diabetul zaharat -

Download Diabetul Zaharat -

Post on 03-Jun-2018

222 views

Category:

Documents

2 download

Embed Size (px)

TRANSCRIPT

  • 8/11/2019 Diabetul Zaharat -

    1/250

    Diabetul zaharat

  • 8/11/2019 Diabetul Zaharat -

    2/250

    Definiie

    Sindrom heterogen caracterizat printr-o tulburare

    complex n reglarea metabolismului energetic al

    organismului, care afecteaz deopotriv utilizarea

    glucidelor, lipidelor i proteinelor, precum i celelaltemetabolisme; aceste alterri sunt datorate insuficienei

    absolute sau relative de insulin. Modificrilebiochimice pe

    care aceste tulburri le antreneaz conduc la modificri

    celulare funcionaleurmate de leziuni anatomice ireversibile

    n numeroase esuturiiorgane.

  • 8/11/2019 Diabetul Zaharat -

    3/250

  • 8/11/2019 Diabetul Zaharat -

    4/250

    Etimologie

    Diabeiu(greaca veche) = a se scurge ca printr-un sifon(aluzie la poliuria marcat a acestor pacieni)

    Thomas Willis (medic, anatomist i profesor la Oxford)- 1674 - a descoperit c urina este dulce

    - a adugat cuvntul mellitus(ca mierea)

    Diabetes mellitus(Diabet zaharat)

  • 8/11/2019 Diabetul Zaharat -

    5/250

    Context epidemiologic

    25.039.759%

    10.419.788%

    38.244.216%

    1.1

    1.759%

    13.626.998%

    n lume2003 = 189 milioane2025 = 333 milioane

    cretere 72%

    81.8156.191%

    18.235.997%

  • 8/11/2019 Diabetul Zaharat -

    6/250

    Tendine epidemiologice ale diabetului n lume

    Prevalena DZ a crescut peste tot n lume, creterea fiindmai evidentdup1990:

    - 1990127 milioane diabetici

    - 2000151 milioane diabetici

    - 2010285 milioane diabetici (6,6% dintre aduli)

    Congres IDF Dubai decembrie 2011

    - 2011366 milioane diabetici8,3% din populaia adult a planetei

    - 2030552 milioane diabetici

    un adult din 10 va avea diabet zaharat

  • 8/11/2019 Diabetul Zaharat -

    7/250

  • 8/11/2019 Diabetul Zaharat -

    8/250

    Pancreasul endocrin - noiuni de anatomie ifiziologie

    Insulele Langerhans

    800.0001.500.000

    12 % din masa

    pancreatic total

    Celule: A, B, C, D

  • 8/11/2019 Diabetul Zaharat -

    9/250

  • 8/11/2019 Diabetul Zaharat -

    10/250

    Hormonii secretai n celulele insulelor

    Langerhans

    Tipulcelular

    Hormonulprodus

    Efect pe metabolismul glucidic

    A Glucagon Hiperglicemiant prin glicogenoliz

    B Insulin

    Peptidul C

    Amilin

    Hipoglicemiant prin mec. multiple

    Efecte metab. incomplet cunoscute

    Hiperglicemiant

    C(PP) Polipeptidpancreatic

    Influen pe motilitatea gastric iabsorbia principiilor nutritive

    D Somatostatin Hiperglicemiant, inhib secreiainsulinei

  • 8/11/2019 Diabetul Zaharat -

    11/250

  • 8/11/2019 Diabetul Zaharat -

    12/250

    Secreia insulinei

  • 8/11/2019 Diabetul Zaharat -

    13/250

    Secreia insulinei

    bazal insulinemia plasmatic = 10-12 U/ml

    stimulat insulinemia plasmatic 50-75 U/ml

  • 8/11/2019 Diabetul Zaharat -

    14/250

    Receptorul de insulin

  • 8/11/2019 Diabetul Zaharat -

    15/250

  • 8/11/2019 Diabetul Zaharat -

    16/250

    Controlul hormonal al glicemiei

    Insulina

    Efect net: scderea glicemiei

    Hormoni de contrareglare

    Efect net: creterea glicemiei

    nlturrii glucozei din snge

    -intrrii glucozei n celule

    -glicogenezei

    eliberrii glucozei dindepozite

    -

    glicogenolizei-gluconeogenezei

    -lipolizei i cetogenezei

    -catabolismului proteic

    nlturrii glucozei din snge

    -intrrii glucozei n celule

    -glicogenezei

    eliberrii glucozei dindepozite

    -

    glicogenolizei-gluconeogenezei

    -lipolizei i cetogenezei

    -catabolismului proteic

  • 8/11/2019 Diabetul Zaharat -

    17/250

    Clasificarea DZ (OMS,1998)

    DZ tip 1 - autoimun

    - idiopatic

    DZ tip 2

    Alte tipuri specifice - defecte genetice ale celulelor

    - defecte genetice ale aciunii insulinei- boli ale pancreasului exocrin- endocrinopatii- medicamente i substane chimice- infecii- forme rare de diabet imun- sindroame genetice rare

    Diabetul gestaional

  • 8/11/2019 Diabetul Zaharat -

    18/250

    Diabetul zaharat tip 1

    Poate apare la orice vrst,dar mai frecvent sub 30 ani Dei exist o predispoziie genetic, majoritatea

    pacienilornu au antecedente familiale de DZ

    Debut relativ abrupt, cu simptome evidente itendinla

    cetoacidoz De obicei, pacieniisunt slabi

    Rezultn urma distrugerii celulelor -pancreatice

    Insulina plasmaticeste foarte redussau absent

    Anticorpi circulani: antiinsulin,anticelule , anti-GAD

    Pacieniisunt dependenide insulin

  • 8/11/2019 Diabetul Zaharat -

    19/250

    Etiopatogenia DZ 1 autoimun

    Predispoziie genetic

    Factor de mediu (viral, toxic, alimentar)

