finisher machine using B.T. Chips (stone aggregates) 12 mm. to 20 mm.size and sand in required proportion at a rate of 6m3/100 m² of surface as per required gradation and asphalt 60/70 or 80/100at a rate of 56 kg/m3 of aggregates but not less than 3.60% by weight of mix and applying tack coat at a rate of 1.0 kg/m² onW.B.M. surface including scraping, brooming, transporting, spreading and consolidating with power roller of 8 to 10 ton so thatthe resulting surfaceiseven,smoothandinperfectlineand leveltothesatisfactionofEngineer-in-chargewithallrequired tools, plant,machinery, labours, oil, kerosene, firewood etc. complete asdirected.
1.0 Description: Thisworkshallconsistofconstructioninasinglecourseof25mm.thickopengradedcarpetona previously preparedbase to the requirements of thisspecifications.Materials:Binder : The binder shall be straight run bitumen of 60/70 or 80/100 grade satisfying the requirement of IS: 73. TheactualgradeofthebindertobeusedshallbedecidedbytheArchitectandEngineer-in-charge.Coarse Aggregates : The coarse aggregate shall consist of crushed stone or crushed gravel. These shall be clean, durable, of cubicalshape, free of disintegrated pieces, organic or other deleterious materials and matter and adherentcoatings.Theaggregateshallpreferablybehygroscopicandoflowporosityandshallsatisfythephysicalrequirements set forth asunder:
2.2.1 Physical Requirement shall be as under:----------------------------------------------------------------------------------------------------------------------------- -------------------------No. Test Test Methodconformto Requirements------------------------------------------------------------------------------------------------------------------------------------------------------
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
183
Title – General Development and Road Works Sheet 9 OF 45
1. Los Angles AbrasionValue* IS:2386 40%maximum2. Aggregate ImpactValue* IS:2386 30% "3. Flakiness Index IS:2386 35% "4. StrippingValue IS:6241 25% "5. WaterAbsorption IS:2386(Part-III) 02% "----------------------------------------------------------------------------------------------------------------------------- -------------------------Note : * Aggregate may satisfy requirements of either of the two tests.
2.2.2 Aggregate Gradation : The mineral aggregates, including fine aggregate shall be so graded or combined asto conformto grading set forth in table below:Aggregate Gradation for Asphalt Carpet :------------------------------------------------------------------------------------------------------SieveSize % by weight by passingthesievefor 20 mm.thickness.------------------------------------------------------------------------------------------------------20.00mm. 10012.5mm. 70 -10010.00mm. 20 -404.75mm. 0 -52.36mm. -------------------------------------------------------------------------------------------------------
Proportioning of Materials:The binder content for premixing shall be at a rate of 56 kg/m3 of aggregates but in any case not less than 3.6 % by weight of thetotalmix.The quantities of aggregates shall be sufficient to yield the specified thickness after compaction. The Contractor shall have theresponsibility of ensuring proper proportioning of materials to have a homogeneous and uniform mix. A variation in binder content of +0.3 percent by weight of total mix shall however, be permissible in individual specimens taken for quality control tests vide MOSTspecification section900.Construction Operations :Weather and Seasonal Limitation : Premixed carpet shall not be laid during rainy weather when the base course is damp orwet.Preparation of Base : The base on which carpet is to be laid shall be prepared, shaped and conditioned to the specified lines, gradeand cross section in accordance with MOST specification clause 601 or as directed by the Engineer-in-charge.Thesurfaceshallbethoroughlysweptandscrapedcleanandfreeofdustandforeignmatter.Project: - Construction of Dairy Building and ancillary works for Indor Dudh
Sangh Ltd.
Sheet 10 OF 45Title – General Development and Road Works
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
184
Cold Aggregate Feeder : The cold aggregate feeder shall have minimum three independent bins or compartments, each provided withaccurate mechanically pre-determined rate of feeding the aggregates to cold elevator or to some intermediate conveyor or directly intothe dryer. The feeder shall provide for the adjustment of total and proportional feedandshallbecapableofbeinglockedinanysetting.Dryer : The dryer shall be capable of continuously agitating the aggregates while heating to the desired temperature. At the discharge endof the dryer or any other suitable location, means shall be provided for ascertaining the temperature of the heatedaggregate.Screening Unit and Gradation Control : The dried aggregate shall be screened into in not less than three sizes. The plant shall includemeans for accurately proportioning each bin size of aggregate either by weight or volumetric measurement. When the gradation control isby volume, the unit shall include a feeder mounted under the compartment bins. Each bin shall have an accurately controlled, individualgate to form an orifice for proportioning the material drawn from each respective bin compartment. The orifice shall have positivemechanical adjustment and provided with a lock. Indicators shall be provided on each gate to show the opening incentimeters.Mixer Unit : The plant shall include a mixer of an approved twin shaft pugmill type capable of producing a uniform mix.Ifnotenclosed,themixerboxshallbeequippedwithadusthoodtopreventlossoffines.Mineral Filler Supply Unit : There shall be an independent unit to feed mineral filler directly into the pugmill. The hopper to bin formineral filler shall provide for the adjustment of proportion of the filler with the aggregate and bitumenfeedsandshallbecapableofbeinglockedinanysetting.Bitumen Heater : A heating system for bitumen always with effective and positive control of temperature shall be provided to maintainproper temperature and for allowing continuous circulation between storage tank and proportioning units during the entire operatingperiod. Suitable arrangements shall be provided for recording the temperatureatthetankandinthecirculatingsystem.Synchronisation : For synchronisation of aggregate bitumen and filler feeds satisfactory means shall be provided to afford positive inter-locking control between the flow of aggregate from the bins or compartment and flow of bitumen from the tank and flow of mineralfiller.Thetemperatureofbinderatthetimeofmixingshallbeintherangeof150Cto177Candaggregates intherangeof 155 C to 163 C. Provided alsothat at no time shall be difference in temperature between the aggregates and the binder exceed 14C.Mixing shall be through to ensure that a homogeneous mixture is obtained in which the particles of the mineral aggregates arecoateduniformly.The mix shall be transported from the mixing plant to the point of use in suitable vehicles. The vehicles employed fortransportshallbecleanandbecoveredoverintransitifsodirectedbytheEngineer-in-charge.Spreading : The mix transported from the hot mix plant the site, shall be spread by means of self propelled mechanical paver withsuitable screeds capable of spreading, tamping and finishing the mix, true to specified grade,linesandcrosssections.Thetemperatureofmixatthetimeoflayingshallbeintherangeof121Cto163C.Longitudinal joints and edges shall be constructed true to the delinquating lines parallel to the center line of the road. Longitudinal jointsshall be off set by at least 150 mm. from those in the binder course. All joints shall be cut vertical tothefullthicknessofthepreviouslylaidmixandthesurfacepaintedwithhotbitumenbeforeplacingfreshmaterial.
Rolling:Immediately after the spreading of mix, it shall be thoroughly compacted by rolling with a set of rollers moving at a spread not exceeding5 km/hour. The initial or break down rolling shall be with 8/10 ton three wheeled roller and the surface finished by final rolling with 8/10ton tandem roller orsuitable roller.The'+r wheels shall be kept damp with the water to prevent the mix from adhering to them but in no case shall fuel or lubricating oil beused for this purpose. Rolling shall commence longitudinally from the edge and progress towards the center except that on super elevatedportions, it shall progress from the lower to upper edge parallel to the center line of the pavement. The roller should proceed on the freshmaterial with rear or fixed wheel leading so as to minimize the pushing of the mix and each pass of the roller shall uniformly overlap notless than one third of the track made in the proceeding pass. Rolling shall continue until the entire surface has been rolled to compactionand all the roller marks eliminated.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
185
Title – General Development and Road Works Sheet 11 OF 45
Opening to Traffic : Traffic may be allowed immediately after completion of the final rolling when the mix has cooled down to thesurroundingtemperature.Surface Finish and Quality Control of Work : The surface finish of construction shall conform to the requirements of MOST Specificationclause 901. Control on the quality of material and works shall be exercised by the Engineer-in- charge in accordance with MOST specificationclause902.
Arrangement for Traffic : The provision of MOST Specification Clause 105 shall apply as regards the flow of traffic duringconstruction.Mode of Measurement and Payment:Thepaymentshallbemadeonthetonnagebasisoftheweightofmixofaggregatesandbitumen.Forthispurposethe Contractor shall have toinstall a weigh bridge of suitable capacity for the purpose of weighment of dumpers at suitable place at his cost as directed. Weight of emptydumpers and weight of loaded dumpers will be recorded in bound and numbered register on plantsite.The Client will feel free to get some loaded dumpers tested and checked at other weigh bridge. Weigh bridge will be periodically gotcalibrated and verified from weight and measureauthorities.Forthepurposeofapplication oftackcoatifthetheoreticalareaaspersanctionedestimateforbasisoftondifferswith the actual area of workdone in the field. Then the reduction in or addition to payment shall have to be effected to the Contractor on pro-rata basis depending uponthe area reduced or exceededrespectively.Weight of mixed materials will be done in presence of a responsible person, not less than the rank of supervisor and the measurementsshall be recorded by the Engineer-in-charge, if so authorized. Record of each dumpers will be maintained separately in bound and numberedregister which will be maintained by the Client's representative and signed by the Contractor. Proper gate pass system shall be established forthe vehicles coming to the plant site and out going from the plant site. The location of the kilometer, hectometer and meter in whichindividual dumpers are unloaded be recordedcarefully.Rate : The contract rate for unit of one M.Ton of carpet shall be paid in full for carrying out the required operations including fullcompensation for allcomponents.
15.14 Providing and laying 20 mm. thick consolidated seal coat over carpet by heating and mixingasphaltandaggregatewith continuous batching hot mix plant, spreading the same by paver finisher machine using B.T. Chips (stoneaggregates) 12 mm. to 20 mm. size and sand in required proportion at a rate of 4 m3/100 m² of surface as perrequired gradation and asphalt 60/70 or 80/100 at a ate of 72 kg/m3 of aggregates but not less than 4.50 % byweight of mix and flushing the sand at rate of 0.03 m3/10 m² including scraping, brooming, transporting, spreadingand consolidating with power roller of 8 to 10 ton so that the resulting surface is even, smooth and in perfect lineand level to the satisfaction of Engineer-in-charge with all required tools, plant, machinery, labours, oil, kerosene,firewood etc. complete asdirected.
1.0 Description : The relevant specification of item no. 15.13 shall be followed same except that the work shall be for 12 mm.thick seal coat instead of 25 mm.thick carpet.Materials:Fine aggregate : The fine aggregates shall consist of crusher run screening and natural sand or a mixture of both. These shall be clean,hard durable, uncoated, dry and free from injurious, soft of flaky pieces and organic or deleterioussubstances.Aggregate gradation : The mineral aggregates, shall be so graded or combined as to confirm to the grading set forth in table below:Aggregates gradation for premix seal coat:------------------------------------------------------------------------------------------SieveDesignation Percentage passing byweight------------------------------------------------------------------------------------------12.5mm. -10.00mm. 1004.75mm. 40 -85
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
186
Title – General Development and Road Works Sheet 12 OF 45
Mode of Measurement and Payment:The payment shall be made on the tonnage basis of weight of mix of aggregates and bitumen. For this purpose the Contractor shallhave to install a weigh bridge of suitable capacity for the purpose of weighment of dumpers at suitable place at his own cost as directed.Weight of empty dumper and weight of loaded dumpers will be recorded in bound and numbered register on plantsite.The Client shall feel free to get some loaded dumpers test checked at other weigh bridge. Weigh bridge will be periodically got calibratedand verified from weight and measureauthorities.For the purpose of application of tack coat of the theoretical area as per sanctioned estimate for basis of ton differs with the actual area ofwork done in the field, then the reduction in or addition to payment shall have to be effected to the Contractor in pro-rata basis dependingupon the area reduced or exceededrespectively.Weight of mix material will be done in presence of responsible person, not less than the rank of supervisor of Department and themeasurements shall be recorded by the Engineer-in-charge, if so authorized. Record of each dumper will be maintained separately inbound and numbered register which will be the responsibility of Contractor. Proper gate pass system shall be established for the vehiclescoming to the plant site and out going from the plant site. The location of the kilometer/hectometer and meter in which individualdumpers are unloaded will be recorded carefully.Rate : The contract rate for unit of one M.Ton of seal coat shall be paid in full for carrying out the required operationsincluding full compensation for all components listed in Most Specification Clause503-B.
SPECIAL CONDITION FOR BITUMINOUS SURFACE WORK WITH USE OF HOTMIX PLANT AND PAVER FINISHER
1. The hot mix plant and accessories to be used for the work shall be in conformity with the specifications, prescribed videGovt. of India, Ministry of Transport Circular No. RW/RMP/1613784, dt. 1.1.87. The plant shall be equipped with all unitsand accessories as per latest I.S 3066/1955, as amended from time to time. The Contractors will have tomodifytheirplantssuitablywithinaperiodofsixmonthsfromthedateofissueoflatestI.S.specificationorcodes.2. The work of laying aggregate mixed with bitumen shall start on site of work only after 8.00 hours in the morning andcontinue upto 17.00 hours in winter season and upto 18.30 hours in summer. No work shall be done except during theperiodmentionedaboveandalsoonSundayandNationalHolidaysviz.26thJanuary,15thAugustand2ndOctober.3. Quantity of bituminous aggregate mix to be laid shall be restricted to 250 ton per dayfor 30/40 capacity plant and maybemoreorlessdependingupontheratescapacityoftheplant.4. The work of laying asphalt mix shall start latest within 60 days from the date of issue of work order and will be completedas per time limit. Reasons for delay instating of work after 60 days shall result in to sufficient cause for laving compensationfor disproportionate progress. However, the period from 15th June to 15th October being monsoon shall not be counted forthe purpose of disproportionate progress and consequent cause for levy of compensation. The Contractors shall commencethe work of laying pavement on or before the last date of the period mentioned above, failing which he shall paycompensation not less than Rs. 500/- per day for every day that he shalldelaythecommencementoftheworkasaboveinaccordancewithclause-2ofthecontract.5. The Contractor shall invariably get the job mix formula for the mix approved by the Engineer-in-charge before startingthework15.15 Providing and applying asphalt painting over the road surface by heating asphalt 60/70 or 80/100 at
350Fandspreading the same at the rate of 1.5 kg/m² including all labour for heating, brushing theroadsurface,
brooming, laying the asphalt at uniform rate so as to have smooth finish surface and spreading sand over it at therate of 0.5 m3/100 m² and rolling with 8 to 10 ton power driven roller as per direction of Engineer-in- chargeThe relevant specification of item no. 15.13 shall be followed same except that the work shall be for asphalt painting. Therate shall be for a unit of one m².15.16.aProviding and laying cast in situ RCC (1:2:4) curbing up to 400 mm height, including necessary excavation,cutting the road, laying PCC 1:5:10 (1 part cement: 5 parts sand : 10 parts stone aggregate 20/37 mm. down size),210 mm. thick, shuttering, exposed rendering, curing and filling the joints with cement mortar (1:1) but excludingreinforcement as directed etc. complete as per the details and drawings.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
187
Title – General Development and Road Works Sheet 13 OF 45
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
188
1.0 Material: (1) Water shall conform to M-1. (2) Cement shall conform to M-3. (3) Sand shall conform to M-6. (4)Stoneaggregate shall conform toM-12.Workmanship :The pits of the size 0.15 M in width and 0.23 M. in depth shall first be excavated, true to line and level. The relevant specifications ofitem 1.01 shall be followed for excavationwork.The pits shall be filled with a layer of 0.10 M. thick lean concrete 1:5:10 (1 cement: 5 Sand :10 20/37 mm. down graded stone aggregates). The curbs then shall be cast of overall size of 0.10 M. width and 0.4 M. depth of which0.23M. shall be below road level in cement concrete (1:2:4) in true line and plumb. The relevant specifications of item no.2.08.b & c shall be followed for cast in situ curbs having exposed rendering. The concrete curb shall be cured for 7 days.Mode of Measurement &Payment:The work shall be measured for the finished work, in running meter. The items of excavation and1:5:10 C.C and1:2:4R.C.C shall be measured according to relevant items and the detailed specifications for the same.Therateshallincludethecostofalllabourandactivitiesinvolvedintheoperationsdescribedabove.The rate shall be for a unit of one running meter. Excavation, C.C 1:5:10 and R.C.C 1:2:4 shall be paid under this item only.
15.16.b Providing and laying Precast RCC (1:1.5:3) curbing of 150mm X 450m high, including necessary excavation, cutting theroad, laying PCC 1:4:8 (1 part cement : 4 parts sand : 8 parts stone aggregate 20/37 mm. down size), 150 mm.thick, shuttering, exposed rendering, curing and filling bituminous mastic in expansion jointsbutexcludingreinforcementasdirectedetc.completeasperthedetailsanddrawings.The relevant specifications of item no. 15.16.a shall be followed except that precast curbs shall be used instead of cast-in-situ. The relevant specifications of item no. 2.19 shall be followed for precasted curbs.
15.17 Supplying,layingandspreadingroundedpeagravel(orCholia)asspecifiedanddirectedbytheArchitect, overpathways.
1.0 Material : Pea gravel shall from desired source and shall be hard, rounded and free from dust, grassetc.2.0 Workmanship : The pea gravel shall be spread uniformly at the specified volume per unit area, in the mannerasspecified by the Architect or Engineer-in-charge. The specified thickness of the spread shall be maintained. It shall not bespread over vertical and slopping faces and at drainmouths.3.0 ModeofMeasurementandPayment:Theworkshallbemeasuredonbasisofthecoveredarea.Therateshall include cost ofpreparation and treatment of corners, edges, openings and mortar screed, whereverspecified.The rate shall be for an unitof one m².15.18.a Providing and sowing good quality lawns, including excavation, filling in red murrum, yellow earth, manure and
maintaining for 1 year after sowing,complete.
Material and Workmanship:The sand shall conform to M-6. The relevant specifications of excavation and filling red murrum and yellow earth shallbeasperitemno.1.01,1.04and1.11.Firstofallthebaseshallbelevelledandmadegoodtoreceivesubsequentlayers.Thegoodqualityriversandshallbe spread evenly over thebase and levelled in desired manner. Over the river sand, red earth having very good fertilityshallbespreadandlevelledwell.Thetotalthicknessofsandandredearthshallbe100mm.Then rotted cattle manure shall be spread to a total thickness of 100 mm. over red earth. The manure shall be freefromanymatterwhichisharmfulorwhichhinderthegrowthofgrassatanystageinanymanner.
After that the inputs of 33 mm. depth and landscaping areas shall be mixed as directed and bust type of grass shallbespread. Wherevernecessary the lawn shall be kept green and clean condition by proper watering, weeding for a period of one month from the date of layingthe grass busts initially and for a period of one year after the initial one monthmaintenance.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
189
Title – General Development and Road Works Sheet 14 OF 45
2.00 Mode of Measurement and Payment : The rate shall include all labours, materials, excavation, loading andunloading, transportation, to saw the grass busts, to maintain it in good green and clean condition for a period of one yearfrom the date of laying etc. complete. The rate shall be for an unit of onem².15.18.b Supplying and planting of shrubbery/Hedge of specified variety including development of bed, removal and refilling of
top soil for fixing the shrubbery/hedge, application of FYM (2.50M3 in 100 M2), termite treatment and average 5-6plants in 1 M2. Soil mount of 4” to 6” in size (water retaining basin) should be made neatly around each plantationand maintained area. Maximum 5% mortality shall be tolerated. Work shall be done as shown inthedrawingorasdirectedandapprovedbyEIC.
a. Shrubbery/Hedgetobeplantedonthesoilalreadydressedorcontouredasrequired.b. Spreading of good quality stone free garden soil, evenly as directed byEIC.c. After spreading the good quality soil, the area shall be watered, rolled with a roller (500-600 kg weight) and graded properly.Roller to be made available by theLandscape Contractor.d. Spreading and mixing of good quality F. Y. M (Farm Yard Manure) The quantity to be used shall be 2.50 M3 in 100 M2 all overthe Shrubbery/Hedge area. The manure to be mixed properly and watered. Areas to be rolled and leveled as per drawing.e. The landscape Contractor to continuously do the weeding operation to have the Shrubbery/Hedge planting area free fromweeds no planting of Shrubbery/Hedge grass cuttings shall beallowed.f. The Landscape Contractor shall supply cuttings of good quality Shrubbery/Hedge as specified. The sample to be approved byEIC; before planting work starts. Area from where the grass cuttings are to be obtained shall be informed and approved byEIC.g. Planting shall be done at minimum 8 cm c/c and 3-4 cuttings of 80/90 mms length shall be planted. The cuttings shall be firmlyembedded in theground.h. After planting, the area is to be watered with sprinklers. All planting operation must be completed within a period of 7 daysfromthedayoftheplantingoperationsstartsatsite.i. Development Operation; The Landscape Contract shall maintain the planted Shrubbery/Hedge areas for a minimum period of12 months from the date of planting or till the Shrubbery/Hedge is properly established whichever is later and as determinedby theEIC.The Landscape Contract shall do the following operations regularly.I watering, weeding, rolling and Shrubbery/Hedge mowing, applying fertilizers, weedicides, etc., as and whenneededii. First three cuttings shall be done with a garden shears. After three cuttings, the Landscape Contractor shall do the cuttings witha Shrubbery/Hedge mower.iii. AllrunnersmustberegularlyandcontinuouslyremovedtohaveaproperShrubbery/Hedgegrowth.iv. Rollingand mowing shallbedoneatleastonceevery5days. Rollingand mowing shallbedoneinsamedirectiononly.v. The finished Shrubbery/Hedge must be even level without patches etc., the Shrubbery/Hedge grass growth must be eveneverywhere. The finished Shrubbery/Hedge must be absolutely weededfree.vi. Before handing over the Shrubbery/Hedge, the Landscape Contractor shall do the top-dressing with equal part of goodqualitysoilscreenedF.Y.MMaterialstobesuppliedbytheLandscapeContractor.
Mode of measurement:The area shall be measured in m2 of the actual area planted.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
190
Title – General Development and Road Works Sheet 15 OF 45
15.19 ProvidingandlayingC.C.1:4:8(1cement:4coarsesand:8gradedstoneaggregate40mm.nominalsize) and curing etc.complete, including cost of formwork for roads and generaldevelopmentRelevant specifications of item no. 2.01 of civil section - 2.00 shall be followed. The concrete shall be measured for itslength, breadth and depth, limiting the dimensions to those specified on plans or as directed. The rate shall be for an unitof one m3.
15.20.a Cement concrete pavement 50 mm. thick with 1:2:4 (1 cement : 2 coarse sand : 4 aggregate 20 mm. nominalsize)includinggivingbroomfinishwithafloatingcoatof1:1cementmortar,withIRCfabricetc.complete.
1.0 Materials and workmanship : The relevant specifications of item no. 9.14.a shall be followed except thatthethicknessofconcreteflooringshallbe50mm.andthetoppingshallberenderedgivingabroomfinishwithIRCfabric.Mode of Measurements and payment:The relevant specifications of item no. 9.14.a shall be followed except that thickness shall be measured correct upto 1 mm. Flooringlaid in borders, margins and treads of steps, shall be measured under item or flooring in respective ofwidth.Therateshallbeforaunitofonem3.
