diabetul zaharat - cam 2013.ppt

of 250 /250
Diabetul zaharat

Author: alina-baciu

Post on 17-Nov-2015

158 views

Category:

Documents


16 download

Embed Size (px)

TRANSCRIPT

  • Diabetul zaharat

  • Definiie Sindrom heterogen caracterizat printr-o tulburare complex n reglarea metabolismului energetic al organismului, care afecteaz deopotriv utilizarea glucidelor, lipidelor i proteinelor, precum i celelalte metabolisme; aceste alterri sunt datorate insuficienei absolute sau relative de insulin. Modificrile biochimice pe care aceste tulburri le antreneaz conduc la modificri celulare funcionale urmate de leziuni anatomice ireversibile n numeroase esuturi i organe.

  • DefiniieNu este o boal n sensul tradiional al termenului

    Sindrom

    - alctuit dintr-un grup heterogen de tulburri cu etiologie i patogenie diferite - componentele sindromului au ca element comun hiperglicemia

  • EtimologieDiabeiu (greaca veche) = a se scurge ca printr-un sifon (aluzie la poliuria marcat a acestor pacieni)

    Thomas Willis (medic, anatomist i profesor la Oxford) - 1674 - a descoperit c urina este dulce - a adugat cuvntul mellitus (ca mierea)

    Diabetes mellitus(Diabet zaharat)

  • Context epidemiologic 25.0 39.759%10.419.788%38.244.216%1.11.759% 13.6 26.998%n lume 2003 = 189 milioane 2025 = 333 milioanecretere 72% 81.8156.191% 18.235.997%

  • Tendine epidemiologice ale diabetului n lumePrevalena DZ a crescut peste tot n lume, creterea fiind mai evident dup 1990: - 1990 127 milioane diabetici - 2000 151 milioane diabetici - 2010 285 milioane diabetici (6,6% dintre aduli) Congres IDF Dubai decembrie 2011 - 2011 366 milioane diabetici 8,3% din populaia adult a planetei - 2030 552 milioane diabetici un adult din 10 va avea diabet zaharat

  • Pancreasul endocrin - noiuni de anatomie i fiziologieInsulele Langerhans

    800.000 1.500.0001 2 % din masa pancreatic totalCelule: A, B, C, D

  • Hormonii secretai n celulele insulelor Langerhans

    Tipul celularHormonul produsEfect pe metabolismul glucidicAGlucagonHiperglicemiant prin glicogenolizBInsulinPeptidul CAmilin Hipoglicemiant prin mec. multipleEfecte metab. incomplet cunoscuteHiperglicemiantC(PP)Polipeptid pancreaticInfluen pe motilitatea gastric i absorbia principiilor nutritiveDSomatostatinHiperglicemiant, inhib secreia insulinei

  • Insulina structur, sintez, secreie

  • Secreia insulinei

  • Secreia insulinei bazal insulinemia plasmatic = 10-12 U/ml stimulat insulinemia plasmatic 50-75 U/ml

  • Receptorul de insulin

  • Controlul hormonal al glicemiei

    InsulinaEfect net: scderea glicemieiHormoni de contrareglareEfect net: creterea glicemiei

    nlturrii glucozei din snge intrrii glucozei n celule glicogenezei eliberrii glucozei din depozite glicogenolizei gluconeogenezei lipolizei i cetogenezei catabolismului proteic nlturrii glucozei din snge intrrii glucozei n celule glicogenezei eliberrii glucozei din depozite glicogenolizei gluconeogenezei lipolizei i cetogenezei catabolismului proteic

  • Clasificarea DZ (OMS,1998)DZ tip 1 - autoimun - idiopatic

    DZ tip 2

    Alte tipuri specifice - defecte genetice ale celulelor - defecte genetice ale aciunii insulinei - boli ale pancreasului exocrin - endocrinopatii - medicamente i substane chimice - infecii - forme rare de diabet imun - sindroame genetice rare

    Diabetul gestaional

  • Diabetul zaharat tip 1 Poate apare la orice vrst, dar mai frecvent sub 30 aniDei exist o predispoziie genetic, majoritatea pacienilor nu au antecedente familiale de DZDebut relativ abrupt, cu simptome evidente i tendin la cetoacidozDe obicei, pacienii sunt slabiRezult n urma distrugerii celulelor -pancreaticeInsulina plasmatic este foarte redus sau absentAnticorpi circulani: antiinsulin, anticelule , anti-GADPacienii sunt dependeni de insulin

  • Etiopatogenia DZ 1 autoimunPredispoziie geneticFactor de mediu (viral, toxic, alimentar)Activare autoimun insulitScderea capacitii -secretoare; afectarea fazei secretorii iniiale, dar insulinemia plasmatic este normalDiabet clinic manifest; insulinemie plasmatic sczut, hiperglicemie, apar simptomeleApariia complicaiilor

  • Diabetul zaharat tip 2Apare, de obicei, dup vrsta de 40 ani80% din cazuri: obeziPerioad prediagnostic lungSimptomatologie de debut tears sau absent, fr tendin la cetoacidozAsocierea a dou defecte celulare: rezistena la insulin i deficiena funciei -celulareCel puin iniial, capacitatea secretorie -pancreatic este relativ pstrat, rspunznd bine la diet i ADO; ulterior, unii vor necesita insulinoterapie

  • Etiopatogenia DZ 2Factori genetici transmitere poligenicRezisten crescut la aciunea insulineiHiperinsulinism funcionalDeficien n secreia insulinic hiperglicemie persistent

    Scderea absolut a secreiei insulinice DZ 2 insulinonecesitant

  • Clasificarea DZ (OMS,1998)DZ tip 1 autoimun (1A) - idiopatic (1B)

    DZ tip 2

    Alte tipuri specifice - defecte genetice ale celulelor - defecte genetice ale aciunii insulinei - boli ale pancreasului exocrin - endocrinopatii - medicamente i substane chimice - infecii - forme rare de diabet imun - sindroame genetice rare

    Diabetul gestaional

  • Diagnosticul clinic al DZPoliuriePolidipsiePolifagieScdere ponderalAstenie

  • Caracteristicile generale ale DZ 1 i 2

    ParticularitateTipul 1Tipul 2EreditateConcordan 30-50% Concordan 90% Baza geneticDefect n programarea imunitiiIR i/sau insulino-deficienSemne de autoimunitatePrezenteAbsenteDebutSub 40 de aniPeste 40 de aniIMCSczutCrescut (80%)Insulinemia plasmaticSczutCrescutTendina la cetozMarcatAbsentTratament oralIneficientEficient

  • Criterii de diagnosticare a DZ (diagnosticul paraclinic)Cel puin dou glicemii a jeun 126 mg/dl (7 mmol/l)sauPrezena simptomelor i o glicemie ntmpltoare (n orice moment al zilei) 200 mg/dl (11,1 mmol/l)sauO glicemie 200 mg/dl (11,1 mmol/l) la 2 ore dup administrarea a 75 g glucoz (TTGO)

    N.B. - glicozuria NU este un criteriu de dg. - NU se recomand ca dg. de DZ s se bazeze pe glicemii efectuate pe glucometre - HbA1c NU se folosete pentru diagnosticul DZ

  • Glucoza plasmatic versus glucoza din sngele total

    Glucoza din plasm Glucoza din sngele total

    126 mg/dl (7 mmol/l) 110 mg/dl (6,1 mmol/l)

    200 mg/dl (11,1 mmol/l) 171 mg/dl (9,5 mmol/l)

  • Criterii de interpretare a glicemiei bazale70-110 mg/dl normal

    110-125 mg/dl glicemie bazal modificat

    126 mg/dl diabet zaharat probabil; confirmarea se face dup a doua dozare

  • Criterii de interpretare a TTGO

    Glicemie n plasma venoasDiabet zaharat bazal la 2 h dup glucoz 126 mg/dl (7 mmol/l) 200 mg/dl (11,1 mmol/l)

    Scderea toleranei la glucoz bazal la 2 h dup glucoz< 126 mg/dl (7 mmol/l) 140 mg/dl (7,8 mmol/l) i < 200 mg/dl (11,1 mmol/l)Normal bazal la 2 h dup glucoz< 110 mg/dl (7 mmol/l)< 140 mg/dl (7,8 mmol/l)

  • Modaliti de debut i de diagnostic ale DZPacient simptomatic

    - simptomele clasice de diabet - simptome ale complicaiilor - acute - cronice

    Pacient asimptomatic - bilan al strii de sntate - depistare activ la subieci cu risc

  • Indicaiile screening-ului pentru DZ 2 la subiecii asimptomatici cu ajutorul glicemiei bazaleToi subiecii cu vrsta 45 ani; se va repeta la intervale de 3 aniTestarea se va face la vrste sub 45 ani i se va repeta la intervale mai scurte la:

    - persoane cu IMC 27 kg/m2 - cei care au rude de gradul I cu DZ - grupuri etnice cu risc crescut - femeile care au nscut copii cu greutatea peste 4,5 kg - femeile care au avut diabet gestaional - hipertensivii; cei cu HDL 35 mg/dl i/sau TG 250 mg/dl - sedentarii - cei cu GBM sau cu STG la testri anterioare

  • Complicaiile DZAcute

    - infeciile - comele - hiperglicemice - cetoacidozic - hiperosmolar - lactacidemic - hipoglicemicCronice

    - microangiopatice - macroangiopatice - neuropatice

  • Infeciile Frecvente la diabeticul dezechilibrat

    Predispoziia ctre infecii explicat prin modificri legate de hiperglicemie:

    - mobilizrii i chemotactismului leucocitar - capacitii fagocitare a polimorfonuclearelor - capacitii bactericide a polimorfonuclearelor - funciilor monocitare

  • Infecii puternic asociate diabetului (quasi-specifice), severe, dar foarte rare: - mucormicozele - otita extern malign - pielonefrita emfizematoas - colecistita emfizematoasInfecii postterapeutice: - abcese insulinice, infecii asociate transplantului renal, dializei peritoneale, hemodializeiInfecii nespecifice asociate DZ: - infecii urinare: cistite, pielonefrite, abcese renale/perirenale - infecii respiratorii - infecii cutanate, mucoase, ale esutului celular s.c. - altele: fasceita necrozant, gangrena Fournier a organelor genitale

  • Hipoglicemiile Definiie scderea valorilor glicemiei sub 60 mg/dl n plasma venoas (sub 50 mg/dl n sngele venos total)

    Clasificare - uoare

    - medii - severeCauze - exces de insulin sau de ADO secretagoge

    - scderea aportului glucidic - efort fizic excesiv - consumul de alcool

  • Mecanismele de aprare mpotriva hipoglicemiei

    - scderea secreiei de insulin - creterea secreiei pancreatice de glucagon - stimulare simpatic secreiei de catecolamine - creterea secreiei de cortizol i h. de cretere

    Simptome

    - periferice - centrale

    Cazuri particulare

    - hipoglicemiile necontientizate - hipoglicemiile nocturne

  • Complicaiile hipoglicemiilorAccident vascular cerebralInfarct de miocardTulburri funcionale cerebrale minore Encefalopatia posthipoglicemicHemoragii retiniene masiveDecerebrare

  • Tratamentul hipoglicemiilorTratament preventiv educaia pacientului diabetic

    Tratament curativ

    - hipoglicemiile uoare i medii - glucide rapid + lent absorbabile - hipoglicemiile severe - glucoz i.v. - glucagon - glucide rapid + lent absorbabile

  • Cetoacidoza diabetic - date generaleDefiniie triada - hiperglicemie - cetoz - acidoz

    F > BVrsta medie 43 ani20 % episoade multiple 20 % apar la diabetici nou diagnosticai

  • Fiziopatologia cetoacidozei diabetice

  • Insulinodeficiena absolut

    - ntreruperea insulinoterapiei - cetoacidoz inaugural (20%) Insulinodeficiena relativ

    - afeciuni intercurente - endocrinopatii: tireotoxicoza, sdr. Cushing, acromegalia - iatrogen (corticoizi, simpatomimetice) - sarcin - stressCauzele cetoacidozei diabetice

  • Debut insidiosStarea de contien com vigilFaciesSemne neuromusculareSemne de deshidratareTemp. cutanat Semne respiratoriiSemne digestiveSemne cardiovasculare

    Tablou clinic

  • Diagnostic paraclinicHiperglicemie: 350 1200 mg%

    Hipercetonurie: > 30 mEq/l

  • Tratamentul cetozei incipiente

    Creterea dozelor de insulin Hidratare corespunztoare Buturi reci ndulcite cu zahr sau glucoz,

    n cantiti mici i la intervale scurte Sucuri de fructe, supe de legume, ceai cu zahr, compot Scderea grsimilor din alimentaie

  • Tratamentul cetoacidozei avansate i severeCombaterea tulburrilor hidroelectroliticeCombaterea tulburrilor metabolice (hiperglicemia)Combaterea tulburrilor acido-baziceCombaterea tulburrilor hemodinamiceCombaterea factorului infeciosMsuri nespecifice

    - oxigenoterapie - sondaj vezical - sond de aspiraie gastric - heparin 5000 u/8h - tratament etiologic

  • Mortalitatea n CAD sever< 0,5% n comele simple

    5 15% n comele complicate

    45% cnd este abolit starea de contien

  • Coma hiperosmolarDefiniie

    Absena cetoacidozei la un diabetic care are o osmolaritate plasmatic hiperglicemic sau mixt (hiperglicemic i hipernatremic) > 350 mOsm/l

    Osmolaritatea = (Na+ + 10) x 2 + glicemia /18 + ureea /6

    (mosm/l)

    Frecven

    - 10% din comele diabetice hiperglicemice

  • Criterii de diagnosticOsmolaritate plasmatic > 350 mOsm/lGlicemie > 600 mg/dlpH > 7,25HCO3 > 15 mEq/lSemne de deshidratare masiv

  • Complicaiile cronice ale DZ

  • Complicaiile cronice ale DZMicroangiopaticeMacroangiopaticeNeuropaticeGangrena diabeticAlte complicaii - hepatopatia dismetabolic

    - cardiomiopatia diabetic - parodontopatia - complicaii osteo-tendino-articulare - osteoartropatia diabetic (piciorul Charcot) - afectarea cutanat

  • n momentul diagnosticului DZ 2 un procent mare din persoane au deja complicaii cronice sau asocieri morbide

    N. Hancu et al. Quality of care of newly-diagnosed diabetes mellitus:"EPIDIAB" program/lessons from the first three years. Diabetologia 2003; 46(Suppl.2): A282.

  • Clasificarea neuropatiei diabeticeNeuropatia subclinicNeuropatia clinic

    PerifericVegetativ (autonom)

  • Neuropatia subclinic

    Teste de electrodiagnostic anormale

    - vitez de conducere nervoas sczut

    Testare cantitativ senzorial anormal

    - vibratorie, tactil, termic

  • Neuropatia perifericPolineuropatia distal simetricNeuropatia diabetic acutNeuropatia diabetic hiposenzitivNeuropatia motorie proximal a membrelor inferioareMononeuropatiileNeuropatiile truncale

  • Polineuropatia distal simetric

    Cea mai frecventTulburri de sensibilitate (hiperestezie sau hiposensibilitate)Membrele inferioareEvoluie centripetDisestezieAnestezie dureroasAgravare nocturnSemne de disfuncie vegetativPiele uscat / aspect pseudo-inflamatorSensibilitatea vibratorie / proprioceptiv Atrofie i hipotonie muscular

  • Neuropatia diabetic acutRar, dar caracteristic DZInstalare acutDureri intense n membrele inferioareCaexie neuropatInsomnieDepresieImpoten

  • Neuropatia diabetic hiposenzitivLipsesc acuzele subiectiveScdere / dispariie a sensibilitii dureroas, termic, vibratorieAlterare variabil a funciilor vegetativeVCN Risc de leziuni cutanateEvaluare cantitativ: determinarea pragului de electropercepie

  • Neuropatia motorie proximal a membrelor inferioare

    RarAmiotrofiiPoliradiculopatia diabeticInstalare acut / subacutTopirea muchilor

  • Mononeuropatiile

    Cel mai frecvent:

    nervii cranieniCubitalSciatic popliteu extern

  • Neuropatiile truncaleRare

    Instalare acut sau progresiv

    Durere abdominal sau truncal unilateral

    T3 - T12

  • Tratamentul neuropatiei perifericeEchilibrare metabolic riguroasAINS, analgezice opioide cu aciune centralTranchilizante minoreCarbamazepina, GabapentinAntidepresive tricicliceTENS, electroacupuncturaCapsaicinaVitaminoterapia, benfotiamina, acidul alfa-lipoicIonizri ale membrelor inferioare cu Xilin 1% i vit. B1Balneofizioterapia (mofete, bi carbogazoase, ionizri)

  • Neuropatia vegetativ Neuropatia cardio-vascularNeuropatia digestivNeuropatia vezicalTulburrile sexualeNeuropatia pupilarTulburrile cutanateHipoglicemiile necontientizate

  • Neuropatia cardio-vascularManifestrile cardiovasculare ale neuropatiei

    CardiaceVasculareTahicardie cu ritm stabilHipotensiune ortostaticInfarct miocardic nedurerosTulburri circulatorii cerebrale intervalului QTc (>400 ms)Tulburri circulatorii ale extremitilorTulburri de ritmEdeme ale membrelor inferioareMoarte subitFenomenul non-dippingAccidente anestezice

  • Tratamentul hipotensiunii ortostaticeStoparea medicaiei care exacerbeaz hipotensiuneaTrecere treptat din clino n ortostatismCiorapi elastici Creterea moderat a aportului de sareSimpatomimetice (etilefrin - Effortil)Mineralocorticoizi (9--fluorohidrocortizon 400 g/zi)Antiinflamatorii nesteroidieneDerivaii de ergotamin (DH-ergotoxin 7 pic. de 3 X / zi)Agoniti ai receptorilor 1 - Midodrin 2,5-10 mg/ziAcid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o