    Activare autoimun insulit

    Scderea capacitii -secretoare; afectarea fazei secretorii

    iniiale, dar insulinemia plasmatic este normal

    Diabet clinic manifest; insulinemie plasmatic sczut,

    hiperglicemie, apar simptomele Apariia complicaiilor

  • 8/11/2019 Diabetul Zaharat -

    20/250

    Diabetul zaharat tip 2

    Apare, de obicei, dupvrsta de 40 ani 80% din cazuri: obezi

    Perioadprediagnosticlung

    Simptomatologie de debut tears sau absent, frtendinla cetoacidoz

    Asocierea a doudefecte celulare: rezistenala insulinideficienafunciei-celulare

    Cel puin iniial, capacitatea secretorie -pancreaticeste relativ pstrat, rspunznd bine la dietiADO;ulterior, unii vor necesita insulinoterapie

  • 8/11/2019 Diabetul Zaharat -

    21/250

    Etiopatogenia DZ 2

    Facto r i genetic itransmitere poligenic

    Rezisten crescut la aciunea insulinei

    Hiperinsulinism funcional

    Deficien n secreia insulinic hipergl icemiepersistent

    Scderea absoluta secreiei insulinice DZ 2 insul ino necesitant

  • 8/11/2019 Diabetul Zaharat -

    22/250

    Clasificarea DZ (OMS,1998)

    DZ tip 1autoimun (1A)

    - idiopatic (1B)

    DZ tip 2

    Alte tipuri specifice - defecte genetice ale celulelor

    - defecte genetice ale aciunii insulinei- boli ale pancreasului exocrin- endocrinopatii- medicamente i substane chimice- infecii- forme rare de diabet imun- sindroame genetice rare

    Diabetul gestaional

  • 8/11/2019 Diabetul Zaharat -

    23/250

    Diagnosticul clinic al DZ

    Poliurie

    Polidipsie

    Polifagie

    Scdere ponderal

    Astenie

  • 8/11/2019 Diabetul Zaharat -

    24/250

  • 8/11/2019 Diabetul Zaharat -

    25/250

    Criterii de diagnosticare a DZ(diagnosticul paraclinic)

    Cel puin dou glicemii a jeun 126 mg/dl (7 mmol/l)sau

    Prezena simptomelor i o glicemie ntmpltoare (n

    orice moment al zilei) 200 mg/dl (11,1 mmol/l)sau O glicemie 200 mg/dl (11,1 mmol/l) la 2 ore dup

    administrarea a 75 g glucoz (TTGO)

    N.B. - glicozuria NUeste un criteriu de dg.- NUse recomand ca dg. de DZ s se bazeze pe

    glicemii efectuate pe glucometre- HbA1cNUse folosete pentru diagnosticulDZ

  • 8/11/2019 Diabetul Zaharat -

    26/250

    Glucoza plasmatic versus glucoza din

    sngele total

    Glucoza din plasm Glucoza din sngele total

    126 mg/dl (7 mmol/l) 110 mg/dl (6,1 mmol/l)

    200 mg/dl (11,1 mmol/l) 171 mg/dl (9,5 mmol/l)

  • 8/11/2019 Diabetul Zaharat -

    27/250

    Criterii de interpretare a glicemiei bazale

    70-110 mg/dlnormal

    110-125 mg/dlglicemie bazal modificat

    126 mg/dl d iabet zaharatprobabil;

    confirmarea se face dup a doua dozare

  • 8/11/2019 Diabetul Zaharat -

    28/250

    Criterii de interpretare a TTGO

    Glicemie n plasma venoas

    Diabet zaharat- bazal- la 2 h dup glucoz

    126 mg/dl (7 mmol/l) 200 mg/dl (11,1 mmol/l)

    Scderea toleranei laglucoz- bazal- la 2 h dup glucoz

    < 126 mg/dl (7 mmol/l) 140 mg/dl (7,8 mmol/l) i

  • 8/11/2019 Diabetul Zaharat -

    29/250

    Modaliti de debut i de diagnostic ale DZ

    Pacient simptomatic

    - simptomele clasice de diabet

    - simptome ale complicaiilor - acute

    - cronice

    Pacient asimptomatic

    - bilan al strii de sntate

    - depistare activ la subieci cu risc

  • 8/11/2019 Diabetul Zaharat -

    30/250

    Indicaiile screening-ului pentru DZ 2 la subieciiasimptomatici cu ajutorul glicemiei bazale

    Toi subiecii cu vrsta 45 ani; se va repeta la intervale de3 ani

    Testarea se va face la vrste sub 45 ani i se va repeta laintervale mai scurte la:

    - persoane cu IMC 27 kg/m2- cei care au rude de gradul I cu DZ

    - grupuri etnice cu risc crescut

    - femeile care au nscut copii cu greutatea peste 4,5 kg

    - femeile care au avut diabet gestaional- hipertensivii; cei cu HDL 35 mg/dl i/sau TG 250 mg/dl

    - sedentarii

    - cei cu GBM sau cu STG la testri anterioare

  • 8/11/2019 Diabetul Zaharat -

    31/250

    Complicaiile DZ

    Acute

    - infeciile

    - comele - hiperglicemice - cetoacidozic

    - hiperosmolar- lactacidemic

    - hipoglicemic

    Cronice

    - microangiopatice- macroangiopatice

    - neuropatice

  • 8/11/2019 Diabetul Zaharat -

    32/250

    Infeciile

    Frecvente la diabeticul dezechilibrat

    Predispoziia ctre infecii explicat prin modificri legate

    de hiperglicemie:- mobilizrii i chemotactismului leucocitar

    - capacitii fagocitare a polimorfonuclearelor

    - capacitii bactericide a polimorfonuclearelor

    - funciilor monocitare

  • 8/11/2019 Diabetul Zaharat -

    33/250

    Infecii puternic asociate diabetului (quasi-specifice),severe, dar foarte rare:- mucormicozele

    - otita extern malign- pielonefrita emfizematoas- colecistita emfizematoas

    Infecii postterapeutice:

    - abcese insulinice, infecii asociate transplantului renal,dializei peritoneale, hemodializei

    Infecii nespecifice asociate DZ:- infecii urinare: cistite, pielonefrite, abcese renale/perirenale

    - infecii respiratorii- infecii cutanate, mucoase, ale esutului celular s.c.- altele: fasceita necrozant, gangrena Fournier a organelorgenitale

  • 8/11/2019 Diabetul Zaharat -

    34/250

    Hipoglicemiile

    Definiiescderea valorilor glicemiei sub 60 mg/dl nplasma venoas (sub 50 mg/dl n sngele venos total)

    Clasificare- uoare

    - medii

    - severe

    Cauze - exces de insulin sau de ADO secretagoge

    - scderea aportului glucidic- efort fizic excesiv

    - consumul de alcool

  • 8/11/2019 Diabetul Zaharat -

    35/250

    Mecanismele de aprare mpotriva hipoglicemiei- scderea secreiei de insulin- creterea secreiei pancreatice de glucagon- stimulare simpatic secreiei de catecolamine- creterea secreiei de cortizol i h. de cretere

    Simptome- periferice- centrale

    Cazuri particulare- hipoglicemiile necontientizate-hipoglicemiile nocturne

  • 8/11/2019 Diabetul Zaharat -

    36/250

    Complicaiile hipoglicemiilor

    Accident vascular cerebral

    Infarct de miocard

    Tulburri funcionale cerebrale minore

    Encefalopatia posthipoglicemic

    Hemoragii retiniene masive

    Decerebrare

  • 8/11/2019 Diabetul Zaharat -

    37/250

    Tratamentul hipoglicemiilor

    Tratament preventiveducaia pacientului diabetic

    Tratament curativ

    - hipoglicemiile uoare i medii- glucide rapid + lent absorbabile

    - hipoglicemiile severe

    - glucoz i.v.- glucagon

    - glucide rapid + lent absorbabile

  • 8/11/2019 Diabetul Zaharat -

    38/250

  • 8/11/2019 Diabetul Zaharat -

    39/250

    Lipoliz

    Hiperproduciedecorpi cetonici

    Acidozmetabolic

    Pierdere de ap, K+ PO-4,baze tampon

    Proteoliz

    Eliberarea de alanin

    ialiaminoacizi

    Creterea ureei

    Insuficien absolut sau relativde insulin

    Accelerarea glicogenolizei ineoglucogenezei

    Hiperglicemie iglicozurie

    Poliurie osmotic

    Deshidratare

    Hiperosmolaritate

    Sete

    PolidipsieAritmieColaps

    COM

    Fiziopatologia cetoacidozei diabetice

  • 8/11/2019 Diabetul Zaharat -

    40/250

    Insulinodeficiena absolut

    - ntreruperea insulinoterapiei

    - cetoacidoz inaugural (20%)

    Insulinodeficiena relativ

    - afeciuni intercurente

    - endocrinopatii: tireotoxicoza, sdr. Cushing, acromegalia

    - iatrogen (corticoizi, simpatomimetice)- sarcin

    - stress

    Cauzele cetoacidozei diabetice

  • 8/11/2019 Diabetul Zaharat -

    41/250

  • 8/11/2019 Diabetul Zaharat -

    42/250

  • 8/11/2019 Diabetul Zaharat -

    43/250

    Tratamentul cetozei incipiente

    Creterea dozelor de insulin

    Hidratare corespunztoare

    Buturi reci ndulcite cu zahr sau glucoz,

    n cantiti mici i la intervale scurte

    Sucuri de fructe, supe de legume, ceai cu zahr, compot

    Scderea grsimilordin alimentaie

  • 8/11/2019 Diabetul Zaharat -

    44/250

  • 8/11/2019 Diabetul Zaharat -

    45/250

    Mortalitatea n CAD sever

    < 0,5% n comele simple

    515% n comele complicate

    45% cnd este abolit starea de contien

  • 8/11/2019 Diabetul Zaharat -

    46/250

    Coma hiperosmolar

    DefiniieAbsena cetoacidozei la un diabetic care are oosmolaritate plasmatic hiperglicemic sau mixt

    (hiperglicemicihipernatremic)> 350 mOsm/l

    Osmolaritatea= (Na+ + 10) x 2 + glicemia /18 + ureea /6(mosm/l)

    Frecven- 10% din comele diabetice hiperglicemice

  • 8/11/2019 Diabetul Zaharat -

    47/250

    Criterii de diagnostic

    Osmolaritate plasmatic > 350 mOsm/l

    Glicemie > 600 mg/dl

    pH > 7,25

    HCO3> 15 mEq/l

    Semne de deshidratare masiv

  • 8/11/2019 Diabetul Zaharat -

    48/250

    Complicaiile cronice ale DZ

  • 8/11/2019 Diabetul Zaharat -

    49/250

    Complicaiile cronice ale DZ

    Microangiopatice Macroangiopatice

    Neuropatice

    Gangrena diabetic

    Alte complicaii - hepatopatia dismetabolic

    - cardiomiopatia diabetic

    - parodontopatia

    - complicaii osteo-tendino-articulare- osteoartropatia diabetic (piciorul Charcot)

    - afectarea cutanat

    t l di ti l i DZ 2 t

  • 8/11/2019 Diabetul Zaharat -

    50/250

    n momentul diagnosticului DZ 2 un procent maredin persoane au deja complicaii cronice sau

    asocieri morbide

    Obezit. HTA DZP BCV Retinop.diab Nefrop.diab. Neurop.diab.

    0

    10

    20

    30

    40

    50

    60

    70

    80

    N. Hancu et al. Quality of care of newly-diagnosed diabetes mellitus:"EPIDIAB" program/lessons from the first

    three years. Diabetologia2003; 46(Suppl.2): A282.