15.20.b Cement concrete pavement 50 mm. thick with 1:2:4 (1 cement : 2 coarse sand : 4 aggregate 20 mm. nominalsize)includinggivingflutedfinishwithafloatingcoatof1:1cementmortar,withIRCfabricetc.complete.
1.0 Materials and workmanship : The relevant specifications of item no. 9.14.a shall be followed except thatthethicknessofconcreteflooringshallbe50mm.andthetoppingshallberenderedgivingaflutedfinishwithIRCfabric.Mode of Measurements and payment:The relevant specifications of item no. 9.14.a shall be followed except thatthickness shall be measured correct upto 1 mm. Flooring laid in borders, margins and treads of steps, shall be measuredunder item or flooring in respective of width.Therateshallbeforaunitofonem3.
15.21 Providingandlayingcementconcretebroomfinish/smoothfinishpavementforplinthprotection/CCRoad 100 –150mm. thick with M25 concrete-Min Cement content 350 kg/cum including giving a floating coat of 1:1 cementmortar, with nominal temperature steel, tie bar, dowel bar as per MORTH specifications of section -6 & / orsteel fibres / PP fibres etc. complete.as specified by the Engineer-in-charge. The rate shall be exclusive ofreinforcement steel, dowel bar and steel / PP fibres (if required). The same shall be paid in relevant tenderitems. Rate shall be inclusive of concrete (to be laid in alternate panels size shall be apprx 3.5mt X 5.0mt ) withfair finished steel channel formwork, saw cutting of construction &contraction joints in width 3 to 5 mm x 1/4 to1/3 thickness of pavement, filling the 25mm x 20 mm (BXD) expansion joint approximately at every 30 mt withreadymix bituminous filler of Shalimar tar products or equivalent as per sample approved &directedbyengineerinchargeetccomplete.ScreenedSandtobeonlyused.
1.0 Material, Workmanship & Mode of Measurement: The relevant specifications of item no. 2.10 of civil section -2.00shall be followed except M25 to be instead of M30. The rate shall be for an unit of one m3. Apart from item no. 2.10ofcivilsection2.0therateshallincludethecostofsawcuttingjointsandbituminousfiller.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
191
Title – List of Materials & Approved Makes-Plumbing Sheet 1 OF 4
LIST OF MATERIALS FOR PLUMBING WORKS
M.P1 GI Pipes and FittingsM.P2 Bib-tap, Stop-Cock and angular stop-cockM.P3 CP Brass Pillar-tapM.P4 Vitreous Chinaware BasinM.P5 European Type Water ClosetM.P6 Orissa Type Water ClosetM.P7 Indian Type Water ClosetM.P8 FootrestsM.P9 SS SinkM.P10 Vitreous Chinaware UrinalM.P11 Low Level Vitreous Chinaware CisternM.P12 Cast Iron Flushing CisternM.P12-A ABS Plastic Flushing CisternM.P13 Flush-CockM.P14 CI Pipes and FittingsM.P15 `P' Trap or Nahni TrapM.P16 Gully –TrapM.P17 Salt Glaze Stoneware Pipe and FittingM.P18 Wall Peg RailM.P19 GI Water SpoutM.P20 Asbestos Cement Pipe (AC Pipe)M.P21 Cydron Ball ValveM.P22 Bitumen Felt for Water Proofing and Damp ProofingM.P23 Brackets and clampsM.P24 UnionsM.P25 FlangesM.P26 Gun Metal Gate/Wheel/Non Return (swing type) ValvesM.P27 CP Brass bottle TrapM.P28 uPVC Pipes and fittingsM.P29 HDPE Pipes and fittingsM.P30 Asbestos Septic TankM.P31 Cast Iron and Spun-Cast Iron pipes and fittings – water supplyM.P32 Cast Iron Manhole covers and framesM.P33 Anti-Corrosive PaintsM.P34 Co Extruded Polyethylene Composite Pressure Pipe and Approved Brass Fittings.M.P35 Expanded Polystyrene or Framed Styroper Slabs
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
192
Title – List of Materials & Approved Makes-Plumbing Sheet 2 OF 4
LIST OF APPROVED MAKES OF PLUMBING MATERIALS
1) SANITARY WARES 1) HINDUSTAN, CERA,PARRYWARE2) CP FIXTURESANDACCESSORIES 1) JAQUAR,ESCO.3) FLUSHINGTANK 1) COMMANDER,HINDUSTAN4) FLUSH-VALVE 1)JAQUAR5) GIPIPES 1) TATA - CLASS C, CLASSB6) GI FITTINGS&SPECIALS 1) RBRAND-ISI
2) DRP7) VALVE WITH GUNMETALCONSTRUCTION 1) ZOLOTO
2) L & T AUDCO ISIMARKED3) LEADER ISIMARKED
8) PLASTICCONTROLVALVE 1)DPP2) PRINCE3) PRAYG
9) CI PIPES&FITTINGS 1)NECO2) BIC
10) uPVC PIPES & FITTINGS 1)SUPREME2) FINOLEX3) PRINCE
11) STONEWARE PIPES& FITTINGS 1) MAHAVIR, TAYA &UNIQUE OR BESTQUALITY AS APPROVED BY THE ARCHIT ECTOREIC12) SSSINK 1) NIRALI,AMC13) ELECTRONICS WATERLEVELCONTROL 1)GELCO
2) SAFFLE14) PUMPSET 1)KSB
2) KIRLOSKER3) WASP4) CROMPTON
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
193
Title – List of Materials & Approved Makes-Plumbing Sheet 3 OF 4
(C) WITHFLANGEDJOINTS 1)IISCO2) BHADRAVATI3) BARODA ROLLING MILLS(BRM)4) PREMIER5) ELECTRO STEELCASTING
(D) WITH SCREWED ONFLANGEDJOINTS 1) BARODA ROLLINGMILLS2) GENERAL TUBES(HAWA)
17) CILA-CLASSSPECIALS 1)ISSCO2) KESORAM3) BHADRAVATI4) BARODA ROLLINGMILLS
18) TYTON TYPES SPECIALSFORRUBBER 1)IISCOGASKETJOINTS 2) MSTRADERS3) NATIONAL CASTING19) CISLUICEVALVES 1) INDIAN VALVECO.
2) KIRLOSKAR3) CRESCENT4) UPADYAYA
20) CI REFLUX VALVES SWING TYPE(NON-RETURN VALVESWITH/WITHOUTBYPASS) 1) INDIAN VALVECO.2) KIRLOSKAR3) CRESCENT4) NECET TRADINGCO.5) NORMEX
21) SINGLE/DOUBLEAIRVALVES 1) INDIAN VALVECO.2) KIRLOSKAR3) PERFECTENGG.4) ASSOCIATES5) NECET TRADINGCO.6) A.J.TRADERS7) S.C.TRIVEDI8) SHAILESH KUMAR & CO.9) GENERAL TUBE CO.(HAWA)
22) FIBRE REINFORCED PRECAST RCCMANHOLE 1) PRATIBHA INDUSTRIESCOVER AND FRAMEFORCHAMBERS 2) K.K.CO.3) ALCOCK23) CI / DI MANHOLE COVER, FRAMEANDGRATING 1)NECO
2) BIC24) FLOAT/EQUILIBRIUM VALVES 1)HAWAWITHCOPPERFLOATS 2)GLENFIELD25) POLYETHYLENE COMPOSITEPRESSUREPIPE 1)KITEC
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
194
Title – List of Materials & Approved Makes-Plumbing Sheet 4 OF 4
31) HOTPIPEINSULATION 1)ARMACEL2) CHAMPION & CHARMINARNOTE: ALL MATERIALS SHALL CONFORM TO THE RELEVANT STANDARDS OR CODEOFBUREAU OF
INDIAN STANDARDS AND SHALL HAVE ISI MARK VALIDATED FOR THE PERIOD OF INSTALLATIONAND TAKE OVER. THEY SHALL ALSO FULFIL ALL HYDRAULIC TESTS AT SITE AND SHALL BE FREEFROM ALL NOTICEABLE DEFICIENCIES DURING THE GUARANTEE PERIOD AS WELL.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
195
Title – Material Specifications for Plumbing Works Sheet 1 OF 8
SPECIFICATIONS OF MATERIALS - PLUMBING
M-P1 GI Pipes andFittings:GI pipe shall be of the required diameter and class conforming to IS:1239. The specified diameter of the pipes shall refer tothe inside diameter of the bore. GI fittings shall be of the standard `R' or equivalent make and clamp and screws shall be asper specifications.M-P2 Bib-Tap, Stop-cock and AngularStop-Cock:A bib-cock is a draw off tap with a horizontal inlet and free outlet. A stopcock is a valve with a suitable means ofconnectionforinsertioninapipelineforcontrollingtheflow.AllcocksshallbeofCPbrassconstruction,ofheavyduty,firstqualityandofapprovedmakeoritsequivalent.They shall be of the first quality, screw down type and CP brass, polished bright conforming to IS:781. The diameter shall beas specified in the description of the item.The minimum finished weight in kg of a tap/cock shall be as under:----------------------------------------------------------------------------------------------------------------------------- -
Diameter Bib Stop Diameter Bib StopInmm tap cock inmm tap cock------------------------------------------------------------------------------------------------------------------------------ 80.25 0.25 15 0.40 0.4010 0.30 0.35 20 0.75 0.75------------------------------------------------------------------------------------------------------------------------------
M-P3 CP BrassPillar-Tap:The capstan head of a specified dia of CP brass construction shall be of the first quality of approved make conforming toIS:1795.M-P4 Vitreous ChinawareBasin:Wash basin shall be of the first quality white/coloured porcelain conforming to IS:2556 (Part-IV) and IS:771.The size of the washbasin shall be as specified. The washbasin shall be of one piece construction with a continued over-flowarrangement. All internal angles shall be designed so as to facilitate cleaning. It shall have a single tap hole or two holes, asspecified. Each basin shall have a circular waste hole which is either riveted or bevelled internally with 65 mm diameter attop and 10 mm depth, to suit the waste fitting. The necessary stud slot to receive the bracket on the under side of the basinshall be provided. The basin shall have a recessed internal soap holder which shall fully drain into the bowl. The washbasinshall be provided with a CP brass chain and rubber plug.White/coloured glazed Pedestal of the quality and colour as that of the basin, shall be provided where specified in the item.It shall be completely recessed at the back for reception of supply and wash pipe. It shall be capable of supporting the basinrigidly and adequately and shall be so designed as to make the height from the floor to the top of the rim of basin, 750 mmto 800 mm, as directed.M-P5 European Type Water Closet(EWC):The EWC shall be white/coloured glazed porcelain, first quality floor mounted, wall mounted or double siphon coupledcloset, of wash down type, conforming to IS:2556 and IS:771. The size and type shall be as specified in the item.
`P' or `S' trap shall be provided as required with a water seal not less than 50 mm.The solid plastic seat and cover shall be of the first quality, black, white or coloured, conforming to IS:2548. It shall be madeof moulded synthetic materials which shall be tough and hard with high resistance to solvents and shall be free from blistersand other surface defects and provided with chromium plated brass hinges and rubber buffer of suitable size.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
196
Title – Material Specifications for Plumbing Works Sheet 2 OF 8
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
197
M-P7 Indian Type WaterClosetThe Indian type white or coloured glazed WC of the first quality shall be of size specified in the itemand conforming to IS:771 and IS:2556 (Part-II). Each pan shall have integral flushing ring of suitable type with adequate number of holesaround to have satisfactory flushing. It shall also have an inlet at the front for connecting flush pipe, as directed. Theinsideofthebottomofthepanshallhavesufficientslopefromthefronttowardstheoutletandsurfaceshallbeuniform and smooth. The pan shall beprovided with 100 mm dia `P' or `S' trap with approximately 50 mm water seal and with or without 50 mm dia venthorn.M-P8 Footrests:A pair of white glazed porcelain rectangular foot rests of minimum size 250 mm x 130 mm x 20 mm shall be providedwith water closet.M-P9 Stainless SteelSink:TheSSsinkshallbeofaspecifiedsizeandqualityofapprovedmakeorequivalent certifiedbytheconsultants.ItshallbemadeoutofSalemStainlessSteelAISI30418/8.Itshallbepolishedinaneasycleanfinish.Thebracketsforsinks shall conform toIS:775.The sinkcomprises of 40 mm dia waste coupling with a rubber plug and a CP chain of approved quality of approved make or its equivalent as certifiedby the Consultants.M-P10 Vitreous ChinawareUrinal:The lipped type vitreous Urinal, either Large flat back, Small flat back or Angular, shall be asspecified in the item conforming to IS:771. It shall be of the first quality free from any defects.The urinals shall have fixing arrangement for15 mm dia spreader, 32 mm dia CP domicile waste and CP pipes with a wall flange. The urinal shall be fixed to the wall by one CI bracket andtwo CI wall clips, as approved by the manufacture complete as directed.
11 Low Level Vitreous Chinaware FlushingCistern:The low level vitreous chinaware flushing cistern shall be of 10 to 12.5 litres capacity and of 5 to 6.5 litres capacityconforming to relevant IS code. The flushing cistern shall:a) beofthefirstqualityfreefromanydefects,b) haveanoutletdiaof32mmtobeconnectedwithaWCpanwithapipe,c) be provided with an inlet and an outlet for fixing an incoming and an over flowingpipes,d) be provided with a CP handle forflushing,e) beprovidedwithaCIbracket(conformingtoIS:775)forwallmountingatthespecifiedheight,andf) consist of the main body, a lid, a ceramic siphon andvalve less fittings.
M-P12 Cast Iron FlushingCistern:The CI flushing cistern of 15 litre capacity shall conform to IS:774. The flushing cistern shall be of thefirst quality and free from any defects and have an outlet of 32 mm diameter. The outlet shall be connected to a lead pipe of 32 mm diameter.The lead pipe shall conform to IS:404 (Part-I). For fixing inlet pipe and overflow pipe, a 20 mm dia inlet and outlet shall be provided. Theflushing cistern shall be provided with a GI chain allowing a movement of the lever to a sufficient length. The CI flushing cistern shall be paintedwith one coat of anticorrosive paint and two coats of paint. The flushing cistern shall be fixed on two CI brackets conforming to IS:775.M-P12A ABS Plastic FlushingCistern:Raw material of cistern body shall be of virgin polypropylene with critical and functional partsmoulded from Engineering grade ABS, Acetyl, Nylon and Nylon glass. The float shall work on clock valve mechanism with concealed air pocketto give upward thrust of 75 gm by Archimedes principle. Derlin valve made from an Acetyl compound shall withstand an inlet pressure upto 20kg/cm2. Main rubber valve shall be of parabolic design on ball and socket joint for better seal. Valve seat shall be of Engineering grade ABSplastic for long scratch free life. Cistern shall be of 10 litre capacity and flow can be adjusted from 7 to 10 litres. It shall conform to IS 7231.
M-P13 FlushCock: Heavy type half-turn flush-cock conforming to relevant IS code shall be chromium plated gun metalhaving diameter specified in the description of the item. The flush-cock shall be concealed type or exposed.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
198
Title – Material Specifications for Plumbing Works Sheet 3 OF 8
M-P14 Cast Iron Pipes andFittings:All soil, waste, vent and anti-siphon pipes and fittings shall conform to IS:1729 for sand cast pipe. All spun soil pipe shallconform to IS:3989. All rain water pipe shall conform to IS:1230. The pipe shall have a spigot and socket end. The pipesand fittings shall be true to shape, smooth, cylindrical and their inner and outer surfaces being as nearly as practicablyconcentric. They shall be sound and nicely cast, shall be free from cracks, laps, pinholes or other imperfection, neatlydressed and carefully fitted.The end of pipes and fittings shall be reasonably at right angle to their axis.The sand cast iron pipes shall be of the diameter specified in the description and shall be in lengths of 1.5 m, 1.8 m, and2.0 m including socket ends of the pipe, unless shorter lengths are either specified or required at junctions. The pipes andfittings shall be supplied without ears unless specified.The spun cast iron pipes of the diameter specified in the description shall be in lengths of 3.0 m and 2.5 m including
socket ends of pipe, unless shorter lengths are specified or required at the junctions.
Tolerances:The Standard weights and thickness of pipes shall be as shown in the following table. A tolerance upto -10% however,shall beallowed.----------------------------------------------------------------------------------------------------------------------------- ---------Sr. NBdia Thickness Overall Weight in kg of Pipe excludingearsinmm inmm 1.5mlong 1.8mlong 2 mlong--------------------------------------------------------------------------------------------------------------------------------------1. 75 5.0 12.83 16.52 18.372. 100 5.0 18.14 21.67 24.153. 150 5.0 31.91 - ------------------------------------------------------------------------------------------------------------------------------ ---------A tolerance upto 15% in thickness and 20 mm in length shall be allowed. For fittings tolerance in lengths shall be +25 mmand -10 mm.The thickness of fittings and their socket and spigot dimensions shall conform to the specifications for thecorresponding sizes of straight pipes. The tolerances in weights and thickness shall be the same as for straight pipes.M-P15 `P' Trap or NahniTrap:The ‘P’ trap shall be of CI and free from porosity or other defects which affect serviceability. The thickness of the basemetal shall not be less than 6.5 mm. The surface shall be smooth and free from cracks, chips and other flaws or any otherkind of defects which affect serviceability. The size of ‘P’ trap shall be as specified with self-cleansing design.The Nahni trapshall be of quality approved by the Consultants conforming to the relevant IS code.The Nahni trap shall be with a deepseal of minimum 50 mm. Places where the trap with a deep seal can not be accommodated, the same with a shallow sealshall be used with a prior permission of the Consultants. The cover shall be of CI or SS grating with a perforated cover ofappropriate size.M-P16 GullyTrap:The Gully trap shall conform to IS:651 and be free from defects. The glaze of the traps shall be free from crazing.Theyshallgiveasharpcleartonewhenstruckwithlighthammer.Thereshallbenobrokenblisters.The size of the gully trap shall be as specifiedin the item.Each Gully trap shall have a square CI grating of proper dimensions at its inlet. It will also have a water tight cover with a frameof inside dimensions 300 mm x 300 mm. If the cover is of CI, the weight shall not be less than 4.53 kg and of the frame not less than 2.72kg. The grating cover and frame shall be sound and truly square with machined seating faces.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
199
Title – Material Specifications for Plumbing Works Sheet 4 OF 8
M-P17 Salt Glaze Stoneware Pipe andFitting:The pipes and fittings shall be of the first quality manufactured from fire clay, thoroughly salt glazed, burnt through thewhole thickness, of a close even texture, free from air blows, fire blisters, crack and other imperfections which effect theserviceability. The inner and outer surfaces shall be smooth and perfectly glazed. The pipe shall be capable ofwithstanding pressure of 1.5 m head without showing sign of leakage. The thickness of the wall shall not be less than1/12th of the internal dia. The depth of socket shall not be less than 38 mm. The inside of the socket shall besufficientlylargetoallowajointof6mmaroundthepipe.The pipes shall generally conform to a relevant IS:651.M-P18 Wall PegRail:The aluminium wall peg-rail shall have three aluminium pegs of approved quality and size. It shall be fixed onteakwoodplankofsize450mmx75mmx20mm.TheteakwoodshallbeFrench-polishedoroilpainted,asspecified.M-P19 GI WaterSpout:The GI pipes of specified dia shall be of medium quality and specials shall be of `R' brand orequivalent.The pipe shall have length, as required for the thickness of wall in which it is fixed and at the outside end a tee and a bendcut at half the length shall be provided. At the other end a coupling shall be provided to have better fixing. water spout shall be providedas per detailed drawing or as specified.M-P20 Asbestos Cement Pipe (A.C.Pipe):The asbestos cement pipe specified in the description of the item shall conform to IS:1626. Specials like bends, shoes,cowls, etc., shall conform to the relevant IS code. The interior of the pipe shall have a smooth finish, regular surfaceand regular internal diameter. The tolerance in all dimensions shall be as per IS:1626-Part-I.M-P21 Crydon BallValve:Ball valve of screwed type including polyethylene float and necessary lever etc., shall be of the size mentioned in thedescription of item and conform to IS:1703.M-P22 Bitumen-Felt for Water-Proofing andDamp-Proofing:Bitumen felt shall be of type 2 with -self finished felt grade-2 conforming to IS:1322.M-P23 Brackets/Clamps:Pipes in shafts and other locations shall be supported by Aluminium, CI or MS hot dip galvanised brackets/clamps of chilly make ofapproved design. Pipe in wall chases shall be anchored by iron hooks and at ceiling level shall be supported on structuralbrackets/clamps chilly make, fabricated from MS or Aluminium flat bar of 5 mm thickness as per drawing and detail. However, onlywhen specified, slotted angles shall be used. The 6 to 8 mm dia GI rod clamps required shape and size to fit well on the pipe whentightened with nut-bolt and washer on the brackets/clamps. Clamp shall also be formed out of 2 semi-circular pieces hinged with 6 mmdia MS pin on the side and provided with flanged ends on the other side with holes to fit in the screw bolt and nut of 40 mm length. Theclamps shall be provided with a hook made out of 275 mm long 10 mm dia MS bar riveted to the ring at the centre of 1 semi-circularpiece. The brackets or clamps shall be fixed to the walls keeping 50 mm clear off the finished face of the wall to facilitate cleaning andpainting of the pipes.M-P24 Unions:Contractor shall provide adequate number of unions on all pipes to enable dismantling later. Unions shall beprovided near each gun metal valve, stop-cocks or check-valves and on straight runs, as necessary, at appropriate locations.M-P25 Flanges:Flanged connections shall be provided on pipes running through shafts as shown on the drawings and at allequipment connections. Connections shall be made by the correct number and a 3 mm thick gasket. Where hot water or steamconnections are made, insertion gasket shall be suitable for high temperature grade and quality, approved by the consultant. Bolt hole diafor flanges shall conform to those of CI sluice valves.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
200
Title – Material Specifications for Plumbing Works Sheet 5 OF 8
M-P26 Gun Metal Gate/Wheel/Non-Return Valve (swingtype)ISI MARKED valves of required size shall be of heavy gunmetal fullway type or Globe valves conforming to IS:778 tested at 20 kg/cm2. Valves above 65 mm dia shall be flanged mount testedat the manufacturer's works and their name stamped on it.M-P27 CP Brass BottleTrap:The bottle trap shall be as per the specified dia and of the first quality. The bottle-trap shall beprovided with a CP brass extension piece to the wall flange on one hand and on the other with a rubber adopter for wasteconnection.M-P28 UPVC Pipes andFittings:They shall be of the first quality of approved make or equivalent conforming to IS:4985 and:7834 in all respects. uPVC Pressure pipes and fittings, uPVC SWR Drainage system, uPVC Threaded plumbing system and uPVC casingpipes shall be used as per the dia and relevant specification specified under items.They shall be extremely light in weight and shall havea minimum wall thickness of 3.2 mm They shall be injection moulded from selected raw materials having a working pressure-rating of4, 6,10 and 15 kg/cm2. Pipe dia of 20 to 400 mm shall be available in working pressure as specified above. uPVC SWR drainage systemare exclusively suitable for soil, waste, rain-water drainage. The pipes and fittings shall be resilient and shall have good impact strength.uPVC shall be resistant to oils, fats, alcohols and aromatic free petrol but shall be unsuitable for use with aromatic and chlorinatedhydrocarbons, ketones, esters andethers.PVC pipes and fittings shall remain stable upto 60OC PVC with a thermal co-efficient of 0.00007mm/m/OC. Therefore, due to thermal expansion, a gap of 10 mm from the surface is approved during laying of the pipes and fittings.They shall be fixed to the walls/surfaces with the help of PVC clips. Further, they can be connected to the conventional AC, GI or CI pipeswith the help of special adapters. The jointing shall be done with special care and as specified by manufacturer. Further, all fittings shallhave their ends chamfered at 15O.uPVC Pipes and Fittings:All uPVC pipes and fittings shall conform to IS:4985.They shall be lightweight, resilient, strong, seamless, resistant to chemicals, electrolytic and galvanic corrosion, odourless, and of hygienic- and self-extinguishing quality. The thermal expansion shall be 0.0004 Cal./Hr. cm2/OC/cm. The coefficient of linear expansion shall be 0.00005-0.00006 mm/m/OC. uPVC pipes and fittings shall be available in dia varying from 20 to 400 mm with a working pressures varying from2.5 to 15 kg/cm2.M-P29 High Density Polyethylene (HDPE) Pipes andFittings:All pipes and fittings shall conform to IS:4984 and shall befrom reputed manufactures like PIL or EIL approved.The pipes shall be capable of withstanding a working pressure of 2 kg/cm2 to10 kg/cm2 at 50OC. All the fittings and bends shall be factory made moulded or manufactured from the same material as the pipes.M-P30 Asbestos SepticTank:It shall be from Everest or equivalent, as approved by the Consultants. It shall be of required size asshown in detailed drawing or as specified in the item. It shall be of single piece in width and length but if required to match the specifiedsize in depth, not more than four compartments shall be allowed (which includes top and bottom pieces and extension pieces). It shall bemade from the finest raw materials.It shall be free from any joints in side walls, bottom piece, top cover and baffle walls and be of twocompartments separated by a baffle wall in a horizontal section. No leakage should be there from joints between pieces depth-wise. Theside walls shall be capable of withstanding the earth pressure and the top cover shall be designed to carry the traffic load and surfacecovering load.It shall be air tight and designed to disintegrate the sewage by putrefaction. It shall contain two inlets (one for regularconnection and other for alternative connection) and one outlet. The inlet shall be of 100 mm dia and the outlet shall be of 75 mm dia.All such connection shall be leak-proof. Rejected materials shall not be used.M-P31 CI and Spun Cast pipes and Fittings: watersupply
Pipes and Specials:- The cast iron pipes shall confirm to IS 1537 while spun cast pipes shall confirm to IS:1536. Thepipes shall be either with spigot and socket ends or flanged ends. The cast iron pipes shall be vertically either class Aor Class B as specified. The spun iron pipes shall be of class A, Class B as specified in the item. These pipe and specialshall be used for water pressure upto half of the hydraulic test pressure of various pipes as given below:Hydraulic Test Pressure for vertically cast iron pipes:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
201
Title – Material Specifications for Plumbing Works Sheet 6 OF 8
----------------------------------------------------------------------------------------------------------------------------- ----NominalDiameter Test Pressure inkg/cm2Socket &spigotPipes FlangedpipesClass A Class B Class A ClassB----------------------------------------------------------------------------------------------------------------------------- -----upto and including300mm 20 25 20 25Over 300mm but upto600mm 20 25 15 20----------------------------------------------------------------------------------------------------------------------------- -----Hydraulic Test pressure for centrifugal spun cast Iron pipes:----------------------------------------------------------------------------------------------------------------------------- -----NominalDiameter Test Pressure inkg/cm2Socket & spigot pipes FlangedpipesClassLA A B A B----------------------------------------------------------------------------------------------------------------------------- -----upto and including300mm 20 25 30 20 25Over 300mm but upto600mm 20 25 30 - ------------------------------------------------------------------------------------------------------------------------------ -----Specials:The specials shall conform to IS 1538 and shall be of medium or heavy class depending on their thickness. The hydraulictest pressure of each class shall be as follows:----------------------------------------------------------------------------------------------------------------------------- -----Test pressure in kg/cmsq
Nominal Specialswith/withoutbranchesspecialswithbranchesDiameter Not greater than half themain dia. greater than half the maindia.-------------------------------------------------------------------------------------------------------Medium Heavy Medium Heavy----------------------------------------------------------------------------------------------------------------------------------upto and including300mm 20 25 20 25Over 300mm but upto600mm 20 25 15 20----------------------------------------------------------------------------------------------------------------------------- -----All CI pipes shall be capable of easily working a drill or file. Pipes and specials shall be sound with smooth inner andouter surface, nearly dressed and carefully fitted free from laps pinholes, and other imperfections and shall ring clearlywhen struck with a light hammer, the end of the pipes and the specials shall be reasonably square to their axis.All pipes and specials before they are affected by rust shall have been coated with an approved anti-corrosive treatmentor by heating and dipping in Dr. Agnus Smith's solution at the factory.