  • Neuropatia digestivDisfuncia esofagian

    Disfuncia gastric

    Disfuncia intestinal

    Disfuncia veziculei biliare

  • Neuropatia vezicalHipotonie ureteralPareza vezicalvezica neurogen

    Tulburrile sexualeB impoten - tulburri de erecie - ejaculare retrogradF tulburri menstruale

  • Neuropatia pupilarAsimptomaticMsurarea reflexului pupilar la lumin

    Tulburrile cutanateAnhidroz distalHipersudoraie compensatorie n superioar a corpului

    Hipoglicemiile necontientizateAbsena semnelor de avertizare a hipoglicemiilor

  • Macroangiopatia diabetic Ateroscleroza date generaleArteriosclerozaAterosclerozaAthero (terci) + sclerosis (induraie)IstoricLocalizare

  • Fiziopatologia aterosclerozei Ipoteza rspunsului la injurie (R. Ross)

  • Leziunile ateroscleroticeStriurile lipidice

    Placa de aterom fibroas

    Placa de aterom complicat

  • Diagnosticul clinic al aterosclerozei

    Faza preclinic, asimptomatic

    - diagnostic de suspiciune - modificri metabolice (hipercolesterolemia) - factori de risc (fumat, HTA, DZ etc.)

    Faza clinic

    - obstrucie > 60-70% din lumenul arterial - ischemie n diverse teritorii - coronarian - cerebral - membrele inferioare - renal - mezenteric

    - particularitile ATS la diabetici

  • Diagnosticul paraclinic al aterosclerozei

    Ecg Ecg de efort Scintigrafia cu taliu Ecocardiografia Angiografia Ecografia intravascular

  • Microangiopatia diabeticNefropatia diabetic

    Retinopatia diabetic

  • Nefropatia diabetic date epidemiologice50 % dintre pacienii aflai n programele de supleere renal au drept cauz a insuficienei renale diabetul

    Dup 20 de ani 30 % dintre pacienii cu DZ 2 dezvolt nefropatie

    20% dintre cei cu nefropatie ajung la insuficien renal terminal

  • Eliminarea urinar de proteinePrin consens:

    Normoalbuminurie < 30 mg/24 ore

    Microalbuminurie 30-300 mg/24 ore

    Macroalbuminurie > 300 mg/24 ore

  • Stadializarea nefropatiei diabeticeStadiul I Hiperfuncie i hipertrofie renal

    Stadiul II Silenios, normoalbuminuric

    Stadiul III Nefropatia diabetic incipient

    Stadiul IV Nefropatia diabetic patent (clinic manifest)

    Stadiul V Insuficiena renal cronic terminal

  • Evoluia n timp a filtratului glomerular i a eliminrii urinare de albumin

  • Diagnostic clinicSemne de HTASemne de sindrom nefrotic, IRCPrezena altor complicaii ale diabetului: retinopatie, macroangiopatie, neuropatie numrului de hipoglicemii nejustificate i necesarului de insulin

  • Caracteristicile clinice ale diabeticilor hipertensivi presiunii pulsului arterial

    Hipotensiunea ortostatic

    Hipertensiunea nocturn

  • Diagnostic paraclinicRata filtrrii glomerulare

    Eliminarea urinar de proteine

    Biopsia renal

  • Screening pentru nefropatia diabetic

    Microalbuminuria se evalueaz la

    diagnosticarea DZ i apoi anual

    Creatinina seric trebuie dozat anual

  • Eliminarea urinar de proteine

    normoalbuminuriemicroalbuminuriemacroalbuminurieRata de excreie a albuminei (mg/24 ore)< 3030-300 300Raportul albumin/creati- nin (mg/g)Brbai

    Femei

    < 20

    < 30

    20-200

    30-300

    200

    300

  • Factori de risc pentru progresia nefropatiei diabeticeHTAAlbuminuriaControlul glicemic insuficientFumatulConsumul crescut de proteineDislipidemia

  • Metode terapeuticeMeninerea unui control glicemic optim pe termen lungTratamentul precoce al hipertensiunii arterialeTratamentul dieteticReducerea lipidelor sericePrevenirea i tratamentul comorbiditilor existenteTratamentul anemiei renaleProfilaxia i tratamentul bolii osoase renale

  • Retinopatia diabetic date generaleRD unul din primele semne de afectare vascular

    Prima cauz de cecitate 20-74 ani

    Prevalena corelat cu durata de evoluie a DZ

    > 20 ani de DZ toi pac.cu DZ 1

    > 60% pac. cu DZ 2

  • Alterarea compoziiei membranei bazale

    - extravazare - plasm edem - hematii hemoragii - lipoproteine exsudate dure

    Pericitelor - proliferarea cel. endoteliale - tonicitii peretelui capilar ectazii capilare microanevrismeFiziopatologia retinopatiei diabetice

  • Proliferarea cel. endoteliale + microanevrismele ncetinire curent sanguin adezivitatea plachetar Ocluzie capilar Hipoxie retinian Stimularea angiogenezei Vase de neoformaie

  • Leziunile din RDDilataia capilarelorMicroanevrismeleHemoragiile intraretinieneExsudatele dureExsudatele moiAnomalii intravasculare intraretinieneAnomalii venoase

  • Leziunile din RDNeovascularizaia retinianHemoragiile preretinieneHemoragiile vitreeneDezlipirea de retinRubeoza irian. Glaucomul neovascularMaculopatia diabetic

  • Clasificarea retinopatiei diabeticeRetinopatie diabetic neproliferativ

    - uoar - sever (preproliferativ)

    Retinopatie diabetic proliferativ

  • Diagnosticul retinopatiei diabeticeExamenul FO

    - oftalmoscopia direct - biomicroscopia FO - oftalmoscopia indirectAngiografia cu fluoresceinFluorometria vitreanEcografia ocularElectroretinogramaTeste de discriminare cromaticAdaptometria

  • Screening-ul retinopatiei diabeticeAcuitatea vizual poate fi normal chiar n prezena unor leziuni avansate ale retinei necesar screening periodic pentru toate persoanele cu diabet

    Examenul oftalmologic se va face la depistarea diabetului i apoi anual

    Pacienii cu retinopatie diabetic vor fi evaluai mai des n funcie de indicaiile medicului oftalmolog

  • Frecvena examinrilor n funcie de stadiul RD

    Anomalii retinieneUrmrire laNormal + rare microanevrismeRDNP uoarRDNP moderatRDNP severEMCSRDPAnual9 luni6 luni4 luni2-4 luni2-3 luni

  • Tratamentul medicamentos al RDEchilibrarea metabolic a DZEvitarea hipoglicemiilorVitamine A, EExtractul de ginkgo bilobaDobesilat de calciuAspirinaTratamentul HTAIECA, Sartani, Sandostatin

  • Tratamentul chirurgical al RDTratamentul laser

    - panfotocoagularea laser - tratamentul laser focal

    Vitrectomia posterioar

    Crioterapia

  • Alte afectri oculare n diabetul zaharatCataractGlaucomInfeciiNeuropatii de nervi oculomotori adaptrii la ntuneric discriminrii cromatice

  • Piciorul diabetic - date epidemiologice25% dintre bolnavii cu DZ internai sunt spitalizai pentru complicaii la nivelul piciorului

    50-70% dintre amputaiile netraumatice sunt la pacienii cu DZ

    Neuropatia diabetic este a doua cauz, pe plan mondial, de durere neuropat, dup lumbago

  • Fiziopatologia piciorului diabeticPrincipalele modificri sunt determinate de: neuropatie arteriopatie

  • Diagnostic diferenial - simptome Arteriopatia diabetic Claudicaie intermitent Durere de repaus Durere spontan, brusc instalat

    Neuropatia diabetic Dureri de repaus, nocturne Arsuri Parestezii

  • Diagnostic diferenial semne clinice Arteriopatia diabetic Absena pulsului, picior rece Paloare la ridicarea membrului inf. Roea la trecerea n ortostatism Cianoz Modificri trofice

    Neuropatia diabetic Piele atrofic Calus Unghii distrofice Deformri osoase Picior cald Reducerea/absena sensibilitii Absena reflexelor

  • Arteriopatia diabetic Evaluare Echo-Doppler Angiografie

    Management Medicaie Exerciii fizice Trimitere la specialist

    Neuropatia diabetic Evaluare Monofilament Sensibilitate vibratorie Reflexe osteo-tendinoase