  • 8/11/2019 Diabetul Zaharat -

    51/250

    Clasificarea neuropatiei diabetice

    Neuropatia subclinic

    Neuropatia clinic

    Periferic Vegetativ (autonom)

  • 8/11/2019 Diabetul Zaharat -

    52/250

    Neuropatia subclinic

    Teste de electrodiagnostic anormale

    - vitezde conducere nervoassczut

    Testare cantitativsenzorialanormal

    - vibratorie, tactil, termic

  • 8/11/2019 Diabetul Zaharat -

    53/250

  • 8/11/2019 Diabetul Zaharat -

    54/250

    Neuropatia periferic

    Polineuropatia distal simetric

    Neuropatia diabetic acut

    Neuropatia diabetic hiposenzitiv

    Neuropatia motorie proximal a membrelor inferioare

    Mononeuropatiile

    Neuropatiile truncale

  • 8/11/2019 Diabetul Zaharat -

    55/250

    Polineuropatia distal simetric

    Cea mai frecvent Tulburri de sensibilitate (hiperestezie sau hiposensibilitate)

    Membrele inferioare

    Evoluie centripet

    Disestezie Anestezie dureroas

    Agravare nocturn

    Semne de disfuncie vegetativ

    Piele uscat / aspect pseudo-inflamator

    Sensibilitatea vibratorie / proprioceptiv

    Atrofie i hipotonie muscular

  • 8/11/2019 Diabetul Zaharat -

    56/250

    Neuropatia diabetic acut

    Rar, dar caracteristic DZ

    Instalare acut

    Dureri intense n membrele inferioare

    Caexie neuropat

    Insomnie

    Depresie

    Impoten

  • 8/11/2019 Diabetul Zaharat -

    57/250

    Neuropatia diabetic hiposenzitiv

    Lipsesc acuzele subiective

    Scdere / dispariie a sensibilitii dureroas, termic,

    vibratorie

    Alterare variabil a funciilor vegetative

    VCN

    Risc de leziuni cutanate

    Evaluare cantitativ: determinarea pragului de electropercepie

  • 8/11/2019 Diabetul Zaharat -

    58/250

  • 8/11/2019 Diabetul Zaharat -

    59/250

    Mononeuropatiile

    Cel mai frecvent:

    nervii cranieni

    Cubital

    Sciatic popliteu extern

  • 8/11/2019 Diabetul Zaharat -

    60/250

    Neuropatiile truncale

    Rare

    Instalare acut sau progresiv

    Durere abdominal sau truncal unilateral

    T3 - T12

  • 8/11/2019 Diabetul Zaharat -

    61/250

  • 8/11/2019 Diabetul Zaharat -

    62/250

    Tratamentul neuropatiei periferice

    Echilibrare metabolic riguroas AINS, analgezice opioide cu aciune central

    Tranchilizante minore

    Carbamazepina, Gabapentin

    Antidepresive triciclice

    TENS, electroacupunctura

    Capsaicina

    Vitaminoterapia, benfotiamina, acidul alfa-lipoic Ionizri ale membrelor inferioare cu Xilin 1% i vit. B1

    Balneofizioterapia (mofete, bi carbogazoase, ionizri)

  • 8/11/2019 Diabetul Zaharat -

    63/250

    Neuropatia vegetativ

    Neuropatia cardio-vascular

    Neuropatia digestiv

    Neuropatia vezical Tulburrile sexuale

    Neuropatia pupilar

    Tulburrile cutanate Hipoglicemiile necontientizate

  • 8/11/2019 Diabetul Zaharat -

    64/250

    Neuropatia cardio-vascular

    Manifestrile cardiovasculare ale neuropatiei

    Cardiace Vasculare

    Tahicardie cu ritm stabil Hipotensiune ortostatic

    Infarct miocardic nedureros Tulburri circulatorii cerebrale

    intervalului QTc (>400 ms) Tulburri circulatorii aleextremitilor

    Tulburri de ritm Edeme ale membrelorinferioare

    Moarte subit Fenomenul non-dipping

    Accidente anestezice

  • 8/11/2019 Diabetul Zaharat -

    65/250

    Tratamentul hipotensiunii ortostatice

    Stoparea medicaiei care exacerbeazhipotensiunea Trecere treptat din clino n ortostatism

    Ciorapi elastici

    Creterea moderat a aportului de sare

    Simpatomimetice (etilefrin - Effortil)

    Mineralocorticoizi (9--fluorohidrocortizon400 g/zi)

    Antiinflamatorii nesteroidiene

    Derivaii de ergotamin (DH-ergotoxin 7 pic. de 3 X / zi) Agoniti ai receptorilor 1 -Midodrin2,5-10 mg/zi

    Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o

  • 8/11/2019 Diabetul Zaharat -

    66/250

    Neuropatia digestiv

    Disfuncia esofagian

    Disfuncia gastric

    Disfuncia intestinal

    Disfuncia veziculei biliare

  • 8/11/2019 Diabetul Zaharat -

    67/250

    Neuropatia vezical

    Hipotonie ureteral

    Pareza vezical

    vezica neurogen

    Tulburrile sexuale

    Bimpoten - tulburri de erecie

    - ejaculare retrogradFtulburri menstruale

  • 8/11/2019 Diabetul Zaharat -

    68/250

    Neuropatia pupilar

    Asimptomatic

    Msurarea reflexului pupilar la lumin

    Tulburrile cutanate

    Anhidroz distal

    Hipersudoraie compensatorie n superioar a corpului

    Hipoglicemiile necontientizate

    Absena semnelor de avertizare a hipoglicemiilor

  • 8/11/2019 Diabetul Zaharat -

    69/250

    Macroangiopatia diabetic

    Aterosclerozadate generale

    Arterioscleroza

    Ateroscleroza

    Athero (terci)+ sclerosis (induraie)

    Istoric

    Localizare

  • 8/11/2019 Diabetul Zaharat -

    70/250

    Fiziopatologia aterosclerozei

    Ipoteza rspunsului la injurie (R. Ross)

  • 8/11/2019 Diabetul Zaharat -

    71/250

    Leziunile aterosclerotice

    Striurile lipidice

    Placa de aterom fibroas

    Placa de aterom complicat

  • 8/11/2019 Diabetul Zaharat -

    72/250

    Diagnosticul clinic al aterosclerozei

    Faza preclinic, asimptomatic- diagnostic de suspiciune- modificri metabolice (hipercolesterolemia)- factori de risc (fumat, HTA, DZ etc.)