M-P32 CI Manhole covers andFrames:
CI Manhole covers and frames shall confirm IS:1726. The general requirements for material, manufacture &
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
202
Title – Material Specifications for Plumbing Works Sheet 7 OF 8
It shall be from STP Limited or equivalent, as approved by the Consultants.It shall be a high build bituminous emulsion, specially formulated for protection against corrosion. It shall form a 2 mmthickdryfilm which shallnotcrackatlowtemperaturesnorbecomecrookedathightemperatures.Itshallalsobeused aswaterproofing material on flat, sloped and steeped roofs. It shall be applied by brush and by heavy duty airless spraying.
M-P33B Tankmastic:
It shall be from STP Limited, conforming to IS:158 and IS:9862 or equivalent approved by the Consultants.This special bituminous paint shall have no harmful reaction on drinking water, be used to protect the inside of water tanksand pipe connections against corrosion, and be applicable on steel, wood, concrete, iron etc. It shall have a covering capacityof 12 m2/litre.
M-P33C Pipekote:It shall be from STP Limited or equivalent as approved by the Consultants. It shall conform to IS:158.Thisheavydutybituminouspaintshallnot impartanyodourortastetowater,carriedinthesteelwaterpipelines,tanks and pen-stocks. It shall be applied on the inside surface of the water pipeline, tanks and pen-stocks be resistant to mild acids, alkalisand withstand heat upto 150OC. It shall render a heavy body protective film. If zinc-rich, epoxy primer shall be used tobetter results ofpipekote.M-P33D Silvershield:It shall be from STP Limited or equivalent, as approved by the Consultants.
It shall be a bituminous aluminium-finish paint formulated for application over anti-corrosive paints. It shall have acovering capacity of 10 m2/liter.M-P33E ShalimasticHD:
It shall be from STP Limited or equivalent, as approved by the Consultants. It shall comply with the Standards of the USDept. of interior bureau of reclamation specification CA-50.It shall be a viscous, heavy-duty, anti-corrosive waterproof coal tar paint and offer resistance to acids and alkalis. Itshall be used for the protection of all types of iron and steel structures.
M-P34 Co-extruded Polyethylene Composite Pressure Pipe and Approved BrassFittings:
Co-extruded polyethylene composite pressure pipe shall conform to ASTM F:1282-95, specifications having weldedaluminium tube reinforcement between inner and outer polyethylene layers being bonded to aluminium tube by a meltadhesive with welded aluminium tube of itself being capable of sustaining internal pressures. It shall be from reputedmanufactures like KITEC or equivalent, as approved by the Consultants.
Nominal pipe sizeMmID:ODEquivalentNB sizeInch Total Wall Thickness mm
Minimum Maximum12:16 ½ 1.75 2.0016:20 ¾ 2.00 2.2520:25 1 2.45 2.7025:32 1 ¼ 2.80 3.20
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
203
Title – Material Specifications for Plumbing Works Sheet 8 OF 8
and colour, as indicated. They shall be of high density, suitable for insulating application like thermoplastic slabs.
1.01.a Providing and fixing galvanized iron (GI) mild steel tube (Medium grade Class B) of Tataorequivalentapproved make conforming to IS: 1239, including tube fittings of ‘R’ brand or equivalent make such assockets, unions, reducers, long or short bends, elbows, nipple, flanges, check-nuts, tees, etc., complete in proper line andlevel, including necessary supports viz., clamps, brackets, as specified, jointing with screw joints, using hold tight and jutefor pipes and Teflon tape for fittings and fixtures, open and/or conceal to wall, ceiling and floor including making themgood, testing and wrapping the pipes and fittings with Hessian cloth and painting with 2 coats of anti corrosive paint -(bituminous paint) and then wrapping the same with plastic etc., complete of the following nominal bore (NB)size:1) 150 mm 2)100mm 3)80mm 4)65mm 5) 50mm
6) 40 mm 7)32mm 8)25mm 9)20mm 10) 15mm.
1.0 Materials:Galvanized mild steel tubes of specified nominal bore shall conform to IS: 1239 and be as per plumbing materialspecification like Tata or equivalent approved makeGalvanized fittings (sockets, unions, reducers, long or short bends, elbows, nipple, flanges, check-nuts, tees, etc) requiredfor the specified bore of pipes shall be of R’ brand or equivalent make. Clamps, to fix the pipes to the brackets, shall befabricated from MS Hot dip GI flat of 35X5 mm of required size or of Chilly make (3mm minimumthickness)ascertifiedbytheEngineer-in-charge.Brackets,tokeepthepipes25to50mmclearoffthefinishedfaceof the walls,shall be fabricate from MS flat of 35 X 5mm of required size and shape, duly painted with anticorrosive paint and fixed tothe surface using suitable anchorbolts.Paint shall conform to relevant civil specification.
2.0 Workmanship:
Cutting, laying and jointing:When the tubes are to be cut or rethread, the end shall be carefully filed out so that no obstruction to bore is offered.The ends of the tubes shall then be threaded conforming to the requirements of IS: 554 with pipe dies and taps carefully,in such a manner as will not result in slackness of joints when the 2 pieces are screwed together.The tapes and dies shall be used only for straightening threads which have become bent or damaged and dies shall notbe used for turning of the threads so as to make them slack, as the later procedure may not result in a watertight joint.The threads for tube and fittings shall be protected from edge until they are fitted, properly and as directed.In jointing the tubes, the inside of the socket and the screwed end of the tube shall be oiled and smeared by using Teflontape round the screw end of the tube. The end shall then be tightly screwed into the socket, tees, etc., with a pipe wrench.Care shall be taken that all the pipes and fittings are properly tightened to render the joints completely leak proof. Whilefixing pipes shall be kept, at all times, free from dust and dirt. Burr joints shall be removed after screwing. On laying, theopen ends of the pipes shall be temporarily plugged to prevent access of surface water, soil or any other foreign matter.Any threads exposed after jointing shall be painted or in the case of underground/concealed piping, thickly coated withapproved anti-corrosive paint to preventcorrosion.Fixing of the tube and fittings to wall, ceiling and floors :The pipes and fittings shall be fixed in vertical alignment,unless otherwise specified and shall be secured to the walls using brackets and clamps as mentioned below.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
204
Title – ITEM SPECIFICATIONS –Water Supply Works Sheet 1 OF 6
The brackets, to be fixed to the surface using suitable anchor bolts, shall be fabricated from MS flat of 35 X 5mm of requiredsize and shape duly painted with anticorrosive paint of approved make. This shall facilitate the fixing of pipes about 25 to50mm mm clear off the finished face of the wall (as pre the drawing) so that cleaning and painting of the pipes becomeseasy. The brackets shall be spaced at regular intervals in straight length at 2 m. C/C interval in horizontal run and at 2.5 m.C/C interval in vertical runSubsequently, the clamps shall be fixed on the brackets which are made out of MS Hot dip GI or Aluminum flat, bent torequired shape and size so as to fit tightly on the pipe when tightened with nut, bolt and washer of non corrosive metal.Smaller tubes and fittings shall run on the surface of the wall or ceiling, unless otherwise specified. The fixing shall be doneby means of standard pattern holder clamps of chilly or equivalent as approved by EIC, keeping the pipes about at least 15mm clear off the wall.Whennecessarytoconcealthepipesorwhenspecifiedso,chasingmaybeadoptedorthepipemaybefixedinductsorrecesses,etc.Ordinarily,thepipeshallnotbeburiedin walls orsolidfloorsbutwhere unavoidable,itshallbeburied in one piecewithout any joint for short distances with adequate protection against damage. In that case the pipe shall be painted withanti-corrosive bitumastic paint of approved quality and/or covered with black Japan and plastic or jute cloth soaked in tar.The pipe should not come in contact with lime mortar or lime concrete as the pipe material is affected by lime. Under thefloors, the chases for the pipe shall be filled with sand An MS sleeve shall be fixed at the place where a pipe is passingthrough a wall or floor to provide for expansion, contraction and other such movements.. The pipes which are laid open shallbe painted with anti corrosive paint of approvedquality.All pipes and fittings shall be fixed truly vertical and horizontal, unless unavoidable.For pipes of 15 mm and 25 mm dia, the holes in the walls shall be made by drilling and not by dismantling the brick workand in the floors with chisel or jumper. However, for bigger diameter pipes, the holes shall be carefully made only to therequired size. After fixing the pipe the holes shall be made good with C.M. 1:3 (1 cement: 3 coarse sand) and properlyfinished to match the adjacent surface. All pipes shall be fixed in accordance with the layout and alignment shown on thedrawings. Care shall be taken to avoid air pockets.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
205
Title – ITEM SPECIFICATIONS –Water Supply Works Sheet 2 OF 6
Testing of joints:After laying and jointing, the pipes and fittings shall be inspected under working conditions of pressure and flow. Any joint orfitting, found leaking, shall be redone. And all pipes, which are leaking, shall be removed and replaced, without any extra cost.The pipes and fittings, shall be tested to a hydraulic pressure of 7 Kg/cm2. The pressure shall be maintained for 2hoursand the pressure drop at the end of the period shall not exceed 0.5 Kg/cm2. The pipe shall be slowly and carefully chargedwith water, allowing all air to escape and avoiding all shock and water hammer. The draw off taps and stopcocks shall then beclosed and subsequently the specified hydraulic pressure shall be applied gradually. The pressure gauge must be accurate andcalibrated from NABL approved lab. The pipes and fittings shall be tested in sections as the work of laying proceeds, keepingthe joints exposed for inspection during thetesting.AtestregistershallbemaintainedandallentriesshallbesignedanddatedbytheContractorandEngineer-in-charge. Inaddition to the sectional testing carried out during the construction, the Contractor shall test the entire installation afterconnections to the overhead tanks and/or pumping system or mains have been completed. He shall rectify leakage and replacedefective materials in the system. Any damage to the building, furniture and fixtures due to carelessness, open or burst pipesor failure of fittings, shall be made good during the defects liability period, without any extracost.Mode of Measurements andPayment:
a) The description of each item shall unless otherwise stated, shall be held to include wherever necessary, conveyance,delivery, handling, unloading, storing, fabricating, hoisting andexecution.b) The length shall be measured on RM basis of the finished work. The length shall be taken along the centre line ofthepipeandfittings.Thepipesfixedtowalls,ceiling,floors,etc.,shallbemeasuredandpaidunderthisitem.c) All the work shall be measured in decimal system as fixed in its place subject to tolerance given below, unlessotherwisestated:
(i) Dimension shall be measured to the nearest 0.01m.(ii) Area shall be worked out to the nearest 0.01m2.
d) All measurements of cutting shall unless otherwise stated, be held good to include the consequentwastage.e) Incaseoffittingofpipeofunequalbore,thelargestboreshallbemeasuredforthetest.f) Testing of pipe lines, fittings and joints include for providing all plant and appliances necessary for obtainingaccesstotheworktobetestedandcarryingoutthetests.g) The rate shall include the cost of GI steel tubing with screwed socket joints/flanged joints together with all fittings (suchas bends, sockets, elbows, tees, crosses, short pieces, clamps, reducer, nipples, checkouts and plugs, unions, etc.,) andfixing complete with clamping wall-hooks, anchor fasteners etc., and also for cutting, screwing, for making forged (orhand made) bends on piping as required. Connector shall be inserted, where required or directed.The rate shall include manual cutting through walls, floors etc. and their making good, painting of the exposed threadswith anti-corrosive paint, pressure testing, providing sleeves and sand filling under floors all as specified. The rate shallbe for all labour required for finishing to required shape and size, testing, fitting in position, straight cutting and wastereturn of packing.On prior approval of EIC (well before execution), making holes through RCC., masonry or any other surface using corecutting machine shall be paid extra, but the rate shall be inclusive of making the surface good after core cutting work isover.h) TherateshallbeforaunitofoneRM.1.01.b Providing and fixing galvanised iron (GI) mild steel tube (Medium grade Class C ) of Tataorequivalentapprovedmake conforming to IS: 1239, including tube fittings of R Brand such as sockets, unions,reducers, long or short bends, elbows, nipple, flanges, check-nuts, tees, etc., complete in proper line and level,including necessary supports viz., clamps, brackets, as specified, jointing with screw joints, using hold tight and jutefor pipes and Teflon tape for fittings and fixtures, open and/or conceal to wall, ceiling and floor including makingthem good, testing and wrapping the pipes and fittings with Hessian cloth and painting with 2 coats of approvedpaint - (bituminous paint) and then wrapping the same with plastic etc., complete of the following nominal bore(NB)size: be grade C instead of grade B.1) 150 mm 2)100mm 3)80mm 4)65mm 5) 50mm
6) 40 mm 7)32mm 8)25mm 9)20mm 10) 15mm.The relevant specification of item no. 1.01.a shall be followed except the grade of pipe shall
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
206
Title – ITEM SPECIFICATIONS –Water Supply Works Sheet 3 OF 6
1.03.c Providing and fixing insulation to all pipes embedded in walls with 6 mm thick asbestos rope ofchampionorequivalent on GI lines for hot water supply, etc., complete, as directed of the following nominal bore (NB) size:
1)150mm 2)100mm 3)80mm 4)65mm 5) 50mm
6)40mm 7)32mm 8)25mm 9)20mm 10) 15mm.Therelevantspecificationsofitem1.01.aand1.03.ashallbefollowedexceptthattheGIpipescarryinghotand/orcold water embeddedin walls shall be insulated with 6 mm thick asbestos rope closely wound and over wrapped with 2 layers of 500 micronPVCtaping.1.04 Providing,fixingandtesting,heavyqualitygunmetalorbrassgatefullwaywheelvalveofZolotomakeor from the list of
approved make, with screwed / flanged end confirming to IS 778 bearing ISI mark, factorytestedat20kg/m2.,onGIlinesincludingunionofRBrandoneithersideofvalve ifscrewedendorpairofGI flange &EPDMwasher with GI coated nut bolt if flanged end for the following nominal bore (NB)size:
1)150mm 2)100mm 3)80mm 4)65mm 5) 50mm
6)40mm 7)32mm 8)25mm 9)20mm 10) 15mm.
1.0 Materials:The gun metal gate/full way valve of specified dia shall conform to IS: 778 and relevant specifications of plumbingmaterials.ItsfittingsshallbeofRbrand.Allmaterialshallbeof1stqualityofapprovedmakeorequivalent,ascertified by theEngineer-in-charge.2.0 Workmanship:The gun metal gate valve shall be fully cleared of all foreign matter, before fixing. The fixing of valve with flangedends shall be done by means of bolts, nuts and 3 mm rubber insertions, with counter flanges drilled to the same specifications. The jointingshall be leak proof. Unions as specified shall be provided near each screwed end GMvalve, stopcock and/or checkvalve.3.0 Mode of Measurements andPayment:The rate includes all labour, materials, tools and plant, etc., required for satisfactorycompletion of this item. The rate shall be for an unit of one number.1.05 Providing,fixingandtesting,heavyqualityISImarkedgunmetalorbrassnon-returnswingtypevalveof Zoloto / Leader,
with screwed/flanged ends with EPDM washer & GI Nut bolt, factory tested at 20 kg/cm2 on Schedule 80, HDPE / GIlines of the following nominal bore (NB) size:(minimum one no of union shall beprovidedoneithersideofvalveonscrewedjointpipe)
1)150mm 2)100mm 3)80mm 4)65mm 5) 50mm
6)40mm 7)32mm 8)25mm 9)20mm 10) 15mm.
1.0 Materials:The gun metal non-return full way valve of specified dia shall conform to IS: 778 and relevant specifications ofplumbing materials. The non-return valve shall be of tested quality. Its fittings shall be of R brand. All material shall be of 1st quality ofapproved make or equivalent, as approved by the Engineer-in-charge.2.0 Workmanship:The gun metal non-return valve shall be fully cleared of all foreign matter, before fixing. The fixing of valve shallbe done by means of bolts, nuts and 3 mm rubber insertions, with counter flanges drilled to the same specifications. The jointing shall be leakproof. Unions as specified shall be provided near each screwed end valve, stopcock and/or check valve.3.0 Mode of Measurements andPayment:The rate includes all labours, materials, tools and plant etc., required for satisfactorycompletion of this item. The rate shall be for an unit of one number.1.08 LabourchargesforfixingGeyserincludingsupplyandfixing1no.anglevalveofJaquarmakeContinentalseries Cat. No. 053,
with CP copper pipe inlet and outlet connections, including all other electrical accessories supplied/listed by themanufacturer, etc complete to the satisfaction of EIC and as per the drawing/layout.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
207
Title – ITEM SPECIFICATIONS –Water Supply Works Sheet 4 OF 6
The hot water geyser shall be fitted as per the layout drawing, including all specials required for satisfactory completion ofthe item and as per the instructions of the Engineer-in-charge.Labour charges for fixing a Water Purifier / RO plant or equivalent, including supply and fixing 1 no. angle valve of Jaquar
make Continental series Cat. No. 053, with CP copper pipe inlet and outlet connections, including all other electrical accessoriessupplied/listed by the manufacturer, etc complete to the satisfaction ofEICandasperthedrawing/layout.Water Purifier from Eureka Forbes or equivalent shall be fitted as per the layout drawing, including all specials required for satisfactorycompletion of the item and as per the instructions of the Engineer-in-charge.The rate shall be for a unit of one number.