    Management Controlul durerii Trimitere la specialist

  • Localizarea ulceraiilor neuropate

  • Aspecte ale piciorului diabetic

    Deformrile osoase predispun anumite zone la ulceraii

  • Examinare picior

    Examen vascular periferic

    palpare puls arterialexaminare circulaie venoas culoare tegumenteT tegumente

    Examen neurologic ROT testare sensibilitate

    - tactil - termic - dureroas - vibratorie

  • Prevenia piciorului diabeticEducaia pacientului pentru ngrijirea picioruluiExaminarea piciorului zilnicngrijirea pielii i unghiilornclminte adecvat

    Renunarea la fumat

    Identificarea deformrilor osoase

    Evaluarea / ameliorarea controlului:GlicemieiTAFactorilor de risc cardiovascular

  • Important de reinut n managementul piciorului diabeticClaudicaia intermitent din angiopatie poate lipsi sau poate fi estompat datorit neuropatiei

    Paradoxal, la nceputul tratamentului hipoglicemiant durerile se pot intensifica

  • Piciorul diabetic - concluziiInspecia piciorului se va efectua la fiecare vizit iar examinarea complet anual

    Testarea sensibilitii periferice la bolnavul cu diabet se face anual

    Se recomand un control agresiv al glicemiei pentru a reduce riscul apariiei piciorului diabetic

    Pacientul trebuie nvat s-i examineze piciorul si s-l ngrijeasc

    Se va trimite pacientul la chirurg, ortoped, dermatolog la apariia unei rni, infecii, onicomicoze

  • Complicaiile cutanate ale diabetului zaharatDermatoze datorate diabetului zaharat i complicaiilor sale

    - manifestri cutanate ale neuropatiei diabetice - manifestri cutanate ale angiopatiei diabetice - infeciile cutanate

    Dermatoze datorate tratamentului specific diabetului zaharat

    Dermatoze asociate cu diabetul zaharat

  • Manifestri cutanate ale neuropatiei diabeticeTegumentul uscatPierderea prului la nivelul gambelorHiperhidrozaDurilloamele i hiperkeratoza plantarHematoamele subunghealeVenectaziile Edemul neuropatUlcerele neuropate

  • Manifestri cutanate ale angiopatiei diabeticeDermopatia diabetic

    Necrobioza lipoidic

    Rubeoza facial

    Ulcerele arteriopate

  • Infeciile cutanateTinea pedisOnicomicozaOnicodistrofiaAlte infecii micotice cutanate FoliculiteFurunculozeFasceita necrozant

  • Dermatoze datorate tratamentului specific diabetului zaharat

    Lipodistrofia insulinicAlergia la insulinReaciile la ADO - eritem polimorf

    - necroliz epidermic toxicReaciile lichenoideInfecii cutanate la locurile de injectare (S. aureus)

  • Dermatoze asociate cu diabetul zaharat

    Buloza diabeticScleredemulAcanthosis nigricansXantoamele eruptiveVitiligoGranulomul inelarCarotenodermia

  • Evaluarea iniialObiective evaluarea statusului bolii i a factorilor de risc pentru complicaiile diabetuluiinformarea pacientului despre natura i severitatea boliieducaia pacientului n legtura cu dieta adecvat, exerciiul fizic, medicaie, automonitorizarea glicemieistabilirea unui plan terapeuticstabilirea unui plan de monitorizare

    Metode anamnezexamen clinic complet investigaii paraclinice

  • Examen clinicGreutate si nlime, IMC (Kg/m), circumferina abdominalTAFrecvena cardiacPalparea tiroideiExaminarea corduluiExaminarea picioruluiExaminarea pieliiExaminarea neurologic (reflexe, sensibilitatea vibratorie, tactil, termic, dureroas)

  • Investigaii paracliniceGlicemia bazal i la 2 ore postprandialColesterol total, LDL-colesterol, HDL-colesterolTriglicerideAcid uricUree, creatinin seric, clearence-ul de creatininExamenul de urinMicroalbuminuria EKGExamen FORadiografia toracicEcografie abdominalOscilometrie

  • Monitorizare

  • Tratamentul diabetului zaharatDZ este o boal cronic

    Obiectivul principal: meninerea parametrilor clinici i biochimici specifici ct mai aproape de normal

    Tratamentul trebuie privit n perspectiva speranei de via

  • Criteriile unui bun control metabolicGlicemia preprandial: 80-110 mg/dlGlicemia postprandial: 100-145 mg/dlHbA1c: < 6,5 %Colesterol total: < 200 mg/dlTrigliceride a jeun: < 150 mg/dlTA < 130 / 80 mm Hg (120 / 70 mm Hg)IMC < 25 kg/m2 (B);

    < 24 kg/m2 (F)

  • Importana controlului glicemic Obiectivul principal al terapiei n DZ 2 este de a obine valori ale glicemiei ct mai aproape de valorile normale, n scopul de a preveni i ncetini apariia complicaiilor macro i microvasculare

  • Hemoglobina glicozilatStandardul de aur pentru monitorizarea glicemieiReflect o medie a valorilor glicemiei pe o perioad anterioar de 2-3 luniSe exprim ca procent din totalul Hb (normal 4-6%) Se coreleaz bine cu valorile glicemieiObiectiv realistic - Valoarea cea mai sczut a HbA1c obinut fr reacii adverse inacceptabile

  • Corelaii ntre valorile Hb A1c i glicemieA1c (%) Media glicemiilor

    6 135 mg/dl (7,5 mmol/l) 7 170 mg/dl (9,5 mmol/l) 8 205 mg/dl (11,5 mmol/l) 9 240 mg/dl (13,5 mmol/l) 10 275 mg/dl (15,5 mmol/l) 11 310 mg/dl (17,5 mmol/l) 12 345 mg/dl ( 19,5 mmol/l)

  • Avantajele HbA1cEvaluare obiectiv a controlului glicemic

    Se coreleaz cu riscul de apariie a complicaiilor

    Nu poate fi manipulat de pacient

    Neinfluenat de modificrile recente ale glicemiei ca urmare a ingestiei de alimente

  • Automonitorizarea glicemieiCrete compliana la tratament i are efect favorabil asupra schimbrii stilului de viaFrecvena se stabilete n funcie de pacient, stadiul bolii, riscul evenimentelor hipoglicemiceAjut la individualizarea tratamentului i adaptarea msurilor nefarmacologiceDezavantaje cost crescutdisconfort fizic

  • Metode de tratament Tratamentul dietetic

    Exerciiul fizic

    Tratamentul medicamentos (insulin i/sau ADO)

    Educaia specific

  • Terapia n trepte a DZ tip 2

    Insulin +/- ADOTerapie combinatMonoterapie oralDiet+exerciiu fizic

  • Tratamentul dieteticLocul dietoterapiei n tratamentul DZ

    Obiectivele tratamentului nutriional:

    - meninerea glicemiei la un nivel ct mai aproape de valorile normale - normalizarea profilului lipidic - asigurarea unui aport caloric adecvat - prevenirea i tratarea complicaiilor acute i cronice - creterea calitii vieii printr-o alimentaie adecvat

  • Recomandrile nutriionale generale pentru pacientul diabeticCaloriiGlucide: 55-60 % din aportul caloricFibre alimentare: 30-40 g/ziLipide: sub 30 % din calorii Colesterol: < 300 mg/ziProteine: 12-15 % din aportul caloricSodiu: < 6 g NaCl / zi; la hipertensivi < 3 g NaCl / ziAlcoolulEdulcoranteleVitamine i minerale

    CARBOHIDRAI FIBRE 55%PROTEINE15%LIPIDE 30%

  • Etapele alctuirii unei dietePrecizarea caracteristicilor generale ale dieteiCalculul aportului caloricDistribuia caloriilor pe cele 3 principii energetice

    - 55-60 % glucide - 25-30 % lipide (1/3 animale, 2/3 vegetale) - 12-15 % proteine (1/2 animale, 1/2 vegetale)Distribuirea glucidelor pe numrul de mese precizat

    - 20% - 10% - 30% - 10% - 20% - 10%Alegerea alimentelorPregtirea corect a alimentelor (reguli de gastrotehnie)

  • Curba glicemic n funcie de indexul glicemic

  • Factori care influeneaz indexul glicemicConcentraia n glucide a alimentelorConinutul de proteine i lipide al alimentelorConinutul n fibre alimentarePrezena de amidon greu digerabilMrimea particulelor de amidonForma fizic a hraneiConinutul hidric al alimentelorTemperatura alimentelorPrezena inhibitorilor enzimatici naturali, a fitailor i taninelorGradul de prelucrare mecanic prin masticaie

  • Exemple de index glicemic

    138% Glucoz126% Miere100% Glucoz100% Pine alb90-99% Pine integral, piure de cartofi, biscuii 80-89% Piure de cartofi, morcovi80-89% Cartofi, banane70-79% Pine integral, orez, cartofi70-79% Chips-uri60-69% Pine alb, banane60-69% Macaroane, spaghete fierte 15 minute50-59% Spaghete fierte 5 minute, chips-uri50-59% Mere, portocale, mazre 40-49% Mazre, portocale40-49% Spaghete fierte 5 minute, lapte30-39% Lapte, mere30-39% Fructoz20-29% Fasole psti, fructoz10-19% Arahide, soia10-19% Arahide, soia