    Faza clinic- obstrucie > 60-70% din lumenul arterial- ischemie n diverse teritorii - coronarian

    - cerebral- membrele inferioare- renal- mezenteric

    - particularitile ATS la diabetici

  • 8/11/2019 Diabetul Zaharat -

    73/250

    Diagnosticul paraclinic al aterosclerozei

    Ecg

    Ecg de efort

    Scintigrafia cu taliu

    Ecocardiografia

    Angiografia

    Ecografia intravascular

  • 8/11/2019 Diabetul Zaharat -

    74/250

    Microangiopatia diabetic

    Nefropatia diabetic

    Retinopatia diabetic

  • 8/11/2019 Diabetul Zaharat -

    75/250

    Nefropatia diabetic date epidemiologice

    50 % dintre pacienii aflai n programele de supleererenal au drept cauz a insuficienei renale diabetul

    Dup 20 de ani 30 % dintre pacienii cu DZ 2 dezvoltnefropatie

    20% dintre cei cu nefropatie ajung la insuficienrenalterminal

  • 8/11/2019 Diabetul Zaharat -

    76/250

    Eliminarea urinar de proteine

    Prin consens:

    Normoalbuminurie < 30 mg/24 ore

    Microalbuminurie30-300 mg/24 ore

    Macroalbuminurie > 300 mg/24 ore

  • 8/11/2019 Diabetul Zaharat -

    77/250

    Stadializarea nefropatiei diabetice

    Stadiul IHiperfuncie i hipertrofie renal

    Stadiul IISilenios, normoalbuminuric

    Stadiul IIINefropatia diabetic incipient

    Stadiul IVNefropatia diabetic patent (clinic manifest)

    Stadiul VInsuficiena renal cronic terminal

    f

  • 8/11/2019 Diabetul Zaharat -

    78/250

    Evoluia n timp a filtratului glomerular i a

    eliminrii urinare de albumin

  • 8/11/2019 Diabetul Zaharat -

    79/250

    Diagnostic clinic

    Semne de HTA

    Semne de sindrom nefrotic, IRC

    Prezena altor complicaii ale diabetului: retinopatie,macroangiopatie, neuropatie

    numrului de hipoglicemii nejustificate i

    necesarului de insulin

  • 8/11/2019 Diabetul Zaharat -

    80/250

  • 8/11/2019 Diabetul Zaharat -

    81/250

  • 8/11/2019 Diabetul Zaharat -

    82/250

    Screening pentru nefropatia diabetic

    Microalbuminuria se evalueazla

    diagnosticarea DZ i apoi anual

    Creatinina serictrebuie dozatanual

  • 8/11/2019 Diabetul Zaharat -

    83/250

    Eliminarea urinar de proteine

    normoalbuminurie microalbuminurie macroalbuminurie

    Rata de excreiea albuminei(mg/24 ore) < 30 30-300 300

    Raportulalbumin/creati-

    nin (mg/g)Brbai

    Femei

    < 20

    < 30

    20-200

    30-300

    200

    300

  • 8/11/2019 Diabetul Zaharat -

    84/250

    Factori de risc pentru progresianefropatiei diabetice

    HTA

    Albuminuria

    Controlul glicemic insuficient

    Fumatul

    Consumul crescut de proteine

    Dislipidemia

  • 8/11/2019 Diabetul Zaharat -

    85/250

    Metode terapeutice

    Meninerea unui control glicemic optim pe termen lung

    Tratamentul precoce al hipertensiunii arteriale

    Tratamentul dietetic Reducerea lipidelor serice

    Prevenirea i tratamentul comorbiditilor existente

    Tratamentul anemiei renale

    Profilaxia i tratamentul bolii osoase renale

  • 8/11/2019 Diabetul Zaharat -

    86/250

    Retinopatia diabetic date generale

    RDunul din primele semne de afectare vascular

    Prima cauzde cecitate20-74 ani

    Prevalena corelat cu durata de evoluie a DZ

    > 20 ani de DZtoi pac.cu DZ 1

    > 60% pac. cu DZ 2

    Fi i t l i ti ti i di b ti

  • 8/11/2019 Diabetul Zaharat -

    87/250

    Alterarea compoziiei membranei bazale

    - extravazare - plasm edem- hematii hemoragii- lipoproteine exsudate dure

    Pericitelor- proliferarea cel. endoteliale

    - tonicitii peretelui capilar ectazii capilare microanevrisme

    Fiziopatologia retinopatiei diabetice

  • 8/11/2019 Diabetul Zaharat -

    88/250

  • 8/11/2019 Diabetul Zaharat -

    89/250

    Leziunile din RD

  • 8/11/2019 Diabetul Zaharat -

    90/250

    Leziunile din RD

    Neovascularizaia retinian Hemoragiile preretiniene

    Hemoragiile vitreene

    Dezlipirea de retin

    Rubeoza irian. Glaucomul neovascular

    Maculopatia diabetic

    Clasificarea retinopatiei diabetice

  • 8/11/2019 Diabetul Zaharat -

    91/250

    Clasificarea retinopatiei diabetice

    Retinopatie diabetic neproliferativ

    - uoar

    - sever (preproliferativ)

    Retinopatie diabetic proliferativ

    Diagnosticul retinopatiei diabetice

  • 8/11/2019 Diabetul Zaharat -

    92/250

    Diagnosticul retinopatiei diabetice

    Examenul FO- oftalmoscopia direct

    - biomicroscopia FO

    - oftalmoscopia indirect

    Angiografia cu fluorescein

    Fluorometria vitrean

    Ecografia ocular

    Electroretinograma Teste de discriminare cromatic

    Adaptometria

    Screening ul retinopatiei diabetice

  • 8/11/2019 Diabetul Zaharat -

    93/250

    Screening-ul retinopatiei diabetice

    Acuitatea vizualpoate fi normalchiar n prezena unorleziuni avansate ale retinei necesar screeningperiodic pentru toate persoanele cu diabet