Labour charges for fixing a Water Cooler, including supply &fixing angular stop cock 5053 of Jaquar- Florentine and CPcopper pipe inlet connection and GI outlet pipe, including fixing electrical accessories supplied/listed by manufacture complete,asdirected.2.0 Workmanship:The work shall be carried out in best manner of a workmanship, as directed by the Engineer-in-charge.3.0 Mode of Measurements andPayment:The rate shall cover all material and labour required for the satisfactoryoperation of the unit.1.17 Providing and fixing flanged mount CI sluice valve of Zoloto / Leader make with GM seats, hightensilebrass
spindle with cap, conforming to standard water-works pattern and flanges as per IS: 15381, flat faced anddrilled,etccompletetothesatisfactionofEICwithaccessoriesofthefollowingpipedia:
1) 300 mm 2)250mm 3)200mm 4) 150mm
5)100mm 6)80mm 7)65mm 8) 50mm
1.0 Materials andWorkmanship:CI Sluice valves shall be cast iron double flanged, with non-rising spindle. Each sluice valveshall be provided with wheel for valves in exposed positions and cap top for underground installation. Contractors shall providesuitable operating keys for sluice valves with tops. Sluice valves shall be of approved quality conforming to IS 780 of class-I.The body,domes, covers, wedge/gate and stuffing box shall be of good quality cast iron, the spindle of bronze, the nut and valve seats leaded tinbronze. The bodies spindle and other parts shall be truly machined with surfaces smoothly finished. The area of the water way of thefittings shall be at least equal to the nominal bore of the pipe.3.0 Mode of Measurements andPayment:The rate shall include all the operations required for satisfactory completion of theitem. The rate shall be for a unit of one number.1.18.a Providing, fixing and testing open high density Polyethylene (HDPE) pipes – Hasti orequivalentapprovedmake
(for water supply/drainage purpose) and all type of fittings readymade or fabricated, including jointing using buttwelding, testing, etc. complete, with a working pressure of 6 Kg/cm2 for following diameters. The rate shall includemaking good the surface etc.complete
a)160mm b)140mm c)125mm d)110mm e)90mm f) 75mm
Materials:The HDPE pipes shall be of series II suitable for a working pressure of 6 Kg/m2. It shall conform to IS : 4984-1978. The fittings shall beeither be fabricated out of the pipe or shall be readily available from the manufacturer. Ready madefittingsshallbecompressionmoulded,matchingtothepipespecifications.ItshallconformtoM-P30.Workmanship:Excavation:2.1.1 Thelinesofthetrenchesforallthepipelinesshallbecarefullysetouttothealignmentofthepipelines.Allthenecessaryexcavation,rammingthetrenchbottom,dressingthetrenchsides,refillingthetrenches,ifrequiredinlayers
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
208
Title – ITEM SPECIFICATIONS –Water Supply Works Sheet 5 OF 6
with compacting and disposing the surplus excavated earth, to prepare the trenches of the required length, width and depth, inall respects, in all sorts of soil, shall be as per the relevant specifications of section 1.00 of excavation. The trenches shall becarefully trimmed so that the pipe when laid, shall rest on the natural bed throughout its full length.Therateforearthworkshallincludeforanytimberingorshoringrequiredtosupportthesidesofthetrenches.Unless otherwise directed, not more than 100 m. length in advance of the end of the pipeline already laid shall be open at any time of the work.All works shall be done in open trenches and no tunneling shall be permitted, except after the written consent of theEngineer-in-charge.The Contractor shall take necessary care to protect all the underground works viz. pipes, cables, foundations etc. that may come across or be invicinity of the excavtion. Any damage done, shall be made good by the Contractor at his own cost.Width of the trench:2.2.1 The maximum width of the trench for measurement purpose shall be taken as the external diameter of the pipe plus40 cm. atthe bottom of the trench or actual whichever is less. The sides of the trench shall be kept vertical upto a height of 2 m. fromthebottom.
Depth of the trench:ThetrenchesshallbedugtosuchdepthsastheEngineer-in-chargemaydirectfromtimetotime,butnormallyitshallbe between 900 mm to 1200mm. The bottom of the trench shall be trimmed-off to a perfectly plain surface and allirregularitiesshallbelevelled.Thejointholesshallbeexcavatedtosuchdimensions,asdirectedsoastoallowthejointstobewellandthoroughlyweldedorproperlymade,asthecasemaybe.Noextrapaymentshallbemadeforthis.Laying:Thepipesandfittingsshallbelaidtolineandlevel,inthetrenches,asindicatedonthedetaileddrawing.The joints of the pipes shall preferably be made by butt welding using an Electric hot plate or blow lamp for heating the ends to be jointed. Theend of the pipe to be jointed shall be cut square leaving 3 to 5 mm. more than the required finished length. The pipe surface shall then bescrapped by a knife to remove all unevenness on the periphery. Appropriate union shall then be inserted on the pipe. The pipe shall then beheated slowly and uniformly by means of ametal baffle held in front of the end of the pipe. The temperature of the hot plate/blow lamp shallbe brought to 200OC.On heating, the ends of the pipe swells outwards. Heating shall be continued till the swelling of the pipe is equal to thewall thickness of the pipe. The pipes shall then be pressed against a flange forming tool and pressure shall be maintained till an uniform joint isobtained, i.e till a uniform rim of melted material is formed. The temperature shall be checked by thermocrome chalk, which shall turn blueand then black within 3 seconds. Jointing shall be carried out on ground and a suitable length of the jointed pipe shall be lowered into thetrench. Jointing shall be carried out by skilled persons only. Care shall be taken so that there is no displacement of the center line of the pipewhile jointing. Under roads or where the pipe have to pass through concrete pipe sleeves, 1 m. extra length on both the sides shall be left asdirected by the Engineer-in-charge.Dependingonthesiteconditions,detachableflangedjointsorscrewedjointsmayalsobemade.Where the pipes are to be used for rain water down takes, across the floor slabs, they shall be carried through a G.I sleevetoenableawater-proofjointtobemadeattheslablevel.Testing of the pipes:Testing shall be carried out after the completion of whole length or in parts, as decided by the Engineer-in-charge. The relevantspecifications of item no. 1.01.a.1 shall be followed. Testing shall be carried out with 1.5 times the working pressure. Both theopen ends of the pipe under testing shall be plugged either by providing caps or by sluice valve. If necessary, both the ends shallbe properly anchored. Number of plug points with ferrule of required diameters shall be provided to serve as injection points,air relief points, etc. The pressure shall be applied by means of a manually operated hand force pump or hydraulic pressurepump and the pressure shall be maintained for half-an-hour. In case the trench is already back filled, the pressure shall bemaintained for atleast an hour. While undergoing the test, the pipes shall be struck with a small hammer to detect any leakagethrough the hair cracks. For pipe laid on steep gradientsoronverticalwalls,thetestshallbecarriedoutatthelowerendofthepipe.Anypipe or joints showing the slightest leakage shall be replaced or redone, as required and then tested again. No pipe installationshall be accepted unless the leakage is less than 230 liters/day/Km per 25 mm. dia. of the pipe of 3.66 m. length, for a workingpressure of 10 Kg/m2. For other lengths and diameters of pipe the above shall be proportionate.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
209
Title – ITEM SPECIFICATIONS –Water Supply Works Sheet 6 OF 6
Refilling the trenches:Usuallytherefillingshallbedoneaftersuccessfullytestingthepipes.Mediumsandin200mm.depthonallsidesodfthetrenchesshallbeprovidedandlevelledasdirected.Rateforsandfillingshallbepaidintherespectiveitemofwork.The remaining portion of the trench after filling sand shall be filled in with the available excavted earth. In case the excavated earth is notsufficient, a mixture of hard and soft materials shall be filled. Filling shall be done as per therelevantspecificationsoffillinginsection1.00ofexcavation.2.3.3 Before refilling the trenches the CC 1:1.5 :3 (M20) thrust block &support block & U clamps shall be block shallbeprovidedtokeeppipeinlinelevel&plumb.Mode of Measurements and Payment:The work shall be measured in rmt. of the pipe laid. It shall include providing the trenches andrefilling the same afterthe pipes arelaid.The rate shall be inclusive of the cost of tools, equipments, labour etc. required for the completion ofthe item in all respects. The Excavation, refilling with the available excavated earth, PCC and sand filling on all sides of the trench shall bemeasured and paid separately in relevant item ofcivil tender.Therateshallbeforanunitofonermt..
Providing and fixing, underground or below floor high density Polyethylene (HDPE) pipes – Hasti or equivalent approvedmake (for water supply/drainage purpose) for the diameters as specified in BOQ, and all type of fittings readymade or fabricated,including jointing using butt welding, testing, etc. complete, with a working pressure of 6 Kg/cm2. The items such as excavation,back filling, PCC, sand filling etc shall be paid in relevant items of civiltender.
a)200mm b)160mm c)110mm d)90mm e)75mm f) 60mmRelevant specification of Item No. 1.18.a shall be followed, except that pipe shall be laid in ground.Providing and fixing, Open or underground/below floor high density Polyethylene (HDPE) pipes – Hasti or equivalent
approved make (for water supply/drainage purpose) for the diameters as specified in BOQ, and all type of fittings readymade orfabricated, including jointing using butt welding, testing, etc. complete, with a working pressure of 6 Kg/cm2. The items such asexcavation, back filling, PCC, sand filling etc shall be paid in relevant items of civiltender.
a)200mm b)160mm c)110mm d)90mm e)75mm f) 60mmRelevant specification of Item No. 1.18.a shall be followed.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
210
Title – ITEM SPECIFICATIONS - Sanitaryware Sheet 1 OF 8
2.02.a Providing and fixing white glazed vitreous chinaware wash down type floor mounted EuropeanWC,withintegral`P'or`S'trapincludingcuttingandmakinggoodthewallandfloor.
1.0 Materials:European WC Pan, Cement mortar shall conform to relevant specification of civil materials.2.0 Workmanship:Closet shall be fixed to the floor by means of 75mm long 6.5mm diameter counter sunk bolts and nutsembedded in the floor concrete using rubber or fibre washers so as to prevent any lateral displacement. The joint between the trap of WCand soil pipeshall be made with cement and m-seal.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include the cost of all labour andmaterial for fixing the pan, etc., complete, including testing and commissioning.Providing and fixing ivory glazed vitreous chinaware extended wall mounted cantilever type EWC of Hindustan make Cat No 20040Ultra with Hindware seat cover, with Commander make Dual flush Egret cistern with cistern fittings, CI chair bracket with rag boltand GI 12mm rag bolt with nut and metal washer(pair) etc including supply and fixing of 1 no CP heavy duty angle valve with CPwall flange of Jaquar make Continental series Cat. No. 053 with CP brass inlet connection with integral `P' or `S' trap includingcutting and making good the wall and floor as under with supported on CI wall brackets etc. complete to the satisfaction ofEIC
The relevant specifications of item no. 2.02.a shall be followed except that the WC shall be wall hung and supported either onCI floor mounted chair or on CI wall brackets of approved quality.Providing and fixing ivory glazed vitreous chinaware extended wall mounted cantilever type EWC of Hindustan make Cat No 20061Studio with Hindware seat cover, with Commander make Dual flush Egret cistern with cistern fittings, CI chair bracket with rag boltand GI 12mm rag bolt with nut and metal washer(pair) etc including supply and fixing of 1 no CP heavy duty angle valve with CPwall flange of Jaquar make Continental series Cat. No. 053 with CP brass inlet connection with integral `P' or `S' trap includingcutting and making goodthewallandfloorasunderwithsupportedonCIwallbracketsetc.completetothesatisfactionofEICThe relevant specifications of item no. 2.02.a shall be followed except that the WC shall be wall hung and supported either on CI floormounted chair or on CI wall brackets of approved quality.Providing and fixing Ivory glazed vitreous chinaware extended wall mounted cantilever type EWC of Hindustan make Cat No 20028with Hindware seat cover, with Hindustan make Flushing tank Cat 21038 Constellation cistern with cistern fittings, CI chair bracketwith rag bolt and GI 12 mm rag bolt with nut and metal washer(pair) etc including supply and fixing of 1 no CP heavy duty anglevalve with CP wall flange of Jaquar make Continental series Cat. No. 053 with CP brass inlet connection with integral `P' or `S' trapincluding cuttingandmakinggoodthewallandfloorasunderwithsupportedonCIwallbracketsetc.completetothe
satisfaction ofEICThe relevant specifications of item no. 2.02.a shall be followed except that the WC shall be wall hung andsupported eitheronCIfloormountedchairoronCIwallbracketsofapprovedquality.Providing and fixing, Indian make Ivory glazed vitreous chinaware Orissa pattern No. 20004 water closet of Hindware make withCommander make Dual flush Egret cistern with cistern fittings. Item comprising of : a) Best Indian make, vitreous chinaware Orissapattern water closet, size 580 mm. x 440 mm., back / front inlet as recommended or equivalent. b) Dual Flushing cistern c) 1 noCP heavy duty angle valve with CP wall flange of Jaquar make Continental series Cat. No. 053 with CP brass inlet connection.d) 1no. white glazed vitreous chinaware `P' or `S' trap, of approved make, with or without vent horn, as instructed. (The quoted
rate shall include for setting the water closet in1:2:4 BBCC).The relevant specifications of item no. 2.02.a shall be followedexcept that the WC shall be wall hung and supported either on CI floor mounted chair or on CI wall brackets of approved quality.2.08a ProvidingandfixingIvoryglazedvitreouschinawarewashbasinofHindustanmakewithsingleordouble hole for pillar-tap
comprising of: a) Ivory glazed vitreous chinaware washbasin, with supporting MS or CI brackets. b) 1 no. 40 or 32mmCP cast brass bottle-trap of Jaquar make Allied series Cat. No. 769 withextensionpiecetowall,wallflangewithrubberadopterforwasteconnectionandonewastecouplingCatNo. 709. c) 1 no.heavy quality CP brass angle valve with wall CP flange of Jaquar make Florenetine series Cat.No.5053,15mmsize.d)1no.15mmNBheavyqualityCP-brassinletconnectionwithunionsatend.The
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
211
Title – ITEM SPECIFICATIONS - Sanitaryware Sheet 2 OF 8
supporting bracket shall be painted with 3 coats of approved paint of approved shade etc. complete to thesatisfaction of EIC in following size:
i) 530mmx450mm,ii) 550mmx400mm,iii) 510 mm x 400 mm - Hindustan make Cat. No. 10007SOLAiv) 550mmx400mm (oval-under countertype).
1.0 Materials:The washbasin, the CP brass pillar-tap, the CP brass bottle-trap the CP brass angular stopcock and inletconnection shall conform relevant specifications of plumbing materials. The bracket shall conform to IS: 775. All materials shall be of 1stquality, of approved make or equivalent as approved by the Consultants.2.0 Workmanship:The washbasin shall be fixed on the wall or counter, as and where directed. The washbasin shall besupported on a pair of MS or CI brackets fixed in CM 1:3 (1 cement: 3 sand). The brackets shall conform to IS: 775-1962. The wallplasterontherearshallbecuttorestthetopedgeofthewashbasin.Afterfixingthebasin,plastershallbemadegood and surface finished matchingwith the existingone.The bracket shall be painted with 3 coats of approved ready-mixed paint of approved shade.The CP brass bottle-trap and union shall be connected to 40 or 32mm dia waste pipe, which shall be suitably bent towards the wall. It shall discharge into anopen drain leading to a galley-trap or direct into it on the ground floor and shall be connected to a waste pipe through a floor trap on theupper floors. CP brass bottle-trap and union may not be provided where the surface drain or a floor trap is placed directly under the basinand the waste is discharged into it vertically down.The height of the front edge of the washbasin from the floor level shall be 80 cm or asspecified in the drawing.The necessary inlet, outlet connections and fittings such as pillar-cocks, CP brass waste coupling, waste pipe,stopcock, bottle-trap chain with rubber plug, etc., shall be fixed.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools and plant, etc., required for satisfactory completion of this item as specified.b Providing and fixing ivory glazed vitreous chinaware wash basin of Hindustan make with single ordoublehole for pillar-tapcomprising of: a) Ivory glazed vitreous chinaware washbasin, with supporting MS or CI brackets. b) 1 no. 40 or 32mm CP castbrass bottle-trap of Jaquar make Allied series Cat. No. 769 with extension piece to wall, wall flange with rubber adopter forwaste connection and one waste coupling Cat No. 709. c) 1 nos. heavy quality CP brass angle valve with wall CP flange of Jaquarmake Continental series Cat. No. 053, 15mm size. d) 2 nos. 15mm NB heavy quality CP-brass inlet connection with unions at end.The supporting bracket shall be painted with 3 coats of approved paint of approved shade etc. complete to the satisfaction ofEIC in followingsize:
i) 510 mm x 400 mm - Hindustan make Cat. No. 10007SOLAThe relevant specification of item no. 2.08a shall befollowed.2.10.a. ProvidingandfixingastainlesssteelsinkofNiralimake(GraceDeluxJumboglossytype),singlebowl of size not more
than 610 mm x 460 mm and depth 254 mm, comprising of: a) stainless steel sink supported on MS or CI brackets.b) 1 no. 40 or 32 mm CP cast brass bottle-trap of Jaquar make Allied series Cat. No. 769withextensionpiecetowall,wallflangewithrubberadopterforwasteconnectionandonewastecoupling.c) 1 no. heavyquality CP brass angle valves with wall CP flange of Jaquar make Continental series Cat. No. 053 15 mm size. d) 1no. 15 mm NB heavy quality CP-brass inlet connection with unions at end. The supporting bracket shall bepainted with 3 coats of approved paint of approved shade etc. complete to the satisfaction of EIC
1.0 Materials:Stainless steel sink, 40mm CP brass waste-coupling with a rubber plug and chain shall conform to relevantspecification of plumbing material.2.0 Workmanship:The SS kitchen sink shall be supported on a pair of MS or CI brackets, fixed in CM 1:3 (1 cement: 3 coarsesand). The MS or CI brackets shall conform to IS: 775. The wall plaster on the rear shall be cut to rest the top edge of the
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
212
Title – ITEM SPECIFICATIONS - Sanitaryware Sheet 3 OF 8sink over it. After fixing the sink, the plaster shall be made good and the surface finished to match with the existing one.The CP brass trapand union shall be connected to 40mm dia nominal bore waste pipe (as per drawing), which shall be suitably bent towards the wall. It shalldischarge into a `P' trap leading to a gully-trap or direct into the galley-trap on the ground floor and shall be connected to a waste pipethrough a floor trap on the upper floors. Surface drain or a floor trap when placed directly under the sink, the waste shall be verticallydirectly discharged down.The height of the front edge of the sink from the floor level shall be 80 cm or as shown in drawings.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools, plant and other equipment required for satisfactory completion of this item.
2.10.b. Asperitemno2.10.abutsinkshallbewithdrainboardinsteadofsinkwithsinglebowl..2.11.a Providingandfixingscrewdownbrasschromiumplatedheavyqualitybib-tapofJaquarmakeContinentalseries Cat. No.037 on water supply pipe lines of 15mm dia with or without extension piece but with a flange etc. complete to thesatisfaction ofEIC
1.0 Materials:15mm dia CP brass screw down shall conform to IS: 781, as per relevant specification of plumbing materials. Thebib- tap shall be of 1st quality, of approved make or equivalent as approved by Consultants.2.0 Workmanship:The screw down bib-tap of 15mm dia as specified above shall be fixed as directed. The threaded portion shallbe smeared with white or red lead and provided with a few turns of fine spun yarn round the screwed end of the pipe or the joint shall bedone with a Teflon tape. The bib-tap shall be then screwed and fixed water tight.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools and plant, etc., required for satisfactory completion of this item.2.11.b Providing and fixing, Swan Neck Tap with Right &Left Hand Operating Knob, of Jaquar makeContinental series
Cat. No. 127 heavy quality, of approved make, on GI lines, of 15 mm. dia., with or without extensionpieceandflangeetccompletetothesatisfactionofEIC.The relevant specifications of item no. 2.11.a shall be followed except that long body bib tap shall be used. The rateshallbeforaunitofonenumberandincludecostofalllabour,materials,toolsandplant,etc.,requiredforsatisfactory completion ofthisitem.
Providing and fixing brass chromium plated heavy quality wash basin mixer pillar-tap/cock of Jaquar make Continental series CatNo. 167 on water supply pipelines of 15mm dia with or without extension piece but with a flange, etc., complete to thesatisfaction ofEIC.The relevant specifications of item no. 2.11.a shall be followed entirely except that central hole CP basin mixer shall be used.The rate shall be for a unit of one number and include cost of all labour, materials, tools and plant, etc., required forsatisfactory completion of this item.Providing and fixing brass chromium plated heavy quality wash basin pillar-tap/cock of Jaquar make Continental series Cat No.011 on water supply pipelines of 15mm dia with or without extension piece but with a flange, etc., complete to the satisfactionofEIC. The relevant specifications of item no. 2.11.a shall be followed entirely except that central hole CP basin mixer shall be used.The rate shall be for a unit of one number and include cost of all labour, materials, tools and plant, etc., required forsatisfactory completion of this item.Providing and fixing 15mm NB CP brass heavy quality wall or floor mounted sink tap, swivel type, with CP wall flange, castedspout of Jaquar make Continental series Cat. No. 357etc. complete to the satisfaction of EIC
1.0 Materials andWorkmanship:The relevant specifications of item no. 2.11.a shall be followed except that the brass chromium plated wall or floor mountedsink tap, swivelling type, shall be fixed and the wall or floor shall be reinstated to its original condition, after fixation.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
213
Title – ITEM SPECIFICATIONS - Sanitaryware Sheet 4 OF 8
3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools and plant, etc., required for satisfactory completion of this item.2.15 Providing and fixing best Indian make mirror of specified size like Modi float, Sain Gobin, I.A.G orequivalentsilvered
locally, with plain edge as required, with 12mm thick marine plywood backing, with CP brass caps, etc., complete.Teakwood beading of 20mm x 32mm size, with French polish or 3 coats of paint etc. complete to the satisfactionofEIC
1.0 Materials:The mirror shall be of Modifloat, Triveni, I.A.G. or equivalent as approved by the Consultants, with the edgesrounded off as specified. The mirror shall be float glass, electroplated with silver. The mirror shall be free from waviness or distortion, fromall angles of vision. Its thickness shall not be less than 6mm The back of the mirror shall be free from any silvering defects. Silvering shallhave a protective uniform covering of red-lead paint. The 12mm thick marine plywood shall conform to relevant specification of civilmaterials and IS:710. Teakwood shall conform to relevant specification of civil materials.2.0 Workmanship:The mirror of a specified size, shall be mounted on wooden frame comprising of 12mm thick marine plywoodand teak beading, as per drawing and directed by the Architect or Engineer-in-charge. The wooden frame shall be fixed in position by fixingwooden plugs in wall and the work shall be carried out in form of the best workmanship. For teakwood beading relevant civil work itemspecification shall be followed. The teakwood beading shall be of 20mm x 32mm size.3.0 Mode of Measurements andPaymentThe rate shall be for a unit of number and include cost of all labour and materials, toolsand plant, etc., required for satisfactory completion of this item. The rate shall be for a unit of square meter.2.16.a Providing and fixing a CP brass towel-rail of Jaquar make Continental series Cat. No. 1111, 600mm
longwithconcealedtypebracketsfixedtothewallwithCPbrassscrews,etc.,complete.
1.0 Materials:TheCPbrasstowelrodshallbe600mmlongandof20mmdiameter.ThetowelrodshallbeprovidedwithapairofCP brassbrackets, fixed to the wall with CP brass screw with round head, using cup washers, screwed on to wall plug embedded in wall. The bracketsshall be of concealed type CP brass. The rod shall conform to IS:1068. All materialsshallbeof1stqualityofapprovedmakeapprovedbytheConsultants.2.0 Workmanship:The brackets of the towel rail shall be fixed by means of CP brass screws fixed to wall plugs, firmly embeddedin the wall. The towel rod shall be fixed as per detailed drawing or as per the instruction of Engineer-in-charge and Architect.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour andmaterials, tools and plant, etc., required for satisfactory completion of this item.
Providing and fixing a CP brass Towel-ring of Jaquar make Continental series Cat. No. 1121 with concealedtypebracketsfixedtothewallwithCPbrassscrews,etc.,completetothesatisfactionofEICThe relevant specifications of item no. 2.16.a shall be followed for clauses 2.0 and 3.0, except that CP brass towel-ring shall befitted.