  • Rspunsul insulinic la glucidele alimentareGlucide rapid absorbabileGlucide lent absorbabile

  • Efortul fizic terapeutic - beneficiiScade glicemia i HbA1cAmelioreaz profilul lipidic

    - TG - LDL-colesterolul - HDL-colesterolulAmelioreaz HTA uoar i moderatAdjuvant al dietei pentru scderea ponderalAmelioreaz factorii de risc cardio-vascularCrete tonusul psihic i calitatea vieii

  • Efortul fizic terapeutic - riscuriHipoglicemieHiperglicemie i cetoz la pacienii insulino-deficieniPrecipitarea i exacerbarea bolilor cardio-vasculare (angin pectoral, infarct de miocard, aritmii, moarte subit)Agravarea complicaiilor cronice ale DZ

    - retinopatie proliferativ: hemoragii vitreene, deslipiri de retin - nefropatie: proteinuria - neuropatie periferic: leziuni ale articulaiilor i ale es. moi - neuropatie vegetativ: scade rspunsul cardio-vascular la efort, hipotensiune ortostatic

  • Tratamentul insulinic

    Istoric

    Nicolae Paulescu1869 - 1931

  • F.F.G. BantingC.H. Best

  • J.B. CollipJ.R. MacLeod

  • Clasificarea insulinelorDup provenien - animale

    - de tip uman

    Dup durata de aciune

    - cu aciune rapid (analogi) - cu durat scurt de aciune - cu aciune intermediar - cu durat lung de aciune - insuline premixate

  • Insulinemia plasmatic la persoane cu diabet zaharat tip 1 i subieci sntoi

  • Insulina LISPRO Humalog

  • Analogii rapizi de insulin

    Glulisine

  • Analogii de insulin cu aciune lungInsulina glargine (lantus)Insulina detemir (levemir)

  • Preparate de insulinCu aciune rapid (analogi de insulin):

    - NovoRapid - Humalog - ApidraCu aciune scurt:

    - Actrapid HM - Humulin R - Insuman RapidCu aciune intermediar:

    - Insulatard HM - Humulin N (NPH) - Insuman Bazal

  • Cu aciune lung:

    - Monotard HM - Humulin LAnalogi de insulin cu aciune lung:

    - Lantus - Levemir Insuline premixate:

    - Mixtard 10 50 HM (Mixtard 30 HM) - Humulin M1 5 (Humulin M3) - Insuman Comb 25; Insuman Comb 50Analogi premixai:

    - NovoMix 30 - Humalog Mix 25, Humalog Mix 50

  • Scheme de insulinoterapieConvenional

    Intensificat

  • Insulinoterapia intensificatInsuline prandialeInsuline bazale

  • Administrarea insulineiCile de administrareDispozitivele de administrareAutocontrolul i ajustarea dozelorPompa de insulinIndicaiile insulinoterapiei

  • Indicaiile insulinoterapiei n diabetul zaharat tip 2Meninerea dezechilibrului glicemic n ciuda dozelor maxime de ageni orali combinaiHiperglicemie cu cetonemie i cetonurieDecompensarea generat de evenimente intercurenteManagementul perioperatorSarcina i lactaiaHepatopatii i/sau nefropatiiAlergia sau alte reacii adverse serioase la ADOHiperglicemii importante n momentul prezentrii

  • Efectele secundare ale insulinoterapieiHipoglicemiaLipodistrofiaAbcesele la locul injecieiAlergia la insulinProducia de anticorpi la preparatele insuliniceCreterea n greutateEdemul insulinicNeuropatia dureroasScderea acuitii vizuale

  • Hiperglicemiile matinaleSubinsulinizarea

    Fenomenul Somogyi

    Fenomenul de zori (Dawn phenomenon)

  • Tratamentul cu antidiabetice oraleMedicamente care cresc secreia pancreatic de insulin

    - sulfonilureice - reglatori prandiali ai glicemiei

    Medicamente care scad rezistena la insulin

    - biguanide - tiazolidindione

    Medicamente care scad absorbia intestinal de glucoz

    - inhibitori de alfa-glucozidaz

    Incretinele

    Tratamentul cu preparate non-insulinice

  • Canalul KATP cu cele dou componente: receptorul sulfonilureic (SUR 1) i canalul rectificator de K (Kir 6.2)

    Ansamblul canaluluiComponenta SURMedicamente care cresc secreia pancreatic de insulin (secretagoge)Componenta Kir 6.2

  • nchiderea canalului KATP prin legarea unei molecule de ATP la unul din cele 4 situsuri de pe SUR 1

  • Preparatele sulfonilureice

    Agentul sulfonilureicPreparate comercialeDoza maximGeneraia I - tolbutamid - clorpropamidTolbutamid; 500 mgDiabinese; 250 mg3000 mg500 mgGeneraia a II-a - glibenclamid

    - glipizid - gliclazid - gliquidonaGlibenclamid; 5 mgManinil; 1,75; 3,5 mg

    Glucotrol; 5 i 10 mgDiaprel MR; 30 mgGlurenorm; 30 mg15 mg10,5 mg

    10 mg90 mg90 mgGeneraia a III-a - glimepirideAmaryl; 1, 2, 3 i 4 mg6 mg

  • Reglatorii prandiali ai glicemiei

    Acelai mecanism de aciune ca al sulfonilureicelorDurat scurt de aciuneRisc hipoglicemic redusO mas o doz, nici o mas nici o dozPreparate: - Repaglinida (NovoNorm; 0,5 1 2 mg)

    - Nateglinida (Starlix)

  • Medicamente care scad rezistena la insulin

    Biguanidele

    Mecanism de aciuneEfecte adverseContraindicaiiPreparate:

    - fenformin - metformin: Meguan, Siofor, Metfogamma, Metformin (1 cp = 500 mg, 850 mg; doza maxim = 2550 mg) - buformin: Silubin Retard (1 cp = 100 mg; doza maxim = 300 mg)

  • Tiazolidindionele (glitazonele)Mecanism de aciune: PPAR (peroxisome proliferator activated receptors)

    Efecte adverse

    Preparate:

    - troglitazona - pioglitazona (Actos) (1 cp = 15; 30; 45 mg) - rosiglitazona (Avandia) (1 cp = 4 mg; doza maxim = 8 mg)

  • Medicamente care scad absorbia intestinal de glucoz

    Inhibitorii de alfa-glucozidaz

    Mecanism de aciune

    Efecte adverse

    Preparate

    - acarboza (Glucobay, 1 cp = 50; 100 mg; doza maxim = 300 mg) - miglitolul

  • Sulfonilureice i repaglinidaStimuleaz secreia de insulin.Repaglinida Se administreaz n special la pacienii cu glicemii postprandiale crescute.Locurile de aciune ale agenilor antihiperglicemianiBiguanide (metformin)

    Scad rezistena la insulin n esutul muscular.Scad GNG la niv. ficatului.Inhibitori de glucozidaz(acarboza)

    ntrzie absorbia intestinala carbohidrailor.Tiazolidindione

    Scad rezistena la insulinn esutul adipos i muchi. Scad GNG la nivelul ficatului.

  • 1.bin

  • Incretinele

  • McIntyre et al, 1964D GLUCOZ (mg/dl)D INSULIN (mU/L) Secreia de insulin dup administrarea de glucoz oral / intravenos

  • Efectul incretinicIngestia de glucoz determin un rspuns insulinic mai pronunat dect glucoza administrat intravenos, indicnd prezena unor substane secretate de tractul gastrointestinal care stimuleaz eliberarea de insulin printr-un mecanism glucodependent.Creutzfeldt. Diabetologia 1985; 28: 565

    Major discussion point:

    The incretin effect refers to the stimulation of insulin release by substances originating within the intestines in response to rising blood glucose levels. This results in a more robust insulin response than when glucose is injected into the bloodstream.

    Creutzfeldt W, Ebert R. New developments in the incretin concept. Diabetologia. 1985;28:565-573.

  • Definiia incretinelorGut-derived factors that increase glucose-stimulated insulin secretion

    In cret in Intestine Secretion InsulinCreutzfeldt. Diabetologia 1985; 28: 565

    Major discussion point:

    INtestineSeCRETionINsulin

    Creutzfeldt W, Ebert R. New developments in the incretin concept. Diabetologia. 1985;28:565-573.

  • OralIVInsulin (mU/l)Insulin (mU/l)Persoane sntoasePacieni cu DZ tip 2Timp (min)Timp (min)OralIVEfectul incretinic la persoanele sntoasei la pacienii cu diabet zaharat tip 2

    The incretin effect describes the enhanced secretion of insulin observed following energy (usually glucose) ingestion via the enteral vs. parenteral routes. The incretin effect is diminished in human subjects with type 2 diabetes.