    Examenul oftalmologic se va face la depistareadiabetului i apoi anual

    Pacienii cu retinopatie diabeticvor fi evaluai mai desn funcie de indicaiile medicului oftalmolog

    Frecvena examinrilor n funcie de stadiul RD

  • 8/11/2019 Diabetul Zaharat -

    94/250

    Frecvena examinrilor n funcie de stadiul RD

    Anomalii retiniene Urmrire la

    Normal + rare microanevrisme

    RDNP uoarRDNP moderat

    RDNP sever

    EMCS

    RDP

    Anual

    9 luni6 luni

    4 luni

    2-4 luni

    2-3 luni

    Tratamentul medicamentos al RD

  • 8/11/2019 Diabetul Zaharat -

    95/250

    Tratamentul medicamentos al RD

    Echilibrarea metabolic a DZ

    Evitarea hipoglicemiilor

    Vitamine A, E

    Extractul de ginkgo biloba Dobesilat de calciu

    Aspirina

    Tratamentul HTA IECA, Sartani, Sandostatin

    Tratamentul chirurgical al RD

  • 8/11/2019 Diabetul Zaharat -

    96/250

    Tratamentul chirurgical al RD

    Tratamentul laser

    - panfotocoagularea laser

    - tratamentul laser focal

    Vitrectomia posterioar

    Crioterapia

    Alte afectri oculare n diabetul zaharat

  • 8/11/2019 Diabetul Zaharat -

    97/250

    Alte afectri oculare n diabetul zaharat

    Cataract

    Glaucom

    Infecii Neuropatii de nervi oculomotori

    adaptriila ntuneric

    discriminriicromatice

  • 8/11/2019 Diabetul Zaharat -

    98/250

    Piciorul diabetic - date epidemiologice

    25% dintre bolnavii cu DZ internai sunt spitalizai pentrucomplicaii la nivelul piciorului

    50-70% dintre amputaiile netraumatice sunt la pacieniicu DZ

    Neuropatia diabeticeste a doua cauz, pe planmondial, de durere neuropat, duplumbago

    Fiziopatologia piciorului diabetic

  • 8/11/2019 Diabetul Zaharat -

    99/250

    Fiziopatologia piciorului diabetic

    Principalele modificri sunt

    determinate de: neuropatie

    arteriopatie

    Diagnostic diferenial simptome

  • 8/11/2019 Diabetul Zaharat -

    100/250

    Diagnostic diferenial - simptome

    Arteriopatia diabetic

    Claudicaie intermitent

    Durere de repaus

    Durere spontan, brusc instalat

    Neuropatia diabetic

    Dureri de repaus, nocturneArsuri

    Parestezii

    Diagnostic diferenial semne clinice

  • 8/11/2019 Diabetul Zaharat -

    101/250

    Diagnostic diferenial semne clinice

    Arteriopatia diabetic Absena pulsului, picior recePaloare la ridicarea membrului inf.Roea la trecerea n ortostatismCianoz

    Modificri trofice

    Neuropatia diabetic Piele atroficCalusUnghii distroficeDeformri osoasePicior caldReducerea/absena sensibilitii

    Absena reflexelor

  • 8/11/2019 Diabetul Zaharat -

    102/250

    Localizarea ulceraiilor neuropate

  • 8/11/2019 Diabetul Zaharat -

    103/250

    Localizarea ulceraiilor neuropate

    Aspecte ale piciorului diabetic

  • 8/11/2019 Diabetul Zaharat -

    104/250

    Aspecte ale piciorului diabetic

    Deformrile osoase predispun anumite zone la ulceraii

    Examinare picior

  • 8/11/2019 Diabetul Zaharat -

    105/250

    Examinare picior

    Examen vascular periferic

    palpare puls arterial

    examinare circulaie venoas culoare tegumente

    Ttegumente

    Examen neurologic

    ROT

    testare sensibilitate- tactil- termic- dureroas

    - vibratorie

    Prevenia piciorului diabetic

  • 8/11/2019 Diabetul Zaharat -

    106/250

    p

    Educaia pacientului pentru ngrijirea piciorului Examinarea piciorului zilnic ngrijirea pielii i unghiilor nclminte adecvat

    Renunarea la fumat

    Identificarea deformrilor osoase

    Evaluarea / ameliorarea controlului: Glicemiei TA Factorilor de risc cardiovascular

    Important de reinut n managementul piciorului

  • 8/11/2019 Diabetul Zaharat -

    107/250

    Important de reinut n managementul picioruluidiabetic

    Claudicaia intermitentdin angiopatie poate lipsi saupoate fi estompatdatoritneuropatiei

    Paradoxal, la nceputul tratamentului hipoglicemiantdurerile se pot intensifica

    Piciorul diabetic - concluzii

  • 8/11/2019 Diabetul Zaharat -

    108/250

    Inspecia piciorului se va efectua la fiecare vizit iar examinarea

    completanual

    Testarea sensibilitii periferice la bolnavul cu diabet se faceanual

    Se recomandun control agresiv al glicemiei pentru a reduceriscul apariiei piciorului diabetic

    Pacientul trebuie nvat s-i examineze piciorul si s-lngrijeasc

    Se va trimite pacientul la chirurg, ortoped, dermatolog laapariia unei rni, infecii, onicomicoze