Providing and fixing a CP towel-rack, 230 x 600mm size of Jaquar make Continental accessories Cat. 1181 with concealed typebrackets fixed to the wall with CP brass screws, etc., complete to the satisfaction ofEICThe relevant specifications of item no. 2.16.a shall be followed for clauses 2.0 and 3.0 except that CP towel-rack shall be fitted.
Providing and fixing SS or brass chromium plated double Robe hook of Jaquar make Continental series Cat.1161asperthedesignandspecifications,etc.,completetothesatisfactionofEIC
1.0Materials:The CP brass Robe-hook shall be fixed to the wall with CP brass screw with round head, using cup washers, screwed onto wallplugembeddedin wall. ThebracketsshallbeofconcealedtypeCPbrass.Allmaterialsshallbeofapproved make, as approved by theConsultants.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
214
Title – ITEM SPECIFICATIONS - Sanitaryware Sheet 5 OF 8
2.0 Workmanship:The Rob hook shall be fixed by means of CP brass screws fixed to wall plugs firmly embedded in the wall.The hook shall be fixed as per detailed drawing or as per the instruction of Engineer-in-charge and Architect.2.17.a Providingandfixingarecessedtypetoiletpaper-rollholderofapprovedmake,size150mmx150mm,withwooden rod
and spring, including cutting a recess in the wall, setting the roll holder in CM 1:3, reinstatement of the wallsurface to original conditions etc.,complete.
1.0 Materials:The toilet paper roll holder shall be of white glazed vitreous chinaware of specified size. It shall be of recessedtype with wooden rod with spring at one end for holding the paper roll. All materials required for satisfactory completion of this item shallbe of 1st quality, of the approved make or equivalent as approved by the Consultants. The cement mortar 1:3 shall conform to relevantspecification of civilmaterials.2.0 Workmanship:The toilet paper holder shall be fixed in the wall as per drawing, by cutting a recess in the wall, fixing theholder with CM 1:3 ( 1 cement: 3 fine sand) and rectifying the wall surface to original conditions.
3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools and plant, etc., required for satisfactory completion of the item.2.17.b Providingandfixingascrew-to-walltypetoiletpaper-rollholderfixedtothewallwithCPbrassscrews,of Jaquar make
Continental series Cat. No. 1153 complete to the satisfaction ofEICThe relevant specifications of item no. 2.17.a shall be followed except that screw-to-wall type paper-roll holder shall be fixed to the wallwith C.P brass screws, with round head, using cup washers screwed onto the wooden roll plugs, embedded in the wall.2.18.c Providingandfixingasurfacetypesoapdish/trayofChillymakeCat.No.CR001Cindrellacompletewithclean surface to
original conditions, etc., complete to the satisfaction ofEIC
1.0 Materials:TheCPsoapdishortrayshallbeofbestqualityandofapprovedmake.ThescrewsforfixingshallbeofCPbrass.Allmaterialsshallbeofthebestquality,asapprovedbytheConsultants.2.0 Workmanship:The CP soap dish shall be fixed in wall by providing wooden plugs in the wall. The work shall be carriedout in the best manner of workmanship and as per the drawing, as directed by the Consultants.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools and plant, etc., required for satisfactory completion of the item.2.19.a.1. Providing and fixing a CP brass stopcock (male or female end) of 15mm dia on water supply pipe linesas
approved by the Consultants etc.,complete.
1.0 Materials:The brass screw down stopcock, male end, of specified dia shall conform to IS: 781 and as per relevantspecification of plumbing materials. The stopcock shall be of tested quality and of easy to clean variety. The stopcock shall be of approvedmake or equivalent as approved by the Consultants.2.0 Workmanship:The stopcock shall be fixed in position by means of Jam nut and socket. The stopcock shall be fixed asdirected. The joints shall be done with a Teflon tape. The joint shall be tested for any leak.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools and plant, etc., required for satisfactory completion of this item.2.19.c.1 ProvidingandfixingaheavyqualityCPbrassangularstopcockofJaquarmakeContinentalseriesCat.No.
053(maleorfemaleend)of15mmdiaonwatersupplypipelinesetc.completetothesatisfactionofEICThe relevant specifications of item no. 2.19.a.1 shall be followed except that the CP brass angular stopcock shall be used on G.I lines.The rate shall be for a unit of one number and include cost of all labour, materials, tools and plant, etc., required forsatisfactory completion of this item.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
215
Title – ITEM SPECIFICATIONS - Sanitaryware Sheet 6 OF 8
2.19.d Providing and fixing a heavy quality CP brass stopcock (concealed with sheet flange) of 15mm dia.of JaquarmakeCat. No. 083 on water supply pipe lines etc. complete to the satisfaction ofEICThe relevant specifications of item no. 2.19.a.1 shall be followed except that the CP brass push type stopcock shall be used onG.I lines.The rate shall be for a unit of one number and include cost of all labour, materials, tools and plant, etc., required forsatisfactory completion of this item.
2.20.a Providing and fixing a 15mm dia inlet pressure adjustable over head shower rose with shower arm Cat.No,477ofsize190mmandoverheadshowerofJaquarmakeContinentalseriesCatNo.491etc.completetothe satisfactionofEIC
1.0 Materials:All materials shall be of the best quality, of approved make or equivalent certified by the consultants.2.0 Workmanship:The shower set comprising of the adjustable rose and shower arm with flange shall be fixed with a concealedcock so that the flange shall be clear of the finished wall, as per the detailed drawings.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools and plants, etc., required for satisfactory completion of this item.2.21.a Providingandfixingahotandcoldwaterwallmixerwithatelephonicshowerarrangementofapprovedmake as directed
by theConsultants.
1.0 Materials:All materials shall be of the best quality of approved make or equivalent as approved by the Consultants.2.0 Workmanship:The hot and cold water wall mixer with a telephonic arrangement shall be fixed in position by means of Jamnut and socket. It shall be fixed near the outlet of the G.I water line or as directed. The joints shall be done with a Teflon tape. The joint shallbe watertight.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials,tools and plants, etc., required for satisfactory completion of this item.2.21.c Providing and fixing high flow single liver concealed divertor for Bath and Shower with allaccessories,flangeetc
complete of Jaquar make Florentine series Cat. No. 5079 as approved by theConsultantsThe relevant specifications of item no. 2.21.a shall be followed except that wall mixer shall be with non-telephonic shower system.Therate shall be for a unit of one number and include cost of all labour, materials, tools and plant, etc., required for satisfactory completion ofthis item.2.21d Providing and fixing Hand Shower (Health Faucet) of Jaquar make Allied series Cat. No. 573 with anglevalveof
Jaquar make Continental series Cat. No 053 with CP flange with 8 mm dia., 1 m long PVC tube and wall hook ofapproved make and as approved bythe consultantsThe relevant specifications of item no. 2.21.a shall be followed except that wall mixer shall be with non-telephonicshower system.The rate shall be for a unit of one number and include cost of all labour, materials, tools and plant, etc.,required for satisfactory completion of this item.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
216
Title – ITEM SPECIFICATIONS - Sanitaryware Sheet 7 OF 8
2.21.e Providing and fixing Hot & Cold wall mixer with provision for over head shower with all accessories,flange etccomplete of Jaquar make Continental series Cat. No.273The relevant specifications of item no. 2.21.a shall be followed except that wall mixer shall be with fixing Hot &Cold wall mixerwith provision for over head shower.The rate shall be for a unit of one number and include cost of all labour, materials, toolsand plant, etc., required for satisfactory completion of this item.
Providing and fixing a vitreous chinaware Ivory colour large flat back urinal of Hindustan make Cat. No. 60002 as approved byConsultants, comprising of: a) CP brass heavy quality spreaders, 1 for each urinal. b) 32mm NB waste coupling Jaquar make Alliedseries Cat No. 709, 1 for each urinal c) 40 GI waste pipe with bottle trap of Jaquar make Allied series Cat. No. 769, Extension pipe 15mm size. for each urinal upto bottom of channel / trap shall be used, and d) Necessary connecting CP brass pipe upto spreaderalong with necessary connection; in size mentionedunder:
i) Large flat back wall hung urinal, 610mm x 410mm with suppportingbrackets,ii) Small flat back wall hung urinal, 456mm x355mm,iii)Angle back or spree flat back urinal, 430mm x370mm.
1.0 Materials:The Ivory vitreous chinaware flat back wall hung urinal of specified size shall conform to relevant specification ofplumbing material. CP brass heavy quality spreader and CP brass waste coupling shall be of approved quality. The CI bracketshallconformtoIS:775.Allmaterialsshallbeofthebestquality,ofapprovedmakeorequivalentasapproved by theConsultants.2.0 Workmanship:The urinal shall be fixed in position by using wooden plugs and screws and shall be at a height of 65 cm, fromthe floor level to the top of the lip of urinal, unless otherwise directed. The wooden plugs shall be 50mm x 50mm at base tapering to 38mm x38mm at top and 50mm in length and shall be fixed in wall in CM 1:3: (1 cement: 3 coarse sand). The urinal shall be connected to 32mm diaflexible P.V.C. pipe, which shall discharge into the channel or floor trap. The connection between the urinal, waste coupling and waste pipeshall be made by means of putty or white, clear white lead mixed with chopped hemp. Necessary connecting CP brass pipe between stopcockand spreader along with necessary connection shall be provided for flushing the urinal.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials, toolsand plants, etc., required for satisfactory completion of this item.2.23 Providing and fixing a Floor mounting bidets of star white of Hindustan make Cat. No. 30007 as approvedby
Consultants, comprising of: Rimless design with firm thigh support Wall mounted bidet with concealed plumbingchrome-plated cap for overflow hole and angle valve of Jaquar make Florentine series Cat. No5053- 1 no. for eachurinal including Necessary connecting CP brass pipe upto spreader along with necessary connection; in size 34 X36 X 59 cmThe relevant specifications of item no. 2.22 shall be followed except that the floor mounting Bidets usinginstead of Urinal.
1.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour, materials, toolsand plants, etc., required for satisfactory completion of this item.2.27 ProvidingandfixingavitreouschinawareivorycolourdivisionplatforUrinalofHindustanmakewithbrass screws silicon
sealant etc.complete.
1.0 Materials:Urinal partition shall be ivory glazed vitreous chinaware of specified size, CP brass screws and MS clip shall beprovided as required. All materials shall be of 1st quality, of approved make or equivalent as approved by the Consultants2.0 Workmanship: The urinal partition shall be fixed at proper height with CP brass screws with anchor fastener and MSclips, as approved by the manufacturer and as directed by Consultants.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
217
Title – ITEM SPECIFICATIONS - Sanitaryware Sheet 8 OF 8
3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include cost of all labour,materials, tools and plant, etc., required for satisfactory completion of this item.2.29.a Providingandfixingspoutwithallaccessories,flangeetccompleteofJaquarmakeContinentalseriesCat.
No.429asapprovedbytheConsultants.
1.0 Materials:The spout shall conform to relevant latest I.S. Codes and shall be of 1st quality, of approved make orequivalent as certified by the Consultants.2.0 WorkmanshipThe work shall be carried out in the best manner of workmanship, as per drawing and as directed by theConsultants.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include for all labour, materials andtools required to complete the work in satisfactory manner.2.30 Providing and fixing a Urinal Valve Auto Closing System with Built-in Control of Pressmatic Tap ofcategory-
077forUrinalofHindustanmakewithbrassscrewssiliconsealantetc.complete.
1.0 Materials:The spout shall conform to relevant latest I.S. Codes and shall be of 1st quality, of approved make orequivalent as certified by the Consultants.2.0 Workmanship:The work shall be carried out in the best manner of workmanship, as per drawing and as directed by theConsultants.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one number and include for all labour, materials andtools required to complete the work in satisfactory manner.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
218
Title – ITEM SPECIFICATION – Internal Drainage Sheet 1 OF 8
3.01.a ProvidingandfixingCIspun/sandcast,soiltypepipeincludingtubefittingssuchassockets,reducers,longor short bends,flanges, tees etc., with or without inspection door, vents, cowls at top etc., of approved make in proper line and levelincluding necessary support like MS hot dip galvanized iron bracket from 35X5mm or aluminium brackets / clamps(ready made chilly make clamps with minimum 3mm thickness – sample to be approved), MS flats as required,open/concealed to wall, ceiling and floor, including making them good having lead caulked joints, testing and paintingthe pipes and specials with minimum 2 coats of approved bitumastic paint over one coat of primer etc., complete as perthe specification and as directed by the Engineer-in-charge. The diameter of pipe shall be as under:1)230mm 2) 150mm NB 3) 100mm NB 4) 75mm NB.
Materials:The specified dia CI Spun soil/Sand cast pipe and brackets/clamps shallconformto relevantplumbingmaterial specification. The lead shall confirm to IS:782.The fittings shall be of ‘medium’ type cast iron conforming to material specification.
General :The CI Spun soil/Sand cast pipe and fittings shall be of the required diameter, size and type, as specified in the item. The pipe shall befixed in full lengths, as far as possible. All the pipes shall be fixed on wall face, at locations indicated on the drawings or as instructed bythe Engineer-in-charge. Pipes shall be secured to the face of the wall, below all joints, by MS brackets/clamps with Anchor fasters or on abracket with 6mm/8mm dia GI threaded bar bent to a required dia shall be nut-boltedwithwasher.Allsoilpipesshallbecarriedupabovetheroofandshallhaveacowl.The ventilating pipe or shaft shall be carried up to a height of atleast 1 m above the outer covering of the roof of the building. In the caseof windows in a gable wall or a dormer window, ventilating pipe shall be carried upto the ridge of the roof or atleast 2 m above the top ofthe windows. In case of flat roof to which access for use is provided, it shall be carried upto a height of atleast 1 m above the parapet or 2m measured vertically from the top of any windows or opening which may exist upto a horizontal distance of 5 m from the vent pipe intosuch building. In case of open areaswherebuildingsofotherstructuresarenotinimmediatevicinity,theventpipeshallbecarriedouttoaheightofatleast 3m.Where ventilating pipes are carried in shafts, they shall be of an ergonomically workable size. If the shafts are also used to give light andair to rooms, at the roof level the ventilating pipes shall be carried out to a horizontal distance of notlessthan5mfromthesiteoftheshaft.The sand cast iron pipes above parapet shall be fixed with MS brackets/clamps and stays. The brackets/clamps shall be made from 5mmthick MS flat bar of 35mm width, bent to the required shape and size to fit tightly, on the sockets, when tightened with screw bolts. Itshall be formed of 2 semicircular pieces with flanged ends on both sides; with holes to fit in the screw bolts and nut 40mm long. One endof the stay shall be bent to from a hook to be fixed with brackets/clampsbymeansofbolts andtheotherendshallbebentforembeddinginwall inCCblockofsize200mmx 100mmx100mmin1:2:4mix.Theconcreteshallbefinishedtomatchthesurroundingsurfaces.The connection between the main pipe and branch pipes shall be made by using fittings and specials (branches, tees, elbows and bends)with access doors for cleaning. Branch pipes shall be connected to stacks at the same angle asthatofthefittings.Nocollarsshallbeusedonverticalstacks.The waste from lavatories, kitchen basins, sinks, baths and other floor traps shall be separately connected to respective stacks of upperfloors. The waste stack of lavatories shall be connected directly to manhole while the waste stack of other shall be separately dischargedover gullytrap.It shall be the responsibility of the Contractor to provide all sleeves, openings, hangers, inserts, etc., wherever required by the Engineer-in-charge, for various services. Damages caused while providing this shall be made good by the Contractor.Workmanship:All pipes shall be laid as per proper slope, level and gradient specified on the drawing.CI pipes shall be of the specified diameter and infull length including socket ends of the pipes unless shorter lengths are required at junctions with fittings.
Fixing:Thepipesandfittingsshallbefixedinverticalalignment,unlessotherwisespecifiedandshallbesecuredto the walls atjoints with brackets/clamps. They shall be of MS or Aluminium, bent to the required shape and size to fit tightly on thepipe when tightened with MS bar, nut, bolt and washer. The brackets/clamps shall be fixed to the walls and kept about25mm clear off the finished face of the wall so as to facilitate cleaning and painting of the pipes.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
219
Title – ITEM SPECIFICATION – Internal Drainage Sheet 2 OF 8
Preparation of Joints:YarnJoints:The interior of the socket and the exterior of the spigot shall be cleaned thoroughly and dried. The spigot of the upper pipe shall beproperly fitted into the socket of the lower pipe such that there is uniform annular space for fitting with the jointing material. Yarn ofrequired length shall be placed around the spigot of the pipe to centre the spigot in the socket. Knotting of the yarn shall not bepermitted. Required length of the yarn shall be in one piece. When single strand of yarn material is used, overlap at the top shall be notmore than 50mm. When more than one strand is required for a joint, each strand shall be cut to the required length so that the ends shallmeet on the opposite sides ofthepipeandnotontoporbottom.Whenthespigotisshovedhome,theyarningmaterialshallbedriventightlyagainsttheinsidebaseorhubofthesocketwithsuitabletools.
Lead Caulked Joints:The pipes and fittings shall be joined with lead caulked joints. The angular space between the socket and spigot shall be first well packedwith spun yarn soaked in bitumen and then dried, leaving space as detailed and as specified in plumbing material specification, from thelip of the socket, for lead. The joints may be leaded by wrapping a ring of hemp rope covered with clay around the pipes at the end of thesockets by using special leading rings having a hole into which molten lead shall be poured.Lead joints: Conforming to IS: 782, lead shall be heated to proper temp. in a melting vessel. Before pouring, all scum ordress which may appear on the surface of the lead, during melting, shall be skimmed off. Each joint shall be filled in onecontinuous pouring. Spongy or imperfectly filled joints shall be burnt out and re-poured. Care shall be taken not tooverheat the lead.Precaution for melting the lead:i) Leadshallbeputinacleananddrycontainer.ii) Sufficient quantity of lead shall bemelted.iii) Lead shall not beoverheated.The approximate depth (with a tolerance of 5%) of pig lead for each joint of CI Pipes and fittings shall be as under:made with caulking lead wool or yarn. Joints caulked with lead wool or lead yarn shall withstand greater displacement thancast lead joints.----------------------------------------------------------------------------------------------------------------------------DiameterofPipe Depth of lead DiameterofPipe Depth oflead----------------------------------------------------------------------------------------------------------------------------75mmto150mm 45mm 300mmto450mm55mm 200mmto250mm50mm 500mm &600mm60mm----------------------------------------------------------------------------------------------------------------------------Quantity of lead and spun yarn required for each joint shall be as under:----------------------------------------------------------------------------------------------------------------------------Nominal Lead Spunyarn Nominal Lead SpunyarnDia.ofPipe reqd. reqd. Dia.ofPipe reqd. reqd.Inmm inkg inkg inmm in kg inkg----------------------------------------------------------------------------------------------------------------------------75 1.8 0.10 300 7.2 0.48100 2.2 0.18 400 9.5 0.60125 2.6 0.20 450 14.0 0.95150 4.0 0.20 500 15.0 1.00200 5.0 0.20 600 16.0 1.00----------------------------------------------------------------------------------------------------------------------------Note:The quantities given in the table are approximate and a variation of 20% is permissible. However, the depth of lead in thejoints shall be adhered to within the permissible limit of ± 0.5% of above values.After caulking, the leading ring shall beremoved and the projecting lead shall be removed by chiselling. Caulking shall be done after a convenient length of pipehas been laid and leaded. The joint shall be then caulked all around three times with proper caulking chisel of increasingthickness and a hammer, weighing 2 to 2.5 kg in such a manner as to make the joint sound. The joint shall be left flushedand neat, even with the socket. The pipes with ears shall be secured with steel or iron barrel pieces and stout 10 cm longgalvanised iron nails of 10cm length driven into wood plugs of 40mm thickness fixed on the wall on wall. Access doors tofittings shall be provided with 3mm rubber insertion packing and secured without screws to make them air and watertight. Lead joints shall not be covered till the pipelines are tested under pressure, but the rest of the pipe lines may becovered to prevent deformation resulting from temperatureeffect.Lead Wool joints:Wherever it is impractical or dangerous to use molten lead, cold application shall be required. Then thejoints may be
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
220
Title – ITEM SPECIFICATION – Internal Drainage Sheet 3 OF 8Approximate weights and depths of lead wool required for each joint of various dia of CI pipes and fittings are given below. Just sufficientquantity of spun yarn shall be put so that the specified depth of lead wool is achieved. An allowance of 5% variation in the specified weightsand depths shall be permissible.----------------------------------------------------------------------------------------------------------------------------- -------------Nominal dia. Lead wool ReqdDepth Nominal Lead wool ReqdDepthofpipe spunreqd. of lead wool dia.of spunreqd.ofleadwoolinmm inkg inmm pipeinmm inkginmm------------------------------------------------------------------------------------------------------------------------------------------75 0.80 19 300 3.50 25100 0.90 19 350 4.65 29125 1.25 20 400 5.70 31150 1.60 23 450 6.70 32200 2.05 23 500 8.30 33250 2.95 25 600 10.00 35----------------------------------------------------------------------------------------------------------------------------- -------------Jointing shall be made with caulking lead wool or yarn inserted in strings not less than 5mm thick and the caulking shall berepeated with each turn of lead wool or yarn. The entire lead wool or yarn used shall be compressed into a dense mass.Caulking tools of appropriate thickness shall be used to fill the joint space with lead wool to thoroughlyconsolidatethematerialsfromthebacktothefrontofthesocket.Painting:CI drainage pipes in exposed location, in shafts and pipe spaces shall be painted with two or more coats of bitumastic paintover a coat of primer.Paint shall be of approved quality and shade and where directed, the pipes shall be painted inaccordance with approved pipe colour code.CI pipes in chase shall be painted with two coats of bitumen paint covered withpolyethylene tape and a final coat of bitumen paint.CI water supply pipes below ground and covered by cement concreteshall not be painted.Testing:Before use at site, all CI drainage pipes shall be tested by filling up with water for atleast 10 minutes. After filling, pipes shallbe gently struck with a hammer and inspected for blow holes and cracks. All defective pipes and joints shall be rejected andremoved/redone as required, from the site within 48 hours.Pipes shall be tested after installation, by filling up the stack withwater. All opening and connections shall be plugged. The total head in the stack shall, however, not exceed 3 m.Alternatively,the contractor shall test all water supply stacks by a smoke testing machine. Smoke shall be pumpedintothestackafterpluggingallinletsandconnections.Thetopendshall however beleftopen.Thestackshallthenbe observed forleakage and all defective pipes and fittings removed or repaired as directed by the Engineer-in-charge. Defective joints shallberedoneA test register shall be maintained and all entries shall be signed and dated by Contractor and Engineer-in-charge.