  • Incretinele

    YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNQTIGIP: Gastric Inhibitory PolypeptideGlucose-Dependent Insulinotropic PolypeptideHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGGLP-1: Glucagon-Like Peptide 1Drucker D. Diabetes Care 2003; 26: 2929

    Major discussion point:

    There have been 2 important incretins identified thus far: GLP-1 (glucagon-like peptide 1) and GIP (originally gastric inhibitory polypeptide, but it was later determined that GIP did not inhibit gastric function and the name was changed to glucose-dependent insulinotropic polypeptide, retaining the GIP acronym).

    Both of these peptides share amino acid sequences similar to those found in glucagon.

    Drucker DJ. Enhancing incretin action for the treatment of type 2 diabetes. Diabetes Care. 2003;26:2929-2940.

  • GIPGastric inhibitory polypeptideGlucose-mediated insulinotropic polypeptideGM: 4984

    Eliberare: duoden, jejun, ileonul proximal

    Aciuni: - inhibarea secreiei gastrice acide - stimularea secreiei de insulin - aciuni insulin-like asupra metabolismului lipidic

  • GLP-1Glucagon-like peptide-1GM: aprox. 4000

    Eliberare: intestinul subire distal, colon

    Aciuni: - stimularea secreiei de insulin - inhibarea golirii gastrice - aciuni insulin-like extrapancreatice - inhibarea apetitului

  • GLP-1Celula L GLP-1Glucoza EnterocitPancreas: Insulina Glucagonul

    Stomac: MotilitateaHipotalamus: Apetitul

  • Celula Glucide alimentareGIPGLP-1++ secreia de insulin euglicemieMetabolism glucidic normaldigestieabsorbie

  • Celula GIP GLP-1Diabet zaharat tip 2Glucide alimentareSecreie de insulin hiperglicemie

    GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue

  • Efectul administrrii de GLP-1n diabetul zaharat tip 2

    Nauck M et al. Diabetologia 1993; 36: 741744GlucozInsulinGlucagon

    3002502001501005000601201802401612840GLP-1Placebop

  • IntestinalGLP-1releaseGLP-1 inactiveMealActiveGLP-1DPP-4Eliberare deGLP-1intestinalGLP-1 inactivMasGLP-1 activDPP-4

    . GLP-1Rothenberg P et al. Diabetes 2000; 49 (suppl.1): A39

  • Soluii farmacologice GLP-1 uman recombinant infuzie s.c. continu

    Agoniti de receptor GLP-1

    - Exenatida (Byetta) - Liraglutida

    Inhibitori de DPP-4

    Drucker. Diabetes Care 2003; 26: 2929Dungan. Clin Diabetes 2005; 23: 56

  • Exenatida (Byetta)Gila monster (Heloderma suspectum)Aprobat de FDA (2005) i de EMEA (2006) pt. trat. DZ 2Capt C-terminal bogat n reziduuri de prolinAciune de 10 ori mai intens dect a GLP-1 nativT1/2 mai lung

  • GLP-1 i Exenatida

    Eng L et al. J Biol Chem. 1992; 267: 7402

    Major discussion point:

    This schematic shows the amino acid structures of the primary active form of GLP-1 [GLP-1(736) amide] and exendin-4, a protein isolated from the salivary glands of the Gila monster. Yellow letters indicate similar sequences between the 2 proteins.

    Eng J, Kleinman WA, Singh L, Singh G, Raufman J-P. Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. J Biol Chem. 1992;267:7402-7405.

  • Exenatida (Byetta)Indicat n tratamentul DZ tip 2 necontrolat prin:

    - monoterapie cu metformin, sulfonilureice sau TZD - terapie oral combinat: metformin + sulfonilureice metformin + TZD

    Doza iniial: 5 g x 2/zi

    Adm. sc cu 60 min. naintea meselor principale

    Dup o lun, doza se poate crete la 10 g x 2/zi

  • LiraglutidaDerivat acil al GLP-1

    Adugarea unei grupri de acizi grai activeaz legarea de albuminele plasmatice ntrzie eliminarea renal

    T1/2 ~ 12 ore

    Administrare injectabil o singur dat pe zi

    Knudsen L et al. J Med Chem 2000; 43: 1664-1669

  • Soluii farmacologice GLP-1 uman recombinant infuzie s.c. continu

    Agoniti de receptor GLP-1

    - Exenatida (Byetta, Bydureon) - Liraglutida

    Inhibitori de DPP-IV

    Drucker. Diabetes Care 2003; 26: 2929Dungan. Clin Diabetes 2005; 23: 56

  • IntestinalGLP-1releaseGLP-1 inactiveMealActiveGLP-1DPP-4GLP-1 inactivMasGLP-1 activDPP-4

    GLP-1Rothenberg P et al. Diabetes 2000; 49 (suppl. 1): A39Inhibitor deDPP-4Eliberare deGLP-1intestinal

  • Inhibitori de DPP-4Sitagliptina (Januvia)

    - inhibitor competitiv, reversibil i nalt selectiv al DPP-4 - aprobat de FDA (2006) i de ANM (2007) pt. trat. DZ 2

    Vildagliptina (Glavus)

    - se leag de DPP-4 complex inactiv

  • Sitagliptina (Januvia)Indicat n tratamentul DZ tip 2 necontrolat prin:

    - monoterapie cu metformin, sulfonilureice sau TZD - terapie oral combinat: metformin + sulfonilureice

    Doza recomandat: 100 mg/zi (doz unic), indiferent de orarul meselor

  • Efecte adverse ale incretinelorAnalogii de GLP-1

    - greuri i vrsturi (50% dintre pacieni) - dependente de doz - se amelioreaz pe parcursul tratamentului - diaree - hipoglicemii uoare i moderate (cnd se asociaz cu SU)

    Inhibitorii de DPP-4

    - cefalee - susceptibilitate pentru infecii de ci aeriene superioare

  • Algoritmul de tratament n DZ 2Dieta i exerciiul fizic

    Antidiabetice orale

    Asocieri de antidiabetice orale

    Insulin antidiabetice orale

  • Preparate combinate de ADOPreparate combinate glibenclamid + metformin

    Glibomet 2,5 mg/400 mg Glucovance 2,5 mg/500 mg 5 mg/500 mgPreparate combinate TZD + metformin

    Avandamet 1 mg/500 mg Competact 15 mg/850 mg 2 mg/1000 mg 2 mg/500 mg 4 mg/1000 mgPreparate combinate inhibitori DPP-4 + metformin

    Janumet 50 mg/850 mg 50 mg/1000 mg

  • Dislipidemiile

  • Definirea termenilorDislipidemii

    Hiperlipidemii

    Valorile normale

    - colesterol seric total < 190 mg/dl (< 5 mmol/l) - trigliceride serice < 180 mg/dl (< 2 mmol/l) - colesterol - HDL > 40 mg/dl (> 1 mmol/l) - colesterol - LDL < 115 mg/dl (< 3 mmol/l)

    Obiectivele terapeutice

  • Importana dislipidemiilorImpactul epidemiologic

    - boli populaionale - n Romnia: 55% din populaia ntre 20 i 60 ani

    Impactul biologic: risc cardio-vascular

    risc de pancreatit acut

    Impactul economic

  • Lipoproteinele Asocieri moleculare dintre diferite componente lipidice sanguine (TG, colesterol, fosfolipide, AG) i proteinele circulanteConstituite din:

    - partea transportat: AG esterificai sub form de TG i esteri de colesterol - transportorul: apoproteineRolul apoproteinelor:

    - structural - funcional: legarea de receptori activarea sau inhibarea unor enzime (LPL, LCAT)

  • Clase majore lipoproteiceChilomicronii 90% TG

    VLDL 60% TG, 12% colesterol

    IDL forme tranzitorii; 30% colesterol, 40% TG

    LDL 60% colesterol

    - fenotip A - fenotip B - fenotip intermediar

    HDL

  • Clasificarea dislipidemiilor (Frederickson)Tipul I chilomicronemie bazalTipul IIa hiper - LDLTipul IIb hiper - LDL i hiper - VLDLTipul III cu IDL n condiii bazaleTipul IV hiper VLDLTipul V chilomicronemie bazal + hiper - VLDL

    Tipul VI hiper - HDL

  • Clasificarea dislipidemiilor (Asociaia European de ateroscleroz)

    Forma de dislipidemieColesterolTrigliceride Hipercolesterolemie - de grani - moderat - sever190-249250-300> 300< 180< 180< 180Hipertrigliceridemie - moderat - sever< 190< 190180-400> 400Hiperlipidemie mixt - moderat - sever190-300> 300180-400> 400

  • Etiopatogenia dislipidemiilorFactori genetici

    - defect cromozomial monogenic (ex. HLP tip IIa) - defect cromozomial poligenic

    Factori ctigai

    - excesele alimentare - abuzul de alcool - fumatul - sedentarismul - stress-ul - obezitatea - diverse boli: DZ dezechilibrat, hipotiroidismul, sdr. nefrotic - unele medicamente: corticoizii, contraceptivele orale