    Complicaiile cutanate ale diabetului zaharat

  • 8/11/2019 Diabetul Zaharat -

    109/250

    p

    Dermatoze datorate diabetului zaharat i complicaiilor sale

    - manifestri cutanate ale neuropatiei diabetice

    - manifestri cutanate ale angiopatiei diabetice

    - infeciile cutanate

    Dermatoze datorate tratamentului specific diabetului zaharat

    Dermatoze asociate cu diabetul zaharat

    Manifestri cutanate ale neuropatiei diabetice

  • 8/11/2019 Diabetul Zaharat -

    110/250

    a est cuta ate a e eu opat e d abet ce

    Tegumentul uscat

    Pierderea prului la nivelul gambelor

    Hiperhidroza

    Durilloamele i hiperkeratoza plantar

    Hematoamele subungheale

    Venectaziile

    Edemul neuropat

    Ulcerele neuropate

    Manifestri cutanate ale angiopatiei diabetice

  • 8/11/2019 Diabetul Zaharat -

    111/250

    g p

    Dermopatia diabetic

    Necrobioza lipoidic

    Rubeoza facial

    Ulcerele arteriopate

    Infeciile cutanate

  • 8/11/2019 Diabetul Zaharat -

    112/250

    Infeciile cutanate

    Tinea pedis Onicomicoza

    Onicodistrofia

    Alte infecii micotice cutanate

    Foliculite

    Furunculoze

    Fasceita necrozant

  • 8/11/2019 Diabetul Zaharat -

    113/250

    Dermatoze asociate cu diabetul zaharat

  • 8/11/2019 Diabetul Zaharat -

    114/250

    Buloza diabetic

    Scleredemul

    Acanthosis nigricans

    Xantoamele eruptive

    Vitiligo

    Granulomul inelar Carotenodermia

    Evaluarea iniial

  • 8/11/2019 Diabetul Zaharat -

    115/250

    Obiective

    evaluarea statusului bolii i a factorilor de risc pentrucomplicaiile diabetului

    informarea pacientului despre natura i severitatea bolii educaia pacientului n legtura cu dieta adecvat,

    exerciiul fizic, medicaie, automonitorizarea glicemiei stabilirea unui plan terapeutic stabilirea unui plan de monitorizare

    Metode- anamnez- examen clinic complet- investigaii paraclinice

    Examen clinic

  • 8/11/2019 Diabetul Zaharat -

    116/250

    a e c c

    Greutate si nlime, IMC (Kg/m), circumferina abdominal TA

    Frecvena cardiac

    Palparea tiroidei

    Examinarea cordului

    Examinarea piciorului

    Examinarea pielii

    Examinarea neurologic(reflexe, sensibilitatea vibratorie,tactil, termic, dureroas)

    Investigaii paraclinice

  • 8/11/2019 Diabetul Zaharat -

    117/250

    g p

    Glicemia bazali la 2 ore postprandial Colesterol total, LDL-colesterol, HDL-colesterol Trigliceride Acid uric

    Uree, creatininseric, clearence-ul de creatinin Examenul de urin Microalbuminuria EKG

    Examen FO Radiografia toracic Ecografie abdominal Oscilometrie

    Monitorizare

    E l i ii l

  • 8/11/2019 Diabetul Zaharat -

    118/250

    Prima vizitEvaluarea iniialEducaia pacientului: informaii asupra boliii stilului de via

    La fiecareconsultaie

    Urmrirea rezultatelor automonitorizriiglicemiei (dac aceasta s-a fcut)

    Msurarea TAMsurarea greutii / IMC i a CA

    Inspecia piciorului

    La 3 luniDeterminarea HbA1c pentru evaluareacontrolului glicemic

    AnualExamen FODepistarea microalbuminurieiProfil lipidicEvaluarea riscului pentru picior diabetic,

    testarea sensibilitii

    Tratamentul diabetului zaharat

  • 8/11/2019 Diabetul Zaharat -

    119/250

    DZ este o boal cronic

    Obiectivul principal: meninerea parametrilor clinici ibiochimici specifici ct mai aproape de normal

    Tratamentul trebuie privit n perspectiva speranei devia

    Criteriile unui bun control metabolic

  • 8/11/2019 Diabetul Zaharat -

    120/250

    Glicemia preprandial: 80-110 mg/dl Glicemia postprandial: 100-145 mg/dl

    HbA1c: < 6,5 %

    Colesterol total: < 200 mg/dl

    Trigliceride a jeun: < 150 mg/dl

    TA < 130 / 80 mm Hg (120 / 70 mm Hg)

    IMC < 25 kg/m2(B);

    < 24 kg/m2(F)

    Importana controlului glicemic

  • 8/11/2019 Diabetul Zaharat -

    121/250

    Importana controlului glicemic

    Obiectivul principal al terapiei n DZ 2 este de

    a obine valori ale glicemiei ct mai aproape

    de valorile normale, n scopul de a preveni i

    ncetini apariia complicaiilor macro i

    microvasculare

    Hemoglobina glicozilat

  • 8/11/2019 Diabetul Zaharat -

    122/250

    Standardul de aurpentru monitorizarea glicemiei

    Reflecto medie a valorilor glicemiei pe o perioadanterioarde 2-3 luni

    Se exprimca procent din totalul Hb (normal 4-6%)

    Se coreleazbine cu valorile glicemiei

    Obiectiv realistic - Valoarea cea mai sczuta HbA1cobinutfrreacii adverse inacceptabile

  • 8/11/2019 Diabetul Zaharat -

    123/250

    Avantajele HbA1c

  • 8/11/2019 Diabetul Zaharat -

    124/250

    j 1c

    Evaluare obiectiva controlului glicemic

    Se coreleazcu riscul de apariie a complicaiilor

    Nu poate fi manipulatde pacient

    Neinfluenatde modificrile recente ale glicemiei ca

    urmare a ingestiei de alimente

    Automonitorizarea glicemiei

  • 8/11/2019 Diabetul Zaharat -

    125/250

    Crete compliana la tratament i are efect favorabil

    asupra schimbrii stilului de via

    Frecvena se stabilete n funcie de pacient, stadiul bolii,

    riscul evenimentelor hipoglicemice Ajutla individualizarea tratamentului i adaptarea

    msurilor nefarmacologice

    Dezavantaje

    cost crescut

    disconfort fizic

    Metode de tratament

  • 8/11/2019 Diabetul Zaharat -

    126/250

    Tratamentul dietetic

    Exerciiul fizic

    Tratamentul medicamentos (insulin i/sau ADO)