3.0 Mode of Measurement andPayment:The length of pipe shall be measured including all fittings along its length in running meters, correct to a centimeter. Noallowance shall be made for the portion of pipe length entered in the sockets of the adjacent pipe or fittings. The rate shallbe inclusive of all materials, labour, tools and plant etc., required for satisfactory completion, testing andcommissioningofthisitem.Therateshallbeforaunitofonerunningmeter.3.01.b Providing and fixing CI spun/sand cast soil quality pipe of approved make, including tube fittingssuchas sockets, reducers, long or short bends, flanges, tees etc., with or without inspection door, vents, cowls at top etc., inproper line and level including necessary support like MS or aluminium brackets/clamps, MS flats as required,open/concealed to wall, ceiling and floor including making them good, filling the joints and fittings with spun yarnsoaked in neat cement slurry and CM 1:1 (1 cement: 1 sand) and sealant like M-seal or equivalent, testing andpainting the pipes and specials with minimum 2 coats of approved bitumastic paint over one coat of primer etc. complete asper thespecificationandasdirectedbytheEngineer-in-charge.Thediaofpipeshallbeasunder: the next section.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
221
Title – ITEM SPECIFICATION – Internal Drainage Sheet 4 OF 8
2.0 Workmanship:Joints:The pipe shall be fixed vertically. The spigot of the upper pipe shall be properly fitted in the socket of the lower pipesuch that there is uniform annular space for filling with the jointing materials. The annular space between the spigot andsocket shall be filled with a few turns of spun yarn soaked in cement slurry or blown bitumen 85/25 grade. These shall bepressed home by caulking tools. The joints shall then be filled with stiff CM 1:1 (1 cement: 1 fine sand) and sealant like M-seal or equivalent well pressed with caulking tools and finished smooth at top at an angle of 45sloping up. The depth of thesealant shall be approximately 1/4th the total depth of the joint. The joints shall be kept wet atleast for 7 days by taping 4folds of gunny bag to the pipe and keeping it moist constantly.
3.0 Mode of Measurements andPayment:Thelengthofpipeshallbemeasured,includingallfittingsalongitslength,inRMcorrecttoacentimetre.Noallowance shall be made for the portion of pipe length entered in the sockets of the adjacent pipe or fittings. Therate shall be inclusive of all materials, labour, tools and plant, etc., required for satisfactory completion and testing of this item. TherateshallbeforaunitofoneRM.Providing and fixing CI spun sand cast soil quality pipe including tube fittings such as sockets, reducers, long or short bends, flanges,tees etc., with or without inspection door, vents, cowls at top etc., of approved make, in proper line and level including necessary supportlike MS or aluminum brackets/clamps, MS flats as required , open/concealed into wall, ceiling and floor including making them good,having lead caulked joints, testing and painting the pipes and specials with minimum 2 coats of approved bitumastic paint over one coatof primer etc. completeasperthespecificationandasdirectedbytheEngineer-in-charge.Thediaofpipeshallbe
1) 150mmNB 2)100mmNB 3) 75mmNBAll the relevant specifications of item no. 3.01.a shall be followed except that the pipe shall be concealed instead of being kept on the wallface. All pipes running along ceiling shall be fixed on structural adjustable brackets/clamps of special design as shown on the drawings oras directed. Horizontal pipes shall be laid to uniform slope and the brackets/clamps adjusted to the proper levels so that the pipes fullyrest on them. All pipes running along the sunken floor shall be encased in 10 cm brickwork leaving 5cm gap all around the pipe. 5mbedding of CM 1:2 shall be provided below the pipe. Relevant civil specification shall be followed for masonry work and mortar. Horizontalpipes in sunken floor shall be laid to uniform slope and gradient, as specified.Providing and fixing CI spun sand cast soil quality pipe of approved make including tube fittings such as sockets, reducers, long orshort bends, flanges, tees etc. with or without inspection door, vents, cowls at top etc., , in proper line and level including necessary supportlike MS or Aluminum brackets/clamps, MS flats as required, concealed into wall, ceiling and floor, complete including making good thewall, ceiling, and floor, filling the joints and fittings with spun yarn soaked in neat cement slurry and CM 1:1 (1 cement: 1 sand) andsealant like M-seal or equivalent, testing and painting the pipes and specials with minimum 2 coats of approved bitumastic paint overone coat of primer etc., complete as per the specification and as directed by the Engineer-in-charge. The dia of pipe shall be of thefollowing nominalbore:
1)150mmNB 2)100mmNB 3) 75mmNB.All the relevant specifications of item no. 3.02.a shall be followed except that the joints and fittings shall be filled with spun yarn soaked inneat cement slurry and CM 1:1 (1 cement: 1 sand) and sealant like M-seal or equivalent instead of lead caulked joints. The relevantspecification of 3.01.b shall be followed for filling the joints with CM 1:1 (1 cement: 1 sand) and sealant like M-seal.3.03.a Providing and fixing acast iron‘P’trap of self-cleansingdesignwithawatersealnotlessthan50mm,withor without
vent, including setting the trap in 1:2:4 CC, etc., complete. The trap shall be `P' type, with 100mm dia inlet and75mm dia outlet, asrequired.
1.0 Materials:The cast iron(spun) ‘P’ trap shall conform to relevant plumbing material specifications. The CI hinged screweddown cover and all materials shall be of 1st quality as approved by the Engineer-in-charge. CC 1:2:4 and formwork material shall confirmto relevant civil specifications.2.0 Workmanship:The ‘P’ trap with 100mm dia inlet and 75mm dia outlet shall be fixed as per drawing or as directed.The ‘P’ trapshall be jointed with CI pipe with lead joints. The lead joints shall conform to IS: 782 and as described in item no. 3.01.a. The trap and wastepipes shall be set with 1:2:4 ( 1 cement: 2 fine sand: 4 coarse aggregate) CC firmly supported on the structural floor. The concrete shallextend to 40mm below finished floor level. The contractor shall provide all necessary shuttering and centering for the concrete. Size of theconcrete block shall be 30cm x 30cm of required depth.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
222
Title – ITEM SPECIFICATION – Internal Drainage Sheet 5 OF 8
3.0 Mode of Measurements andPayment:The rate shall include the cost of all materials, labour, tools and plants, etc.,required for satisfactory completion of this item, including lead jointing andtesting.The rate shall be for a unit of one number.Providing and fixing a cast iron ‘P’ trap of self-cleansing design with a water seal not less than 50mm, with or without vent,including setting the trap in 1:2:4 CC, etc., complete. The ‘P’ trap shall be with 100mm dia inlet and 100mm diaoutlet.All relevant specification of item no. 3.03.a, above, shall be followed except that outlet of ‘P’ trap shall be with 100mm diainlet and 100mm dia outlet.Providing and fixing acast iron‘P’trap of self-cleansingdesignwithawatersealnotlessthan50mm,withor without vent, includingsetting the trap in 1:2:4 CC, etc., complete. The ‘P’ trap shall be with 150mm dia inlet and 150mm diaoutlet.All relevant specification of item no. 3.03.a, above, shall be followed except that outlet of ‘P’ trap shall be of 150mm dia..Providing and fixing a cast iron Nahni trap of self-cleansing design with a water seal not less than 50mm, with or without vent,including setting the trap in 1:2:4 CC, etc., complete. The Nahni trap shall be with 75mm dia.outlet.All relevant specification of item no. 3.03.a above shall be followed except that Nahni trap shall be used instead of ‘P’ trap.Providing and fixing a cast iron Nahni trap (approx 5kgs) of self-cleansing design with a water seal not less than 50mm, with orwithout vent, including setting the trap in 1:2:4 CC, etc. complete. The trap shall be with 100mm diaoutlet.All relevant specification of item no. 3.03.a above shall be followed except that Nahni trap of 100mm dia shall be used instead of ‘P’ trapwith 75mm dia outletProviding and fixing a cast iron floor trap of self-cleansing design with a water seal not less than 50mm, with or without vent,including setting the trap in 1:2:4 CC, etc., complete. The trap shall be with 100mm dia inlet and 100mm diaoutlet.All relevant specification of item no. 3.03.a, above, shall be followed except that Floor trap with 75mm dia outlet shall be used instead of‘P’ trap with 100mm dia outlet.Providing and fixing a cast iron floor trap of self-cleansing design with a water seal not less than 50mm, withorwithoutvent,includingsettingthetrapin1:2:4CC,etc.complete.Thetrapshallbewith100mmdia.All relevant specification of item no. 3.03.a, above, shall be followed except that Floor trap of 100mm dia shall be used instead of ‘P’ trapwith 75mm dia outlet.3.04.a ProvidingandfixinginpositionaStainlesssteelgrating,150mmx150mmor150mmdia/squareinsize,of Chilly make
Cat. No. SS006 or of equivalent approved make generally conforming to the drawings and fixedontheinletpipeetccompletetothesatisfactionofEIC
1.0 Materials:SSgrating shallbeofthefirstqualityofChillyorequivalent make,asapprovedbytheEngineer-in-charge.Thegratingshall be fixed on inlet of thetrap.2.0 Workmanship:The SS grating shall be fixed as and where directed. The fixing shall be carried out in best workman-likemanner. The joint between grating and the trap shall be filled in CM 1:1. The joint shall be leak proof.
3.0 Mode of Measurements andPayment:The rate shall include the cost of all materials, labour, tools, etc., required for satisfactory completion of this item asdescribed above. The rate shall be for a unit of one number.
Title – ITEM SPECIFICATION – Internal Drainage Sheet 6 OF 8
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
223
3.08.a Providing and fixing, to wall, ceiling and floor, SWR quality, heavy duty type-B PVC pipes of Supreme orequivalent make as approved by EIC,, open laid, for Soil / Waste / Rain water etc complete, with necessaryspecials, bends, such as `Y' junction, `T' junction (both single and double), including plugs, shoes, cowls, flangecompression type fittings, wall clips, in proper line and level with necessary support like split clamps of Chillymake 3 mm minimum thickness fixed with approved anchor fasteners of HILTI or Equivalent, RCC or brickpedestals or battens, if necessary, to wall, ceiling and floor, open laid complete jointing with suitable grade ofgood quality solvent cement (as recommended by the manufacturer) including testing, cutting,makinggoodthewall,ceilingandfloor,etccompletetothesatisfactionofEICofthefollowingOD
1) 230 mm, 2) 110 mm, 3) 90mm
2.0 Materials:The PVC pipe of specified dia shall conform to IS: 7834. The specials and fittings required shall be of the firstquality and UV stabilized so as to facilitate open fixation, conforming to IS: 4985 and also to relevant plumbing material specifications.Workmanship:UV stabilized PVC pipes of specified dia shall be used as directed. For thermal expansion of the PVC pipes dueallowancesabout10mmofthermalgapistobeprovidedparticularlyincaseofover-groundpipelines.Above ground installation of PVC pipe should be undertaken after precautions are observed for their protection against dirt, sun rays andmechanicaldamage.Generally, in horizontal runs, PVC pipes shall be supported at an interval of not more than 10 times the outside dia ofthe pipe. In vertical lines, PVC pipes shall be supported at an interval of 1 m to a maximum of 2 m/. Closer support spacing shall beprovided if approved by themanufacture.Manufacturer’s guidelines regarding handling, transporting, storing, laying and jointing of pipesshall be kept in view, during execution. Provision for expansion joints, air vents and proper anchorage shall bemade.PVC pipes shall be fixed on wall with clips, wooden plugs and suitablebrackets/clamps.Jointing thepipes:
1) Cutthepipeassquareaspossible.Pleaseensurethefitmentofpipesocketoffittingiscorrect.2) Totallengthofinsertionofsocketshallbemarkedonpipe(formostofthecasesthepipeinsertedshouldbeuptothemarkedlineandinnocaseshallbelessthan2/3rdofthepipeenduptothemarkedline)3) The pipe and the socket should be clean and dry. Dust, oil, water, grease etc. should be wiped out with dry clothcleaner from the surfaces to be coated with solventcement.4) Roughen the outside of the pipe and the inside of the socket using sand paper or piece of hacksaw blade up to theentry mark. Stir adhesive i.e. solvent cementthoroughly.5) Apply a thick coat of suitable grade of good quality solvent cement using a flat clean brush evenly on the inside ofthesocketmouthforfulllengthofinsertionandthenonoutsideofthepipeenduptothemarkedline.6) After application of solvent cement, insert the pipe within one minute into the socket. Hold the joint for few secondsand ensure that pipe does not come out of the fitting. Wipe off extra cement. Let it dry. Within 24 hours, your PVCpipes are ready foruse.Strength of solvent type joint depends on following factors.
a) Cleanliness/dryness of the surfaces to bebonded.b) Uniform application of solventcement.c) Avoidance of accumulation ofadhesive.d) Waiting time and setting time depending ontemperature.Threaded PVC pipe fittings shall not be over tightened, as the threads may get damaged. The pipes shall neverbe threaded but suitable threaded fittings shall be used.If any manufacturer recommends its own methods of jointing the same shall be adopted after necessary approval from theEngineer-in-charge or Architect.
Laying the pipes intrenches:The pipes shall be laid over uniform relatively soft fine grained soil, found to be free from presence of hard objects such aslarge flints, rocky projections, large tree roots etc. While laying the pipes underground, care shall be taken so that thetrench shall be as narrow as possible as required for working and its bottom shall be free of stones, sharp objects,etc.The pipes laid underground shall not be less than 1 m from the ground level. The pipe shall be positioned in thetrenches so as to avoid any induced stresses due to deflection. Any deviation required shall be obtained by usingproper type of rubber ring joints.3.0 Mode of Measurements andPayment:The relevant specifications of item no. 1.01.a, of water supply installations, shall be followed except that the PVC pipes ofspecified dia. shall be paid under this item.
The rate shall be for a unit of one RM.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
224
Title – ITEM SPECIFICATION – Internal Drainage Sheet 7 OF 8
3.08.b Providing and fixing uPVC pressure pipes of Supreme or equivalent make as approved by EIC concealedlaidhaving 6kg /cm² working pressure for Soil and Waste water, complete jointing with suitable grade of good qualitysolvent cement (supplied by the manufacturer) with necessary specials, bends, such as `Y' junction,
`T' junction (both single and double), including plugs, shoes, cowls, flange compression type fittings, wall `U' clipsof Chilly make 3mm minimum thickness fixed with approved anchor fasteners of HILTI or Equivalent, etc. andsolvent cement jointing material as specified, testing, cutting, making good the wall, ceiling andfloor,etccompletetothesatisfactionofEIC,Thepipesshallbeofthefollowingdiameter(OD):
1) 230 mm, 2) 150 mm, 3) 100 mm, 4) 80mm
The relevant specifications of item no. 3.08.a shall be followed same except that the pipe shall be concealed. Allpipes running along ceiling shall be fixed on structural adjustable brackets/clamps of special design as shown on thedrawings or as directed. Horizontal pipes shall be laid to uniform slope and the brackets/clamps adjusted to the properlevels so that the pipes fully rest on them. All pipes running along the sunken floor shall be encased in 10 cm brickwork /solid concrete blocks leaving 5cm gap all around the pipe. 5cm bedding of CM 1:2 shall be provided below the pipe.Relevant specification of civil work shall be followed for masonry / block work and mortar. Horizontal pipes in sunken floorshall be laid to uniform slope and gradient.3.09.a Providing and fixing an SWR quality, heavy duty, uPVC ‘P’ trap of Supreme or equivalent make asapprovedby EIC
Including cutting the floor and making them good with surrounding M15 CC, masonry /block supports, MSbrackets etc. testing, etc complete to the satisfaction of EIC having 110 mm inlet and 110 mm outlet.
1.0 Materials:The uPVC SWR ‘P’ trap or ‘P’ trap or Nahni trap shall be of the first quality. It shall have minimum water seal of50mm all materials shall be of 1st quality as approved by the Consultants.2.0 Workmanship:The ‘P’ trap or Nahni trap with 110mm dia inlet and 75mm dia outlet shall be fixed as per drawing or asdirected. The ‘P’ trap or Nahni trap shall be jointed with uPVC Pipe with necessary solvent cement, as per the manufacturer's instructions.The trap and waste pipes shall be set 1:2:4 ( 1 cement: 2 fine sand: 4 coarse aggregate) CC, firmly supported on thestructural floor. The concrete shall be upto 40mm below finished floor level. The contractor shall provide all necessaryshuttering and centering for the concrete. Size of the concrete block shall be 30 x 30 cm and of required depth.3.0 Mode of Measurements andPayment:The rates shall be inclusive of the cost of all materials, labours tools and plants, etc., required for the satisfactorycompletion of this item, including jointing and testing.Therateshallbeforaunitofonenumber.
Providing and fixing an SWR quality, heavy duty, uPVC Nahni trap of Supreme or equivalent make as approvedbyEICIncludingcuttingthefloorandmakingthemgoodwithsurroundingM15CC,masonry/block supports, MS brackets etc. testing,etc complete to the satisfaction of EIC having 110 mm inlet and 110 mm outlet.All relevant specifications of the item no. 3.09.a, except the change in the size, shall be followed.
Providing and fixing a Stainless steel (Grade 316) AMUL TRAP of 230 mm internal dia. as approved by EIC, Including cuttingthe floor and making them good with surrounding M20 CC, masonry/ block supports, MS brackets etc. testing, etc complete tothe satisfaction ofEIC.The rate shall be for a unit of one number.
Providing and fixing a Stainless steel (Grade 316) AMUL TRAP of 150 mm internal dia. as approved by EIC, Including cuttingthe floor and making them good with surrounding M20 CC, masonry/ block supports, MS brackets etc. testing, etc complete tothe satisfaction ofEIC.
The rate shall be for a unit of one number.
3.10Supplyandfixingofstainlesssteelmosquitoproofjaliwithrequiredfittingsforoverflowpipeofoverheadtankaspertherequire
mentanddrawingsetccompletetothesatisfactionofEIC
The rate shall be for a unit of one number.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh,marya.Indore M.P on turnkey basis.
225
Title – ITEM SPECIFICATION – Internal DrainageSheet 8 OF 8
4.01.a Providing and laying salt-glazed stoneware pipes of 230 mm diameter (to the line, level andslopes)andjointingwithstiffmixtureofCM1:1,depthupto1.5m.,includingtestingofpipesandjoints,etc.,complete.
1.0 Materials:Water and Cement mortar of proportion 1:1 shall conform to relevant civil material specifications. 230 mm dia.Glazed stoneware pipe shall conform to relevant plumbing-material specifications. All materials shall be of the 1st quality of approved makeor equivalent as approved by the Consultants.Workmanship:The relevant specification of item no. 1.02.a shall be followed except that stoneware pipe of 230 mm dia shall be laid.Laying:The pipes shall be laid accurately and perfectly true to line, levels and gradients. Care shall be taken to prevent sand, etc., fromentering the pipes. The pipes between 2 manholes shall be laid truly in a straight line without vertical or horizontal undulation. All junctionsand changes in direction and diameter shall be made inside manholes by means of curved tapered channels formed in CC finished smoothand benched on both sides. All along its length, body of the pipe shall rest on an even level bed having grips to receive sockets of the pipes.All inverts shall be laid from sight rails fixed at the true levels, with proper boning rods. The pipes shall be laid, sockets facing up, thegradient beginning at the lower end and with the socket resting in the socket holes cut in the concrete bed, if specified. Each pipe shall belaid singly, and no pipe shall be laid until the trench has been excavated to the required depth for a distance of 20 m in front of the pipe tobe laid. For excavation relevant specification of civil item shall be followed.Jointing:Ineachjoint,agasketoftarredyarnshallbepavedroundthejointandinsertedinitbymeansofsuitablejointingtools. More strains of yarnshall be added and well rammed home. The yarn will be moistened to avoid absorbing water fromthemixedcementmortar.PortlandCM1:1shallbefilledinthejoint,asdescribedhereunder:The cement mortar paste shall be carefully inserted into the joint by hand and shall be caulked into the joint with wooden caulking tools.More cement shall be added until the space of the joint has been filled completely with tightly caulked cement mortar paste and finished asdirected. Depths of yarn and cement mortar paste for different sizes of pipes joints are given below. All dimensions are in mm----------------------------------------------------------------------------------------------------------------------------Internal Depthof Depth Depth ofcementdiaofpipe socket yarn mortarpaste----------------------------------------------------------------------------------------------------------------------------100 50 22 28150 60 28 32230 65 32 32----------------------------------------------------------------------------------------------------------------------------
Testing:(1) Testing shall be done totally at the Contractor's expense inclusive of apparatus, provision of water,etc.(2) After the cement mortar has set, the pipes shall be tested in length between manholes. In the lowest manhole, a plugshall be inserted. At the upper manhole, a circular disc to fit exactly the inside diameter of the pipe with a filling pipewith a right angle bend and an air cock shall be fixed. The length of the pipes shall then be filled with water by meansof pipe connection on the upper disc. The air cock in the upper disc shall be kept open while the pipe line is being filled,to permit the escape of air. When the pipes have been filled with water and air released, theaircockshallbeshutandwatershallbepouredintoaconicalfillerattachedtothefillingtubeofthediscinthe upper manhole until the water remains inthe filler. The filling level in the filler shall be about 1.5 m above the invert level of the highest pipe in that stretch. Atolerance of leakage of 2 litres/cm dia of the drain for 1 Km length may be allowed during a period of 10 minutes only.If it is found that certain pipe joints are leaking, the water shall bedrainedoffandthejointsre-caulked.(3) After the joints and pipes have been proved to be water tight, they shall be bedded or enveloped in CC, if specified, tothe extent necessary. Refilling shall be done with finest selected material and shall be doneinlayers,aspertherelevantspecificationofcivilitem.
3.0 Mode of Measurements andPayment:The work of preparing the trench bed to fit the lower part of the pipe and `Grips' left to take socket, collars, etc., shallbeincludedintherateoflayingthepipes.hemeasurementsshallbenetwithoutanyallowanceforcuttingandwaste. The length of bends, junctionsand other connections shall be included in the total length of the drain pipes. Nothing extra shall be paid for the same. The necessary civilwork like, excavation, refilling trenches, formwork, B.B.C.C, etc., shall be carried out, measured and paid as per relevant items of civil works.The rate shall be for a unit of one RM.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
226
Title – ITEM SPECIFICATION – External Drainage Sheet 2 OF 6
4.01.b Providing and laying salt glazed stone-ware pipes of 150 mm diameter (to level and slopes)andjointingwithstiffmixtureofCM1:1,upto1.5mdepthincludingtestingofpipesandjoints,etc.,complete.
1.0 Materials andWorkmanship:The relevant specification of item no. 4.01.a.1 shall be followed except that the pipe shallbe of 150 mm dia.3.0 Mode of Measurements andPayment:The relevant specification of item no. 4.01.a.1 shall be followed. The rate shall befor a unit of one RM.4.01.c.1 Providing and laying salt glazed stone-ware pipes of 100 mm diameter (to level and slopes)
andjointingwithstiffmixtureofCM1:1,upto1.5mdepthincludingtestingofpipesandjoints,etc.,complete.
1.0 Materials andWorkmanship:The relevant specification of item no. 4.01.a.1 shall be followed except that the pipe shallbe of 100 mm dia.3.0 Mode of Measurements andPayment:The relevant specification of item no. 4.01.a.1 shall be followed. The rate shall befor a unit of one RM.4.03.a Providing and fixing a salt-glazed stoneware gully trap, class `A', of 100 mm dia inlet and 100 mmoutlet,withCI
grating at top, etc.,complete.