  • Tablou clinicXantoame de tip eruptiv, tendinos, tuberos, palmarXantelasmaArc corneanLipemia retinalisDureri abdominale, manifestri de pancreatitManifestri ale ATS cerebrale, coronariene i perifericeSimptome osteo-articulare (rar)

  • Investigaii paracliniceAprecierea aspectului plasmei sau serului dup 24 de ore de la recoltare i pstrare la frigider (+ 40C)Dozarea colesterolului total i a TGDozarea HDL-colesteroluluiCalculul LDL-colesterolului (formula lui Friedwald):

    LDL-col = colesterol total HDL-col TG/5 (mg/dl) LDL-col = colesterol total HDL-col TG/2,2 (mmol/l) Condiie: TG < 400 mg/dl Alte metode (electroforeza, ultracentrifugarea, dozarea apoproteinelor)

  • Depistarea dislipidemiilorIdeal: screening sistematic la ntreaga populaie cu vrsta > 20 ani

    Practic: la grupele cu risc crescut

  • Grupele cu risc crescut la care se recomand depistarea dislipidemiilorBolnavi cu boli cardio-vasculare aterosclerotice

    Persoane cu factori de risc cardiovascular

    Persoane cu arc cornean sau xantomatoz

    Rudele de gradul I ale persoanelor de la punctele 1 i 2

  • Depistarea complet

    - determinarea CT, TG, HDL-col - recoltare dimineaa, dup 8-12 ore de post - recomandat la persoane cu boli cardio - vasculare ATS DZ xantomatoz

    Depistarea parial

    - determinarea doar a colesterolului total - recoltare n orice moment al zilei - recomandat la persoanele care au i ali factori de risc rudele de gradul I ale celor cu BCV ATS alte persoane care se prezint la consultaie

  • Dislipidemiile aterogeneHipercolesterolemie de grani (190-249 mg/dl)Hipertrigliceridemie > 180 mg/dlScderea colesterolului HDL < 40 mg/dl la brbai

    < 50 mg/dl la femeiModificarea LDL care devin mici i dense

  • Dislipidemiile secundareHipercolesterolemii hipotiroidie, colestaz, sindrom nefrotic, sarcin, medicaie cu tiazide i progesteron

    Hipertrigliceridemie DZ necontrolat, sindrom nefrotic, insuficien renal cronic, paraproteinemie

    Hiperlipidemie mixt DZ necontrolat, sindrom nefrotic, medicaie cu tiazide, corticosteroizi, progestageni

  • Complicaii i asocieri morbidePatologia cardio-vascular ateroscleroticPancreatita acutDiabetul zaharatObezitateaHipertensiunea arterialSindromul X metabolic

  • Management-ul dislipidemiilorStabilirea obiectivelorOptimizarea stilului de via

    - dieta hipolipidic - exerciiul fizicTratamentul medicamentos

  • Principiile dietei hipolipidiceAdaptarea aportului caloric n funcie de necesiti i greutatea corporalReducerea aportului caloric provenit din lipide < 30%Scderea lipidelor saturate la 1/3 din totalul lipidelorLipidele mononesaturate i cele polinesaturate (forma cis) vor reprezenta baza aportului lipidic (cte 1/3)Scderea aportului de colesterol < 300 mg/ziCreterea aportului de glucide complexe (50-55%)Fibrele alimentare 20-30 g/ziGlucidele simple 10% din necesarul caloricAlcoolul va fi suspendat sau mult limitatEvitarea fumatului

  • Dieta trebuie negociat cu pacientulControl la 3 luniScade colesterolul cu 10-20%

    Exerciiul fizic

    Scade triglicerideleCrete HDL-colesterolul

  • Tratamentul medicamentosFibraii Mecanism de aciune

    - PPAR exprimarea genei LPL exprimarea genei Apo A I i Apo A II diminuarea genei Apo C activeaz LPL stimuleaz catabolismul LDL i VLDL inhib lipoliza TG din adipocite concentraia LDL mici i dense HDL de volum crescut hiperlipemia postprandial fibrinogenul efect antitrombogen

  • Efecte secundare - disconfort abdominal, greuri, erupii, mialgii (miopatie), efectul anticoagulantelor

    Contraindicaii - insuficien hepatic, renal, sindrom nefrotic, sarcin, alptare

    Monitorizare - teste funcionale hepatice, creatin-kinaza

    Preparate - fenofibrat, bezafibrat, ciprofibrat, gemfibrozil

  • Tratamentul medicamentos Statinele Mecanism de aciune

    - inhib HMG-CoA reductaza, deci sinteza colesterolului - sinteza receptorilor LDL, deci catabolizarea acestuia - procentul de LDL mici i dense - oxidabilitatea LDL - fibrinogenul, Lp(a), PAI-1 efecte favorabile pe sistemul de coagulare-fibrinoliz

    Efecte secundare flatulen, enzimelor hepatice i musculare, erupii

  • Contraindicaii boli hepatice active, sarcin, alptare

    Monitorizare - teste funcionale hepatice, creatin-kinaza

    Preparate - rosuvastatin, atorvastatin, simvastatin, pravastatin, lovastatin, fluvastatin

  • Indicaii de utilizare a claselor de hipolipemianteAsocieri medicamentoase recomandate Colestiramin + statine Fibrai + statine

    Tipul de hiperlipidemiePrima alegereAlternativ Hipercolesterolemie StatineRezine, acid nicotinic, fibraiHipertrigliceridemie Fibrai Acid nicotinic, ulei de peteHiperlipidemie mixtFibrai, statineAcid nicotinic

  • Obezitatea

  • Definiie - obezitatea este o boal caracterizat prin creterea greutii corporale pe seama esutului adipos

    Etimologie - obedo-obedere (lat) = a mnca n exces, a mnca mult i lacom

    Prevalen - n lume > 250 milioane obezi

    - n 2025 > 300 milioane obezi

  • Prevalena supraponderii i a obezitii n rile europene

  • Obezitatea problem major de sntate publicPrevalen crescut la nivel populaional

    Costuri directe i indirecte ridicate implicate de ngrijirea obezitii

    Complicaii multiple

  • Formule de calcul a greutii idealeFormula lui Broca: GI = I 100

    Formula lui Lorentz: GI = (I 100) (I 150)/4 (B)

    GI = (I - 100) (I 150)/2 (F)

    Formula Societii Asigurrilor Metropolitane din New York:

    GI = 50 + 0,75(I 150) + (V 20)/4 (B) F: GI (B) X 0,9

  • Indici de apreciere a obezitiiIndicele de mas corporal:

    IMC = G/I2 (n = 18,5 24,9 kg/m2)Indicele abdomino-fesier:

    IAF = CA / CF (F: IAF < 0,85; B: IAF < 0,95)Indicele abdominal:

    IA = CA / I (n < 0,5)Grosimea paniculului adipos n regiunea tricipital:

    n < 20 mm (B); n < 30 mm (F)CA: n < 94 cm (B); n < 80 cm (F)

  • Clasificarea greutii n funcie de valorile IMC (Kg/m2)

    Subponderal< 18,5Normal18,5 - 24,9Supraponderal25 29,9Obezitate gradul I30 34,9Obezitate gradul II35 39,9Obezitate gradul III 40

  • Clasificarea obezitii n funcie de distribuia esutului adipos

    Riscul cardiovascular n funcie de talie i sex

    Tipul obezitiiTalia (cm) BTalia (cm) FAbdominal Gluteo-femural 94< 94 80< 80

    Risc sczutRisc probabilRisc certBrbai< 9494 101 102Femei< 8080 87 88

  • Clasificarea obezitiiCriteriul etiopatogenic

    - obezitate primar - obezitate secundar

    Criteriul histologic

    - obezitate hiperplazic - obezitate hipertrofic - obezitate mixt

    Criteriul evolutiv

    - obezitate dinamic (faza de acumulare) - obezitate static (de regul cnd a atins maximul ponderal)

  • Organismul normoponderal adult

    EA = EC (MB + TM + TR + ADS)

    Organismul obez

    EA = EC + ED

    EA = energie de aport EC = energie de consum MB = energie consumat pentru nevoile bazale TM = travaliu muscular TR = energie de termoreglare ADS = aciunea dinamic specific a alimentelor

  • Principalii factori de risc obezogen (1)Factori genetici istoric familial de obezitate

    Subnutriia mamei gestante, greutate mic la natere a ftului

    Stil de via nesntos alimentaie hipercaloric, alcool, sedentarism, stress

    Factori psihologici, sociali i culturali

    - depresia, anxietatea tulburri de comportament alimentar - urbanizarea - obiceiuri alimentare nesntoase - lipsa aciunilor de educaie i prevenire la nivel populaional - mentaliti greite

  • Principalii factori de risc obezogen (2)Tulburri de comportament alimentar gustri interprandiale de alimente bogate caloric, bulimie, binge eating, night eating, carbohydrate-craving

    Factori fiziologici sarcin, lactaie, menopauz

    Factori endocrini i hipotalamici

    Medicamente

    Ali factori ntreruperea fumatului n absena unei diete corespunztoare

  • Mortalitatea Riscul cel mai mic: IMC = 20 25 27 Kg/m2 excesiv la IMC > 30 Kg/m2IMC sczut neoplasmeIMC crescut boli cardio-vasculareDurata medie de supravieuire cu 10 ani mai micEfectul fluctuaiilor greutii

  • Complicaiile cardio-vasculare ale obezitiiBoala coronarian

    Insuficiena cardiac

    Aritmiile i moartea subit

    Hipertensiunea arterial

    Varicele membrelor inferioare

  • Complicaiile respiratorii ale obezitii Hipoventilaie hipoxie i hipercapnie tulburri nervoase centrale (somnolen, convulsii)Hipoxemia poliglobulie secundar volumul sanguin HTP CPC IVD ICCG1956, Burnwell Sdr. Pickwick obezitate marcat, hipoventilaie, somnolen, uneori convulsii, cianoz, respiraie periodic, policitemie secundar, HVD, CPC decompensatPneumopatii acute i broniteDispnee, chiar n lipsa insuficienei cardiaceSindromul apneei n timpul somnului

  • Complicaiile digestive ale obezitiiLitiaza biliarAngiocolecistiteHerniile hiatal, inghinal, ombilicalSteatoza hepaticHemoroizi

    Tulburri endocrineDistrofie ovarian (ovare polichistice)Tulburri ale ciclului menstrualHiperestrogenism i hiperandrogenism la femeiHipogonadism la brbai

    CancereleLa B: prostat, colorectalLa F: endometru, sn, ci biliare, col uterin, ovar

  • Complicaiile metabolice ale obezitiiDiabetul zaharatHiperlipidemiaHiperuricemia

    Complicaiile la nivelul aparatului locomotorReumatism cronic degenerativOsteoartrite de old i de genunchiBoli periarticulare tendinite

    Complicaiile neurologice i psihiceCefalee, vertij, astenie fizicTulburri psihice

  • Complicaiile chirurgicale ale obezitiiRisc chirurgical i anestezic mai mareRisc de insuficien respiratorie, infecii ale plgilor, dehiscena plgilor, tromboflebite postoperatorii

    Complicaiile obstetricale ale obezitiiEclampsie, varice, tromboflebite, infecii urinare, diabet gestaional, mortalitate fetal crescutDistocii Retracie uterin ntrziat hemoragii, oc; endometrite, accidente mamare, pielonefrite

    Complicaiile cutanateInfecii microbiene i fungice (intertrigo inghinal, axilar)Eczeme

  • Tratamentul obezitii n funcie de IMC

    IMC (kg/m2)

    Co-morbiditi

    Tratament

    > 27

    Da sau nu

    Educaie privind schimbarea stilului de via

    > 30

    Nu

    Educaie i program de modificare a obiceiurilor

    > 30

    Da

    Educaie, program de modificare a obiceiurilor i medicamente

    > 35

    Da sau nu

    Diet hipocaloric, medicamente

    > 40

    Da

    Toate cele enumerate anterior i metode chirurgicale

  • Principiile tratamentului dietetic n obezitateGlucide: 55-58%Proteine: 15-17%Lipide: 27-28%NaCl: < 6 gFibre alimentare: 20-30 gColesterol: < 300 mgLichide: > 2 litri

    5 mese pe ziMic dejun: 20%Gustare: 15%Prnz: 30%Gustare: 15%Cina: 20%

  • Tipuri de diete utilizate n obezitateDieta cu deficit de 500 kcal/ziDieta cu deficit de 1000 kcal/ziDieta hipocaloric standard de 1200-1300 kcal/ziReducerea la jumtate din aportul caloric anteriorDietele foarte hipocalorice sau restrictive sub 800 kcal/zi

  • Rolul efortului fizic n tratamentul obezitiiCrete sensibilitatea esuturilor la insulinDetermin scdere n greutate i menine

    greutatea dorit Scade riscul cardiovascularScade necesarul de ageni farmacologiciCrete capacitatea de efortCrete calitatea vieii

  • Tratamentul medicamentos al obezitiiOrlistat (Xenical)Inhib selectiv lipaza gastrointestinal absorbia grsimilor cu 30% (TG i colesterol)

  • Aciuni i efecte

    - reducerea greutii pe seama masei grase - reducerea taliei i a IMC - reducerea RCV prin reducerea celorlali FR ( col total, LDL, TG, ameliorarea toleranei la glucoz, a TA)

    Reacii adverse

    - digestive (n condiiile unui aport lipidic crescut) - nivelului plasmatic al vitaminelor liposolubile

    Contraindicaii sindrom de malabsorbie

    Posologie 3 x 120 mg / zi la mesele principale

  • Tratamentul chirurgical al obezitiiIndicaii

    IMC 40 kg/m2IMC 35 kg/m2 cu comorbiditiVrsta ntre 18 i 60 aniEecul tratamentului conservator aplicat cel puin un anPacient care va coopera pe termen lung dup operaie

  • Tratamentul chirurgical al obezitiiContraindicaii

    IMC < 35 kg/m2Vrsta sub 18 ani sau peste 60 de aniObezitate de cauz endocrinDependena de droguri sau alcoolRisc operator inacceptabilBoli asociate grave: hepatopatie, cardiopatie, patologie digestiv

  • Tehnici chirurgicaleTehnici restrictive

    - gastroplastia orizontal - gastroplastia vertical - bandingul gastric

    Tehnici de malabsorbie

    - by-pass-ul jejunoileal - by-pass-ul bilio-intestinal - by-pass-ul bilio-pancreatic

  • Hiperuricemiile

  • Definirea termenilorHiperuricemia Artrita acut uricArtrita gutoas cronic i tofii gutoi

    (guta cronic tofacee)Nefropatia uricLitiaza renal uric

  • Epidemiologie Prevalena hiperuricemiilor - 2 18%

    - n Romnia 4,2% la aduli

    Prevalena gutei - 0,13 0,37%

    - 2 5% din totalul artropatiilor

    Sexotropism masculin

    Vrf de inciden - decada a 5-a de vrst

  • Clasificarea hiperuricemiilorPrimare

    - Idiopatic (> 99%) - Defecte metabolice specifice motenite (

  • Tratamentul dietetic n hiperuricemiiDiet srac n purineTratamentul obezitiiReducerea consumului de alcoolDiet lacto-fructo-zaharat

  • Tratamentul atacului acut de gutColchicinaAINSGlucocorticoizii (po sau intraarticular)NU hipouricemianteProfilaxia recurenelor

  • Prevenirea formrii depozitelor tisulare de urai i diminuarea sau dispariia celor constituiteInhibitorii biosintezei acidului uric

    - allopurinol, oxipurinol, tiopurinol

    Medicaia uricoeliminatoare

    - probenecidul - benziodarona - sulfinpirazona

  • Sindromul metabolic

  • Definiia sindromului metabolic (IDF, 2005)Obezitate abdominal (CA 94 cm la B / 80 cm la F) +Oricare 2 din urmtoarele 4 elemente:

    TG 150 mg/dlHDL < 40 mg/dl la B i < 50 mg/dl la FTAs 130 mm Hg sau TAd 85 mm HgGlicemie a jeun 100 mg/dl

    Major discussion point:

    The incretin effect refers to the stimulation of insulin release by substances originating within the intestines in response to rising blood glucose levels. This results in a more robust insulin response than when glucose is injected into the bloodstream.

    Creutzfeldt W, Ebert R. New developments in the incretin concept. Diabetologia. 1985;28:565-573. Major discussion point:

    INtestineSeCRETionINsulin

    Creutzfeldt W, Ebert R. New developments in the incretin concept. Diabetologia. 1985;28:565-573.The incretin effect describes the enhanced secretion of insulin observed following energy (usually glucose) ingestion via the enteral vs. parenteral routes. The incretin effect is diminished in human subjects with type 2 diabetes. Major discussion point:

    There have been 2 important incretins identified thus far: GLP-1 (glucagon-like peptide 1) and GIP (originally gastric inhibitory polypeptide, but it was later determined that GIP did not inhibit gastric function and the name was changed to glucose-dependent insulinotropic polypeptide, retaining the GIP acronym).

    Both of these peptides share amino acid sequences similar to those found in glucagon.

    Drucker DJ. Enhancing incretin action for the treatment of type 2 diabetes. Diabetes Care. 2003;26:2929-2940.

    GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue GIP:Scrtion normale ou mme augmenteRponse insulinotrope GIP trs diminue

    Major discussion point:

    This schematic shows the amino acid structures of the primary active form of GLP-1 [GLP-1(736) amide] and exendin-4, a protein isolated from the salivary glands of the Gila monster. Yellow letters indicate similar sequences between the 2 proteins.

    Eng J, Kleinman WA, Singh L, Singh G, Raufman J-P. Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. J Biol Chem. 1992;267:7402-7405.