1.0 Materials:Water and Cement mortar of proportion 1:5 shall conform to relevant civil material specifications. The SW Gullytrap of 100 mm x 100 mm size shall conform to relevant plumbing material specifications.Workmanship:Excavation for gully trap shall be done true to dimensions and levels as indicated on plans or as directed. The excavationwork shall generally be done as per relevant civilspecifications.Fixing: The gully trap shall be fixed over CC 1:2:4 (1 cement: 2 sand: 4 coarse aggregate) foundation, 100 mm thick. The jointing of gullytrap outlet to the branch drain shall be done similar to the jointing of SW pipe, as described in the item of externaldrainage.Brick masonry chamber: After fixing and testing the gully trap and branch drain, a brick masonry chamber, size 300 x 300 mm clearinside, with 230 mm thick brick work in CM 1:5 (1 cement:5 sand) shall be built round the gully trap from the top of the bed concreteupto ground level. The space between the chamber walls and the trap shall be filled with CC 1:2:4. Inside, outside and all exposed surfacesof the chamber shall be plastered with CM 1:3 (1 cement: 3sand)andfinishedwithfloatingcoatofneatcement.Thecornersandbottomofthechambershallberoundedofsoas to slope towards the grating.Relevant civil specifications shall be followed respectively for masonry andplaster work.CI cover with frame of specified size shall then befixed on the top of the brick masonry as per the detail specification of relevant plumbing item no.4.17.a.Mode of Measurements andPayment:The rate includes cost of all labour, material, tools, plants, etc., required for the satisfactorycompletion of this item as describedabove.The necessary civil work like; excavation, CC 1:2:4, brick masonry, plastering etc., shall bcarriedout, measured and paid as per relevant items ofcivilworksC.Icoverwithframeshallbemeasuredandpaidaspertherelevantplumbingitemno.4.17.aTherateshallbeforaunitofonenumber.4.03.b Providing and fixing a salt-glazed stoneware gully trap, class `A' of 150 mm dia inlet and 100 mm outlet withCI
grating at the top, etc.,complete.The relevant specifications of item no. 4.03.a shall be followed except that the inlet shall be 150 mm instead of 100 mm.4.03.b.1 Providing and fixing a salt-glazed stoneware gully trap, class `A' of 230 mm dia inlet and 150 mm outlet withCI
grating at the top, etc.,complete.The relevant specifications of item no. 4.03.a shall be followed except that the inletshall be 150 mm instead of 100 mm.4.05. a.1 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 500 mm internal diameter at
a depth up to 1.5 m and joining with collars and butt-ends prepared for collar joints, including filling the jointswith CM 1:1 and testing them etc., complete to the satisfaction of EIC, The rates shall be excluding the cost ofexcavation, filling of trenches, PCC, concrete cradles which shall be measured and paid separately in the relevanttender items of civilworks).
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
227
Title – ITEM SPECIFICATION – External Drainage Sheet 3 OF 6
1.0 Materials:The reinforced concrete non-pressure pipes of specified diameter shall confirm to the relevant IS: 458. Cementmortar shall conform to relevant civil material specifications. All materials shall be of the 1st quality of the approved make or equivalent asapproved by the Consultants.Workmanship:The relevant specification of item no. 4.01.a.1, above, shall be followed except that the reinforced concrete pipes of specifieddiameter shall belaid.Laying of RCC spunpipes:No pipes shall be laid till the drain and its levels and gradients carefully checked and tested and found correctby the Engineer-in-charge.For excavation and refilling of trenches relevant civil specifications shall be followed respectively. After theconcrete cradles have been laid properly, where specified in the schedule, RCC spun pipes shall be lowered gradually into the trenches overthe concrete cradle or bed. Holes for collars shall be made at every joint. These holes shall be made depending upon the particular lengthof the pipe being laid. The pipes shall be leveled properly to the required slope and gradient. The pipe drain shall rest on the bed at everypoint throughout its length. To ensure this, the space between the under side of the pipes and the invert of the cradle shall be carefullygrouted solid with thin cement slurry consisting of 1 cement: 3 clean washed sand, in such a manner that no voids shall be left. This is toensure that the load of the pipes and the superimposed load of the earth filling shall be evenly distributed on the cradle or on firm groundon which the pipe is resting.All precautions shall be taken to the full satisfaction of the Architect/Consultants and the pipes shall be gradually lowered on the cradle oron firm ground. After the alignment of pipes is checked by the authorized representative of the Client, the grouting shall be done withoutany extra charges by the Contractor. The cradle of concrete shall be allowed to set atleast for 3 days, before any pipes are placed in it andthe contractor shall take due care in setting the pipe in the cradle so that no damage to the cradles shall occur. If any damage to the cradleoccurs, it shall be rectified to the satisfaction of the Engineer-in-charge and in any particular case where the damage, in the opinion of theEngineer-in-charge has adversely affected the structural strength of the cradle. The Contractor shall remove the damaged section of thecradle and replace it at his own expenses, to the complete satisfaction of the Engineer-in-charge.Joints:The joints for the pipes shall be made by loose collars and the connecting space shall be as minimum as possible. The collarsshall be specially roughened inside to provide a better grip.Two adjacent pipe ends when butted together concentrically, a dowel will beleft between the two ends. In this dowel, CM 1:1 or collar shall then be adjusted over the pipe so that its ends are equidistant from the pipeends and is concentric with the pipe. The space between the collar and the outer barrel of the pipe can then be caulked with bitumensoaked hemp yarn in layers atleast upto 50 mm (and not exceeding 80 mm) from the joint on its either side.The remaining space oneither side of the joint upto the collar shall then be caulked with a stiff mix of CM 1:1. Every joint shall be finished smooth at an angle of 45Owiththe longitudinal axis of the pipe on either side of the collars.The interior of the pipe drains shall be cleaned off of all dirt, loosemortar and superfluous materials, after jointing.Curing:Every joint shall be kept wet for about 10 days for maturing. The section of the pipe line laid and joined shall be coveredimmediately to protect from weather effects.The joints shall be left exposed for observation.Testing of RCC spunpipes:After joints have been allowed to settle sufficiently, the pipe shall be tested under a head of atleast 0.6 m abovethe top of the highest pipe in the stretch and in no case under a head greater than 6 m of water column at the highest level.Any defectsfound in the joints shall be immediately rectified or redone and any pipe which is found to be leaking shall be removed and replaced. Thedefective pipe shall be removed from the site immediately, thereafter.Mode of Measurements andPayment:TherelevantspecificationofitemNo.4.01.a.1shallbe followedexceptthattherateincludesforlayingtolevelorslopeintrenchesonRCCcradle,ifrequiredetc.,complete,includingmakingthejointsandtestingasindicated.(RCCcradleshallbemeasuredandpaidforseparatelyunderrespectiveitemoftenderforcivilworks.)The measurement shall be net without any allowance for cutting and waste. The length of bends, junctions and other connections(measured along the centre line) shall be included in the total length of the pipes, connections being numbered afterwards and paid forextra overpipes.The size of bends, junctions etc., shall suit to the size of the pipe. The bore (internal diameter of pipe) shall be the criterionfor payment. The relevant civil items like excavation, refilling etc., shall be carried out, measured and paid as per relevant items of tenderfor civilworks.Nothingextrashallbepaidseparatelyfortheuseofmechanicalappliances,wherenecessary.TherateshallbeforaunitofoneRM.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
228
Title – ITEM SPECIFICATION – External Drainage Sheet 4 OF 6
4.05. a.2 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 500 mm internal diameteron RCC cradle if specified (to the level and slope) and jointing at a depth from 1.5 m to 3 m with collars andbutt-ends prepared for collar joints, including filling the joints with CM 1:1 and testing them etc.,complete(RCCcradleshallbemeasuredandpaidintherelevantitemsoftenderforcivilworks.)All relevant specification of item no. 4.05.a.1 shall be followed except that pipe shall be laid in trench of depth 1.5 m to 3 m.
4.05. a.3 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 900 mm internal diameterat a depth from 1.5 m to 3 m and joining with collars and butt-ends prepared for collar joints, including fillingthe joints with CM 1:1 and testing them etc., complete to the satisfaction of EIC, The rates shall be excluding thecost of excavation, filling of trenches, PCC, concrete cradles which shall be measured and paid separately in therelevant tender items ofcivil works).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 900 mm dia shall be laid in trench ofdepth 1.5 m to 3 m.
4.05. a.4 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 600 mm internal diameterat a depth upto 1.5 m and joining with collars and butt-ends prepared for collar joints, including filling the jointswith CM 1:1 and testing them etc., complete to the satisfaction of EIC, The rates shall be excluding the cost ofexcavation, filling of trenches, PCC, concrete cradles which shall be measured and paid separately in the relevanttender items of civilworks).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 600 mm dia shall be laid in trench ofdepth up to1.5 m.
4.05. a.5 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 600 mm internal diameterat a depth from 1.5 m to 3 m and joining with collars and butt-ends prepared for collar joints, including fillingthe joints with CM 1:1 and testing them etc., complete to the satisfaction of EIC, The rates shall be excluding thecost of excavation, filling of trenches, PCC, concrete cradles which shall be measured and paid separately in therelevant tender items ofcivil works).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 600 mm dia shall be laid in trench ofdepth 1.5 m to 3 m.
Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 450 mm internal diameter at a depthup to 1.5 m and jointing with collars and butt-ends prepared for collar joints, including filling the joints with CM 1:1 andtesting of joints, etc complete to the satisfaction of EIC, The rates shall be excluding the cost of excavation, filling of trenches,PCC, concrete cradles which shall be measured and paid separately in the relevant tender items of civilworks).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 450 mm dia shall be laid in trench of depth up to 1.5 m.Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 450 mm internal diameter at a depthfrom 1.5 m to 3.0 m and jointing with collars and butt-ends prepared for collar joints, including filling the joints with CM 1:1and testing of joints, etc complete to the satisfaction of EIC, The rates shall be excluding the cost of excavation, filling oftrenches, PCC, concrete cradles which shall be measured and paid separately in the relevant tender items ofcivil works).Allrelevant specification of item no. 4.05.a.1 shall be followed except that pipe of 450 mm dia shall be laid in trench of depth 1.5 m to 3 m.
4.05. c.1 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 300 mminternal diameteratadepthupto1.5mandjointingwithcollarsandbutt-endspreparedforcollarjoints,includingfilling the joints with CM 1:1 and testing of joints, etc complete to the satisfaction of EIC, The rates shall beexcluding the cost of excavation, filling of trenches, PCC, concrete cradles which shall be measured and paidseparately in the relevant tender items of civil works).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 300 mm dia shall be laid upto adepth of 1.5 m.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
229
Title – ITEM SPECIFICATION – External Drainage Sheet 5 OF 6
4.05. c.2Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 300 mm internal diameter at adepth from 1.5 m to 3 m and jointing with collars and butt-ends prepared for collar joints, including filling the joints with CM 1:1and testing of joints, etc complete to the satisfaction of EIC, The rates shall be excluding the cost of excavation, filling of trenches,PCC, concrete cradles which shall be measured and paid separately in the relevant tender items ofcivil works).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 300 mm dia shall be laid in trench of depth 1.5 m to 3 m.4.05. c.3 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 300 mm internal diameter at a
depth from 3 m to 5 m and jointing with collars and butt-ends prepared for collar joints, including filling the jointswith CM 1:1 and testing of joints, etc complete to the satisfaction of EIC, The rates shall be excluding the cost ofexcavation, filling of trenches, PCC, concrete cradles which shall be measured and paid separately in the relevanttender items ofcivil works).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 300 mm dia shall be laid in trench of depth 3 m to 5 m.
4.05. d.1 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 230 mm internal diameter at adepth up to 1.5 m and jointing with collars and butt-ends prepared for collar joints, including filling the joints withCM 1:1 and testing of joints, etc complete to the satisfaction of EIC, The rates shall be excluding the cost ofexcavation, filling of trenches, PCC, concrete cradles which shall be measured and paid separately in the relevanttender items of civilworks).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 230 mm dia shall be laid upto a depth of 1.5 m.
Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 230 mm internal diameter at a depth from1.5 m to 3 m and jointing with collars and butt-ends prepared for collar joints, including filling the joints with CM 1:1 and testingof joints, etc complete to the satisfaction of EIC, The rates shall be excluding the cost of excavation, filling of trenches, PCC,concrete cradles which shall be measured and paid separately in the relevant tender items ofcivil works).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 230 mm dia. shall be laid in trench of depth 1.5 m. to 3 m.Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 230 mm internal diameter at a depth from3 m to 5 m and jointing with collars and butt-ends prepared for collar joints, including filling the joints with CM 1:1 and testingof joints, etc complete to the satisfaction of EIC, The rates shall be excluding the cost of excavation, filling of trenches, PCC,concrete cradles which shall be measured and paid separately in the relevant tender items ofcivil works).All relevant specification of item no. 4.05.a.1 shall be followed except that pipe of 230 mm dia. shall be laid in trench of depth 3 m. to 5 m.4.05.e.1 Providing and laying in trench reinforced concrete non-pressure IS class NP-3 pipes of 150 mm internal diameter up to
1.5 m depth jointing with collars and butt-ends prepared for collar joints, including filling the joints with CM 1:1and testing of joints, etc complete to the satisfaction of EIC, The rates shall be excluding the cost of excavation,filling of trenches, PCC, concrete cradles which shall be measured and paid separately in the relevant tender itemsof civilworks).All relevant specification of item no. 4.05.a.1 shall be followed except that diameter of the pipe shall be 150 mm4.06.b.1 Providingandfixingacastirongratingframeandcoverofspecifiedclearsize,shapeandweightofNECOmakeincluding carting from store to site of work, fixing in CC and finishing with 3 coats of anti-corrosive paint etccomplete to the satisfaction of EIC.
Machine operation : All function of the machine shall be controlled using Cam timer switches and themachine is to be mechanical Cams operated.CIP Cleaning of Machine: The machine shall be built suitable for in line Cleaning in place from a centralsystem. The float balance tank shall be capable of withstanding the average pressure of 3.5 bar – 85 deg C ofthe CIP solution. The filling nozzle shall have a CIP solution collection cup.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari Dugdha Sangh, marya.IndoreM.P on turnkey basis.
230
Title – ITEM SPECIFICATION – External Drainage Sheet 6 OF 6
1.0 Materials:Grating frame and CI cover shall conform to IS:1726. All materials shall be of first quality of approved make orequivalent as approved by the Consultants.2.0 Workmanship:CI cover with frame of specified size, shape and weight, shall than be fixed on the top of the brick masonrywith CC 1:2:4 (1 cement:2 coarse sand:4 graded stone aggregate 20 mm nominal size), 40 mm thick and rendered smooth. The finished topof the cover shall be finished as per the details, specified in the drawing. All CI items shall be painted in 3 coats with approved bitumasticpaint.3.0 Mode of Measurements andPayment:The rate shall be for a unit of one kg.4.09 Providingandfixing,CIstepsinmanhole,watertank,septictank,etc.,ofsize385mmx150mmx25mmand
paintingwith3coatsofanti-corrosivepaint,etccompletetothesatisfactionofEIC(NECOmake)
1.0 Materials:The CI steps of size 500 x 150 x 22.5 mm, shall conform to IS:5455. Paint and cement mortar shall conform torelevant civil material specifications.2.0 Workmanship:The CI steps of size 500 x 150 x 22.5 mm, shall be fixed in manhole and such other similar structures, as andwhere directed. The steps shall be staggered in vertical run, 300 mm apart and horizontally 380 mm apart. The top step shall be 450 mmbelow the manhole cover and lowest not more than 300 mm above the benching. The steps shall be embedded in wall of manhole, etc. withCC 1:3:6 or cast in-situ upto 200 mm depth and the surface shall be finished with cement plaster 15 mm thick, in CM 1:5. The steps shall bepainted with 3 coats of anti-corrosive paint.3.0 Mode of Measurements andPayment:The rate includes all labours, materials, tools and plants, etc., required for thesatisfactory completion of this item. The rate shall be for a unit of one number.4.10 Providing, laying and Installation of SS Soccer drain of SS 304 Grade (Size of the drain shall be300mmwidth X 100
mm) and the thickness of SS is 2 mm thk. at all floors, all heights, in any position, etc. complete, as directed byArchitects and Engineer- in-charge.
1.0 Mode of Measurements andPayment:The rate includes all labours, materials, tools and plants, etc., required for thesatisfactory completion of this item. The rate shall be for a unit of one RMT.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
231
Part C – Bill ofQuantitiesCivil construction work, ETP, Sanitary plumbing and Drainage.
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
232
Bill of Quantities of Civil work For Civil construction workAt Dairy plant Khandawa under Indore Sahakari
DugdhaSangh Maryadit Indore (M.P.)SECTION-A
Note:- Bidder may add further items if he feels the requirement over and above BOQ givenbelow
S.N.
DESCRIPTION OF ITEMUNIT
QUANTITY
1 Earth work in Excavation by mechanical means (hydraulicexcavator) or by manual means for foundation trenches inall kind of soil and moorum Not exceeding 2.0 m in widthor 10sqm on plan including dressing of sides and rammingof bottom and disposal of surplus excavated soil asdirected, within a lead of 50m as per specification
Cum 552.28
2 Earth filling in foundation trenches including dressing ofside and ramming & watering etc complete. as perspecification
Cum 692.70
3 Moorum filling in plinth including dressing of side andramming & watering etc complete. as per specification
Cum 576.87
4 Providing and laying plain cement concrete(P.C.C.) ofspecified grade below foundation footings and U.G. tankswith 40 mm nominal size graded aggregate M-10(1:3:6)including cost of centering and shuttering - all work up toplinth level as per specification
Cum 27.81
5 Reinforced cement concrete work (any thickness) includingfootings , buttress, plinth and string courses fillets, column,pillars, posts and strutssuspended floors, roof slab , beams, staircase, chajjas,loftsetc up to 6.75 m height including the cost of centering ,shuttering ,finishing in concrete grade M-20 grade nominalMix(with 20mm nominal size stone aggregate) as perspecification
Cum 419.14
6 Reinforcement (Fe 415) for RCC work includingstraightening, cutting bending placing in position and
Kg 24895.0
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
233
binding including cost of binding wire up to floor two levelincluding all wastage etc complete thermo mechanicallytreated bars (TMT) as per specification
7 Providing 8”/ 4” thick brick masonry in ground floor walls,water tanks, septic tanks in 1:4 mortars. Joints of brickMasonry shall not exceed 12 mm thickness. Bricks shall bekept wet for 24 hours before application. Masonry shouldbe in line and plumb and faces shall be smooth and leveled.as per specification
Cum 280.50
8 Providing two coats of cement plaster of 25 mm thicknessto all walls and concrete work in cement mortar 1:6, bothinternally and externally up to 7.50 m height includingcuring, making grooves etc. complete as per specification
Sqm 4276.00
9 Providing two coats of synthetic enamel paint of ISI gradeover two coats of cement putty to all internal plasteredsurfaces as per specification
Sqm 2676.00
10 Providing and applying two coats of external gradesynthetic paint ISI marked paint to all external surfaces asper specification
Sqm 1600.00
11 Providing structural steel- roof truss and purlins for boilerand godown shed areas in hollow square M.S. pipeincluding cutting, bending, welding and erection of trussesat specified height including accessories and fittingscomplete as per specification
Kg 2850.00
12 SupplyofBareZincalume/GalvalumeRoofingorcladdingsheets made out of 0.5 mm , 550 MPA yield stress andhaving coating grade AZ-150 confirming to ACTM1397. the sheet. The sheet shall be fixed with SDSTscrew confirming to grade-1 to be fixed on the crest ofthe rib the screw shall be have integral EPDM washerfor cladding sheets. SDST screw shall be fixed in thevalley near the rib. Each rich / valley shall be fixed withSDST screw every purlin. The overlaps in the lengthshall be applied with one raw of silicon sealant (exteriorgrade-glass to metal grade) lining. The accessories likeridge shall be fixed with SDST screws and gap betweenridges and shall be close with turn bend of the ridge. Thesheet below ridge shall be turn up to avoid leakage.There should be anti capillary flute on side overlapping
Sqm 251.00
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
234
endandeachsheetshallhavemale&femaleribsforoverlapping
13 Providing and fixing in position, 25 to 38 mm. thickacid and alkali resisting Red Mandana stone ofapproved size and shape, for flooring, skirting and dado,including two coats of acid and alkali preventive primer,fixing on average 37 mm. thick cement mortar bedding1:3 (1 part of cement and 3 part ofcoarse sand) with acidproof powder, keeping the joints 6 mm. to 10 mm. wideall around and filling the same with epoxy resin andhardener, including hand/machine polishing, waxpolishing etc. complete, asdirected.
Sqm 365.87
14 Providing & laying 25 mm. thick green polished kotahof approved quality, selected and sorted for uniformcolour, in floor, otta, sill, skirting, dado etc., in requiredsizes up to 60 cm. and as per design with normal pattern(square, rectangular) as per drawings, including cementmortar 1:6 bedding of required thickness, joints &pointing as specified,
Sqm 65.00
15 Providing and fixing in position 300mm x 450mm glazedceramic standard tiles dado in all internal factory walls upto 1.20 m height including joint finishing with chemicalfillers and washing with oxalic acid complete as perspecification
Sqm 214.00
16 Providing and laying 60mm thick factory made cementconcrete interlocking paver block of M ‐30 grade made byblock making machine with strong vibratory compactionand of approved size and design/ shape laid in requiredcolour and pattern over and including 50mm thickcompacted bed of course sand, filling the joints with coarsesand etc. all complete as per the specification (in hard parkarea)
Sqm 78.75
17 Providing and fixing in position3 track powder coated Aluminum section windows ininternal walls including 4 mm thick float glass, hold fastand fixtures. Locks etc. complete as per specification
Sqm 51.84
18 Providing and fixing double leaf aluminium door shutterswith teak ply up to .9M height and 4mm glass up to 2.4Mheight as per drawing with all fixture and fittings and locksetc complete including cost of aluminium door frames asper specification
Sqm 35.52
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
235
19 Providing pre construction anti termite treatment atdifferent stages of constructions as per detailedspecification through contractor’s (specialized in this fieldand approved by architect) in all excavations of buildingand in back filling, plinth filling at all levels with sprayingmethod and shall also include for treatment to all buildingas per direction. as per specification
Sqm 495.87
20 Providing and laying cement water proofing ofaverage 125mm thick for terrace slabs usingcement slurry & waterproofing chemical aftercleaning, arranging brick bats in cement mortar1:5,according to the slope, adding suitable chemicalfor water- tightness and again after 3 days pondingwith water and testing same, providing on topcement mortar 1:3 including addition ofwaterproofing compound and finishing the top withneat cement@ 2.75 kg/m2 and as per direction and instructions,complete at all levels and floors, including furnishing aguarantee bond for 10 years. The work should be carriedout through an approved specialized agency like IndiaWater Proofing Co. or equivalent. (Wall to wallmeasurement will be considered only)
Sqm 495.87
SECTION-B (ROAD WORK)S.N. DESCRIPTION OF ITEM
UNITQUANTITY
1 Box cutting the road surface, to proper slope and camber, formaking a base for road work, including rolling, removing theexcavated stuff and depositing on road side etc. complete, asdirected up to 100 m lead
cum 417.252 Filling, under RCC road with murrum or selected soilobtained from outside (Contractor's earth) in layers of 15cm. thickness, including watering, ramming well andconsolidating etc.complete, as directed. Rolling with 8-10T rollers shall be done to achieve the necessary CBR value
cum 256.75
3 Providing and laying C.C. 1:4:8 (1 cement : 4 coarse sand: 8 graded stone aggregate 40 mm. nominal size) and cum 42.79
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
236
curing etc. complete, excluding the cost of formwork4 Providing and laying controlled 150mm thk. C.C. M-25for road with vacuum dewatering method for the RCC withbroom finish or with power driven towel finish surface ofthe concrete,with 100 mm thk PCC (1:4:8) and curingcomplete.The rate shall be including groove made of 3mmwidth and 25 mm depth as shown in the drawing .Thegrooving operation should be carried out as soon asconcrete is ready to accept the saw cut withouttrowellingetc as directed by Engineer-in-charge.The rate shall beinclusive of labour,material and machinery cost &excluding the cost offormwork&reinforcement,sameshallbepaidinrelevantitem.
cum 64.20
6 Providing and laying Precast Kerb size (Size-
300x500x150 )- vyra make near side of road. The PCC1:3:6 under kerb stone shall be done as directed, and itshall be paid in relevant item. The work of the curb blocksshall be executed in line and level & shall be re-laid ifnecessary,joint shall be filled up with mortar 1:3.
Rmt 110.00
SECTION-C (SANITATION, PLUMBING & DRAINAGE WORK)S.N.
DESCRIPTION OF ITEMUNIT QUAN
TITY1 Providing and fixing Galvanised Iron (GI) (Medium
grade ClassB) pipe supported on wall or floor of Tata orequivalent make, conforming to IS: 1239, including tubefittings such as sockets, unions, reducers, long or shortbends, elbows,nipple,flanges,check-nuts, tees, etc.complete (in proper line and level, with necessary zarimaking, supports viz., clamps, RCC or brick masonrypedestals and battens, if required) jointing with screwjoints, using hold tight and jute for pipes and Teflon tapefor fittings and fixtures, to wall, ceiling and floorincluding making them good, testing and painting with 2coats of black japan paint etc., complete of the followingnominal bore (NB)size:
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
237
1) 25 mm Rmt. 502) 15 mm Rmt. 302 Providing and fixing 50mm flanged mount CI sluicevalve of approved make with GM seats, high tensilebrass spindle with cap, conformingtostandardwater-workspatternandflangesasperIS: 15381, flat facedand drilled, complete with accessories of thefollowing pipe dia:
Nos. 4
3 Providing and fixing white glazed vitreous chinawarewall hung type European WC pan integrated 'P' or 'S'trap with or without vent (HUNDUSTAN Sanitaryware EWC or CERA or equivalent) with concealedpipes M.S. chair brackets including heavy duty plastictoilet sheet, jet spray and other accessories etc.completeas directed
Nos. 2
4 Providing and fixing white glazed vitreous chinawash basin of size 550 x 400 mm with central taphole (Hindustan Sanitaryware No. 10016 or Cera orequivalent) counter type without rim, Swan Neck ofJaquar or equi. Make C. P. brass pillar cock 15 mmhaving minimum weight 525 grams 32 mm dia C. P.brass bottle trap with brass union and C. P. brass walldischarge pipe with flange sand cap, 32mmdiaG.I.waste pipe with fittings up to floor trap, 32 mmdia C. P. brass waste couplin with C. P. chain andrubber plug. 15 mm dia C. P. brass stop valves havingminimum weight 400 gms 15 mm heavy qualityflexible P.V.C. inlet connection of required length withbrass union, washer and C. P. brass cap complete inall respects including cutting and makinggoodthewalls, RCC work and floor setc. Comple te asdirected
Nos. 4
5 Providing and fixing sand cast iron Nahni trap of selfcleansing design with or without vent arm, leadcaulked joint with refined pig lead caulked joint withrefined pig lead and spun yarn in the sockets of H.C.I.Nos. 3
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
238
pipe and fittings with 150 x 150 mm diastainless steelgrating including boxing the trap with 150 mm thickcement concrete 1 : 2 : 4 ( 1 cement : 2 coarse sand : 4stone ballast 20 mm and down guage) includingcutting and making good the walls. R.C.C. work floorsetc. wherever required. 100mm dia inlet and6 Providing and fixing screw down brass chromiumplated heavy quality bib-taps of approved make onwater supply pipe lines of 15mm dia with or withoutextension piece but with a flange, as approved by thearchitects etc complete
No. 6
7 Providingandfixing15mmNBCPbrassheavyqualitywallor floor mounted sink tap, swivelling type, with CPwall flange, casted spout. No. 68 Providing and fixing underground or below floor,
high density Polyethylene (HDPE) pipes (for watersupply/drainage purpose) and all type of fittingsreadymade or fabricated, including jointing using buttwelding, testing, etc. complete, with a workingpressure of 6 Kg/m2. (Earthwork and filling shall bepaid extra.)200 mm OD rmt 10150 mm OD rmt 10
9 Constructing 600 x 600 x600 sizes manholes (insidedimension). The rate includes excavation, 150 mmthick BBCC 1:4:8 in foundation230 mm wide brick masonry walls in CM 1:6, 12 mmthick plastering in inside and outside of chamber inCM 1:4, channels, IPS flooring, making drain channel,CI/MS rungs with paint,steps, CI cover with frame450 mm dia. Weighing 80 Kgs. painting the cover andframe with two coats of coal tar, and 150 mm thickRCC 1:2:4 slab with standard reinforcement etc.complete
No. 10
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
239
10 Providing and Fixing 5000 Ltr Capacity Sintex makePVC tank including necessary inlet and outletconnections and placing at any height etc.completeasdirected
Nos. 2
11 Providing and fixing S.S.(grade 316) Amul Trap of100mm internal dia including floor cutting, concretesealing, masonary , brackets etc. testing etc. complete
Nos. 1212 Providing and installing precast RCC septic tank of100 person capacity of approved make likeGarud/Alcock or equivalentincludingnecessaryexcavation,basecourse,refilling,inlet-outlet connections, placing in line & level, etc.complete and installation as per manufacturer'sspecifications / as directed by EIC
Nos. 1
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
240
SECTION-D (BOUNDARY WALL WORK-350 RMT.)
S.N.
DESCRIPTION OF ITEMUNIT
QUANTITY
1 Earth work in Excavation by mechanical means (hydraulicexcavator) or by manual means for foundation trenches inall kind of soil and moorum Not exceeding 2.0 m in widthor 10sqm on plan including dressing of sides and rammingof bottom and disposal of surplus excavated soil asdirected, within a lead of 50m as per specification
Cum 482.00
2 Earth filling in foundation trenches including dressing ofside and ramming & watering etc complete. as perspecification
Cum 403.00
3 Providing and laying plain cement concrete(P.C.C.) ofspecified grade below foundation footings and U.G. tankswith 40 mm nominal size graded aggregate M-10(1:3:6)including cost of centering and shuttering - all work up toplinth level as per specification
Cum 33.00
5 Reinforced cement concrete work (any thickness) includingfootings , buttress, plinth and string courses fillets, column,pillars, posts and strutssuspended floors, roof slab , beams, staircase, chajjas,loftsetc up to 6.75 m height including the cost of centering ,shuttering ,finishing in concrete grade M-20 grade nominalMix(with 20mm nominal size stone aggregate) as perspecification
Cum 143.00
6 Reinforcement (Fe 415) for RCC work includingstraightening, cutting bending placing in position andbinding including cost of binding wire up to floor two levelincluding all wastage etc complete thermo mechanicallytreated bars (TMT) as per specification
Kg 7950.0
7 Providing 8”/ 4” thick brick masonry in 1:4 mortars. Jointsof brick Masonry shall not exceed 12 mm thickness.Bricks shall be kept wet for 24 hours before application.Masonry should be in line and plumb and faces shall besmooth and leveled. as per specification
Cum 147.00
8 Providing two coats of cement plaster of 25 mm thicknessto all walls and concrete work in cement mortar 1:6, bothinternally and externally up to 7.50 m height including
Sqm 1540.00
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
241
curing, making grooves etc. complete as per specification
9 Providing two coats of synthetic enamel paint of ISI gradeto all plastered surfaces as per specification
Sqm 1540.00
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
242
PART-D PRICE BID
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
243
Price bid for Quantities of Civil work For Dairy Plant Building +Boiler House + compound wall+
+Godown+ E.T.P. at Khandawafor Indore SahakariDugdhaSangh Maryadit Indore (M.P.
SECTION-AS.N.
DESCRIPTION OF ITEMUNIT
QUANTITY RATE
(Rs.)AMOUNT
(Rs.)1 Earth work in Excavation by mechanical means (hydraulic
excavator) or by manual means for foundation trenches inall kind of soil and moorum Not exceeding 2.0 m in widthor 10sqm on plan including dressing of sides and rammingof bottom and disposal of surplus excavated soil asdirected, within a lead of 50m as per specification
Cum 552.28
2 Earth filling in foundation trenches including dressing ofside and ramming & watering etc complete. as perspecification
Cum 692.70
3 Moorum filling in plinth including dressing of side andramming & watering etc complete. as per specification
Cum 576.87
4 Providing and laying plain cement concrete(P.C.C.) ofspecified grade below foundation footings and U.G. tankswith 40 mm nominal size graded aggregate M-10(1:3:6)including cost of centering and shuttering - all work up toplinth level as per specification
Cum 27.81
5 Reinforced cement concrete work (any thickness) includingfootings , buttress, plinth and string courses fillets, column,pillars, posts and strutssuspended floors, roof slab , beams, staircase, chajjas,loftsetc up to 6.75 m height including the cost of centering ,shuttering ,finishing in concrete grade M-20 grade nominalMix(with 20mm nominal size stone aggregate) as perspecification
Cum 419.14
6 Reinforcement (Fe 415) for RCC work includingstraightening, cutting bending placing in position andbinding including cost of binding wire up to floor two levelincluding all wastage etc complete thermo mechanicallytreated bars (TMT) as per specification
Kg 24895.0
7 Providing 8”/ 4” thick brick masonry in ground floor walls,water tanks, septic tanks in 1:4 mortars. Joints of brick
Cum 280.50
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
244
Masonry shall not exceed 12 mm thickness. Bricks shall bekept wet for 24 hours before application. Masonry shouldbe in line and plumb and faces shall be smooth and leveled.as per specification
8 Providing two coats of cement plaster of 25 mm thicknessto all walls and concrete work in cement mortar 1:6, bothinternally and externally up to 7.50 m height includingcuring, making grooves etc. complete as per specification
Sqm 4276.00
9 Providing two coats of synthetic enamel paint of ISI gradeover two coats of cement putty to all internal plasteredsurfaces as per specification
Sqm 2676.00
10 Providing and applying two coats of external gradesynthetic paint ISI marked paint to all external surfaces asper specification
Sqm 1600.00
11 Providing structural steel- roof truss and purlins for boilerand godown shed areas in hollow square M.S. pipeincluding cutting, bending, welding and erection of trussesat specified height including accessories and fittingscomplete as per specification
Kg 2850.00
12 SupplyofBareZincalume/GalvalumeRoofingorcladdingsheets made out of 0.5 mm , 550 MPA yield stress andhaving coating grade AZ-150 confirming to ACTM1397. the sheet. The sheet shall be fixed with SDSTscrew confirming to grade-1 to be fixed on the crest ofthe rib the screw shall be have integral EPDM washerfor cladding sheets. SDST screw shall be fixed in thevalley near the rib. Each rich / valley shall be fixed withSDST screw every purlin. The overlaps in the lengthshall be applied with one raw of silicon sealant (exteriorgrade-glass to metal grade) lining. The accessories likeridge shall be fixed with SDST screws and gap betweenridges and shall be close with turn bend of the ridge. Thesheet below ridge shall be turn up to avoid leakage.There should be anti capillary flute on side overlappingendandeachsheetshallhavemale&femaleribsforoverlapping
Sqm 251.00
13 Providing and fixing in position, 25 to 38 mm. thickacid and alkali resisting Red Mandana stone ofapproved size and shape, for flooring, skirting and dado,including two coats of acid and alkali preventive primer,
Sqm 365.87
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
245
fixing on average 37 mm. thick cement mortar bedding1:3 (1 part of cement and 3 part ofcoarse sand) with acidproof powder, keeping the joints 6 mm. to 10 mm. wideall around and filling the same with epoxy resin andhardener, including hand/machine polishing, waxpolishing etc. complete, asdirected.
14 Providing & laying 25 mm. thick green polished kotahof approved quality, selected and sorted for uniformcolour, in floor, otta, sill, skirting, dado etc., in requiredsizes up to 60 cm. and as per design with normal pattern(square, rectangular) as per drawings, including cementmortar 1:6 bedding of required thickness, joints &pointing as specified,
Sqm 65.00
15 Providing and fixing in position 300mm x 450mm glazedceramic standard tiles dado in all internal factory walls upto 1.20 m height including joint finishing with chemicalfillers and washing with oxalic acid complete as perspecification
Sqm 214.00
16 Providing and laying 60mm thick factory made cementconcrete interlocking paver block of M ‐30 grade made byblock making machine with strong vibratory compactionand of approved size and design/ shape laid in requiredcolour and pattern over and including 50mm thickcompacted bed of course sand, filling the joints with coarsesand etc. all complete as per the specification (in hard parkarea)
Sqm 78.75
17 Providing and fixing in position3 track powder coated Aluminum section windows ininternal walls including 4 mm thick float glass, hold fastand fixtures. Locks etc. complete as per specification
Sqm 51.84
18 Providing and fixing double leaf aluminium door shutterswith teak ply up to .9M height and 4mm glass up to 2.4Mheight as per drawing with all fixture and fittings and locksetc complete including cost of aluminium door frames asper specification
Sqm 35.52
19 Providing pre construction anti termite treatment as perdetailed specification through contractor’s (specialized inthis field and approved by architect) in all excavations ofbuilding and in back filling, plinth filling at all levels withspraying method and shall also include for treatment to allbuilding as per direction. as per specification
Sqm 495.87
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
246
20 Providing and laying cement water proofing ofaverage 125mm thick for terrace slabs usingcement slurry & waterproofing chemical aftercleaning, arranging brick bats in cement mortar1:5,according to the slope, adding suitable chemicalfor water- tightness and again after 3 days pondingwith water and testing same, providing on topcement mortar 1:3 including addition ofwaterproofing compound and finishing the top withneat cement@ 2.75 kg/m2 and as per direction and instructions,complete at all levels and floors, including furnishing aguarantee bond for 10 years. The work should be carriedout through an approved specialized agency like IndiaWater Proofing Co. or equivalent. (Wall to wallmeasurement will be considered only)
Sqm 495.87
TOTAL OF SECTION-A
SECTION-B (ROAD WORK)S.N.
DESCRIPTION OF ITEM UNIT QUANTITY
RATE(Rs.)
AmountAMOUNT
(Rs.)1 Box cutting the road surface, to proper slope and
camber, for making a base for road work, includingrolling, removing the excavated stuff and depositingon road side etc. complete, as directed up to 100 mlead
cum 417.252 Filling, under RCC road with murrum or
selected soil obtained from outside (Contractor'searth) in layers of 15 cm. thickness, includingwatering, ramming well and consolidatingetc.complete, as directed. Rolling with 8-10 Trollers shall be done to achievethe necessary CBR value
cum 256.75
3 Providing and laying C.C. 1:4:8 (1 cement : 4coarse sand : 8 graded stone aggregate 40 mm.nominal size) and curing etc. complete, excludingthe cost of formworkcum 42.79
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
247
4 Providing and laying controlled 150mm thk. C.C.M-25 for road with vacuum dewatering methodfor the RCC with broom finish or with powerdriven towel finish surface of the concrete,with100 mm thk PCC (1:4:8) and curing complete.Therate shall be including groove made of 3mm widthand 25 mm depth as shown in the drawing .Thegrooving operation should be carried out as soonas concrete is ready to accept the saw cutwithouttrowelling etc as directed by Engineer-in-charge.The rate shall be inclusive oflabour,material and machinery cost & excludingthe cost offormwork&reinforcement,sameshallbepaidinrelevantitem.
cum 64.20
6 Providing and laying Precast Kerb size (Size-
300x500x150 )- vyra make near side of road. ThePCC 1:3:6 under kerb stone shall be done asdirected, and it shall be paid in relevant item. Thework of the curb blocks shall be executed in lineand level & shall be re-laid if necessary,joint shallbe filled up with mortar 1:3.
Rmt 110.00
TOTAL 0F SECTION-B
SECTION-C (SANITATION, PLUMBING & DRAINAGE WORK)S.N.
DESCRIPTION OF ITEMUNIT QUAN
TITYRATE
(Rs.)AMOUNT
(Rs.)1 Providing and fixing Galvanised Iron (GI) (Medium
grade ClassB) pipe suppoted on wall or floor of Tata orequivalent make, conforming to IS: 1239, including tubefittings such as sockets, unions,reducers,longorshortbends,elbows,nipple,flanges,check-nuts, tees, etc. complete (in proper line and level, withnecessary zari making, supports viz., clamps, RCC orbrick masonry pedestals and battens, if required) jointingwith screw joints, using hold tight and jute for pipes and
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
248
Teflon tape for fittings and fixtures, to wall, ceiling andfloor including making them good, testing and paintingwith 2 coats of black japan paint etc., complete of thefollowing nominal bore (NB)size:1) 25 mm Rmt. 502) 15 mm Rmt. 30
2 Providing and fixing 50mm flanged mount CI sluicevalve of approved make with GM seats, high tensilebrass spindle with cap, conformingtostandardwater-workspatternandflangesasperIS: 15381, flat facedand drilled, complete with accessories ofthefollowing pipe dia:
Nos. 4
3 Providing and fixing white glazed vitreous chinawarewall hung type European WC pan integrated 'P' or 'S'trap with or without vent (HUNDUSTAN Sanitaryware EWC or CERA or equivalent) with concealedpipes M.S. chair brackets including heavy duty plastictoilet sheet, jet spray and other accessories etc.completeas directed
Nos. 2
4 Providing and fixing white glazed vitreous chinawash basin of size 550 x 400 mm with central taphole (Hindustan Sanitaryware No. 10016 or Cera orequivalent) counter type without rim, Swan Neck ofJaquar or equi. Make C. P. brass pillar cock 15 mmhaving minimum weight 525 grams 32 mm dia C. P.brass bottle trap with brass union and C. P. brass walldischarge pipe withflangesandcap,32mmdiaG.I.wastepipewithfittingsuptofloor trap, 32 mm dia C. P. brass waste couplin withC. P. chain and rubber plug. 15 mm dia C. P. brass stopvalves having minimum weight 400 gms 15 mmheavy quality flexible P.V.C. inlet connection ofrequired length with brass union, washer and C. P.brass cap complete in all respects including cuttingand makinggoodthewalls,RCCworkandfloorsetc.completeasdirect
Nos. 4
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
249
ed5 Providing and fixing sand cast iron Nahni trap of selfcleansing design with or without vent arm, leadcaulked joint with refinedpig lead caulked joint withrefined pig lead and spun yarn in the sockets of H.C.I.pipe and fittings with 150 x 150 mm diastainless steelgrating including boxing the trap with 150 mm thickcement concrete 1 : 2 : 4 ( 1 cement : 2 coarse sand : 4stone ballast 20mmanddownguage)includingcuttingandmakinggoodthewallsR.C.C. work floors etc. wherever required. 100mm diainlte and
Nos. 3
6 Providing and fixing screw down brass chromiumplated heavy quality bib-taps of approved make onwater supply pipe lines of 15mm dia with or withoutextension piece but with a flange, as approved by thearchitects etc completeNo. 6
7 Providingandfixing15mmNBCPbrassheavyqualitywallor floor mounted sink tap, swivelling type, with CPwall flange, casted spout. No. 68 Providing and fixing underground or below floor,
high density Polyethylene (HDPE) pipes (for watersupply/drainage purpose) and all type of fittingsreadymade or fabricated, including jointing using buttwelding, testing, etc. complete, with a workingpressure of 6 Kg/m2. (Earthwork and filling shall bepaid extra.)200 mm OD rmt 10150 mm OD rmt 10
9 Constructing 600 x 600 x600 sizes manholes (insidedimension). The rate includes excavation, 150 mmthick BBCC 1:4:8 in foundation No. 10
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
250
230 mm wide brick masonry walls in CM 1:6, 12 mmthick plastering in inside and outside of chamber inCM 1:4, channels, IPS flooring, making drain channel,CI/MS rungs with paint,steps, CI cover with frame450 mm dia. Weighing 80 Kgs. painting the cover andframe with two coats of coal tar, and 150 mm thickRCC 1:2:4 slab with standard reinforcement etc.complete10 Providing and Fixing 5000 Ltr Capacity Sintex make
PVC tank including necessary inlet and outletconnections and placing at any height etc.completeasdirected
Nos. 2
11 Providing and fixing S.S.(grade 316) Amul Trap of100mm internal dia including floor cutting, concretesealing, masonary , brackets etc. testing etc. complete
Nos. 1212 Providing and installing precast RCC septic tank of100 person capacity of approved make likeGarud/Alcock or equivalentincludingnecessaryexcavation,basecourse,refilling,inlet-outlet connections, placing in line & level, etc.complete and installation as per manufacturer'sspecifications / as directed by EIC
Nos. 1
TOTAL OF SECTION-C
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
251
SECTION-D (BOUNDARY WALL WORK-350 RMT.)
S.N.
DESCRIPTION OF ITEMUNIT
QUANTITY RATE
(Rs.)AMOUNT
(Rs.)1 Earth work in Excavation by mechanical means (hydraulic
excavator) or by manual means for foundation trenches inall kind of soil and moorum Not exceeding 2.0 m in widthor 10sqm on plan including dressing of sides and rammingof bottom and disposal of surplus excavated soil asdirected, within a lead of 50m as per specification
Cum 482.00
2 Earth filling in foundation trenches including dressing ofside and ramming & watering etc complete. as perspecification
Cum 403.00
3 Providing and laying plain cement concrete(P.C.C.) ofspecified grade below foundation footings and U.G. tankswith 40 mm nominal size graded aggregate M-10(1:3:6)including cost of centering and shuttering - all work up toplinth level as per specification
Cum 33.00
5 Reinforced cement concrete work (any thickness) includingfootings , buttress, plinth and string courses fillets, column,pillars, posts and strutssuspended floors, roof slab , beams, staircase, chajjas,loftsetc up to 6.75 m height including the cost of centering ,shuttering ,finishing in concrete grade M-20 grade nominalMix(with 20mm nominal size stone aggregate) as perspecification
Cum 143.00
6 Reinforcement (Fe 415) for RCC work includingstraightening, cutting bending placing in position andbinding including cost of binding wire up to floor two levelincluding all wastage etc complete thermo mechanicallytreated bars (TMT) as per specification
Kg 7950.0
7 Providing 8”/ 4” thick brick masonry in 1:4 mortars. Jointsof brick Masonry shall not exceed 12 mm thickness.Bricks shall be kept wet for 24 hours before application.Masonry should be in line and plumb and faces shall besmooth and leveled. as per specification
Cum 147.00
8 Providing two coats of cement plaster of 25 mm thicknessto all walls and concrete work in cement mortar 1:6, bothinternally and externally up to 7.50 m height including
Sqm 1540.00
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
252
curing, making grooves etc. complete as per specification
9 Providing two coats of synthetic enamel paint of ISI gradeto all plastered surfaces as per specification
Sqm 1540.00
TOTAL OF SECTION D
NET TOTAL OF A, B, C AND D
E-tender for Supply, Installation, Civil construction work and Commissioning of Dairy Plant at Khandwa Under Indore Sahakari DugdhaSangh, marya.Indore M.P on turnkey basis.
253
PART-EDRAWINGS
(ATTACHED)