    Educaia specific

    Terapia n trepte a DZ tip 2

  • 8/11/2019 Diabetul Zaharat -

    127/250

    Insulin+/- ADO

    Terapie combinat

    Monoterapie oral

    Diet+exerciiu fizic

    Tratamentul dietetic

  • 8/11/2019 Diabetul Zaharat -

    128/250

    Locul dietoterapiei n tratamentul DZ

    Obiectivele tratamentului nutriional:

    - meninerea glicemiei la un nivel ct mai aproape de

    valorile normale- normalizarea profilului lipidic

    - asigurarea unui aport caloric adecvat

    - prevenirea i tratarea complicaiilor acute i cronice

    - creterea calitii vieii printr-o alimentaie adecvat

    Recomandrile nutriionale generale pentru

    pacientul diabetic

  • 8/11/2019 Diabetul Zaharat -

    129/250

    pacientul diabetic

    Calorii Glucide: 55-60 % din aportul caloric

    Fibre alimentare: 30-40 g/zi

    Lipide: sub 30 % din calorii

    Colesterol: < 300 mg/zi

    Proteine: 12-15 % din aportul caloric

    Sodiu: < 6 g NaCl / zi; la hipertensivi < 3

    g NaCl / zi Alcoolul

    Edulcorantele

    Vitamine i minerale

    CARBOHIDRAIFIBRE

    55%

    PROTEINE

    15%

    LIPIDE

    30%

    Etapele alctuirii unei diete

  • 8/11/2019 Diabetul Zaharat -

    130/250

    Precizarea caracteristicilor generale ale dietei Calculul aportului caloric

    Distribuia caloriilor pe cele 3 principii energetice

    - 55-60 % glucide

    - 25-30 % lipide (1/3 animale, 2/3 vegetale)- 12-15 % proteine (1/2 animale, 1/2 vegetale)

    Distribuirea glucidelor pe numrul de mese precizat

    - 20% - 10% - 30% - 10% - 20% - 10% Alegerea alimentelor

    Pregtirea corect a alimentelor (reguli de gastrotehnie)

    Curba glicemic n funcie de indexul glicemic

  • 8/11/2019 Diabetul Zaharat -

    131/250

    Factori care influeneaz indexul glicemic

  • 8/11/2019 Diabetul Zaharat -

    132/250

    Concentraia n glucide a alimentelor

    Coninutul de proteine i lipide al alimentelor

    Coninutul n fibre alimentare

    Prezena de amidon greu digerabil

    Mrimea particulelor de amidon Forma fizic a hranei

    Coninutul hidric al alimentelor

    Temperatura alimentelor

    Prezena inhibitorilor enzimatici naturali, a fitailor i taninelor Gradul de prelucrare mecanic prin masticaie

    Exemple de index glicemic

  • 8/11/2019 Diabetul Zaharat -

    133/250

    138% Glucoz126% Miere

    100% Glucoz 100% Pine alb

    90-99% Pine integral, piure decartofi, biscuii

    80-89% Piure de cartofi, morcovi 80-89% Cartofi, banane

    70-79% Pine integral, orez, cartofi 70-79% Chips-uri60-69% Pine alb, banane 60-69% Macaroane, spaghete fierte

    15 minute

    50-59% Spaghete fierte 5 minute,chips-uri

    50-59% Mere, portocale, mazre

    40-49% Mazre, portocale 40-49% Spaghete fierte 5 minute,lapte

    30-39% Lapte, mere 30-39% Fructoz

    20-29% Fasole psti, fructoz

    10-19% Arahide, soia 10-19% Arahide, soia

    Rspunsul insulinic la glucidele alimentare

  • 8/11/2019 Diabetul Zaharat -

    134/250

    Glucide rapid absorbabile Glucide lent absorbabile

    Efortul fizic terapeutic - beneficii

  • 8/11/2019 Diabetul Zaharat -

    135/250

    Scade glicemia i HbA1c Amelioreaz profilul lipidic

    - TG

    - LDL-colesterolul

    - HDL-colesterolul

    Amelioreaz HTA uoar i moderat

    Adjuvant al dietei pentru scderea ponderal

    Amelioreaz factorii de risc cardio-vascular Crete tonusul psihic i calitatea vieii

    Efortul fizic terapeutic - riscuri

  • 8/11/2019 Diabetul Zaharat -

    136/250

    Hipoglicemie Hiperglicemie i cetoz la pacienii insulino-deficieni

    Precipitarea i exacerbarea bolilor cardio-vasculare (anginpectoral, infarct de miocard, aritmii, moarte subit)

    Agravarea complicaiilor cronice ale DZ- retinopatie proliferativ: hemoragii vitreene, deslipiri de retin

    - nefropatie: proteinuria

    - neuropatie periferic: leziuni ale articulaiilor i ale es. moi

    - neuropatie vegetativ: scade rspunsul cardio-vascular laefort, hipotensiune ortostatic

  • 8/11/2019 Diabetul Zaharat -

    137/250

  • 8/11/2019 Diabetul Zaharat -

    138/250

    F.F.G. Banting

    C.H. Best

  • 8/11/2019 Diabetul Zaharat -

    139/250

    J.B. Collip J.R. MacLeod

    Clasificarea insulinelor

  • 8/11/2019 Diabetul Zaharat -

    140/250

    Dup provenien - animale- de tip uman

    Dup durata de aciune- cu aciune rapid (analogi)

    - cu durat scurt de aciune

    - cu aciune intermediar

    - cu durat lung de aciune

    - insuline premixate

    Insulinemia plasmatic la persoane cu diabet

    zaharat tip 1 i subieci sntoi

  • 8/11/2019 Diabetul Zaharat -

    141/250

    zaharat tip 1 i subieci sntoi

    Momentul zilei

    pmol/L

    N=24 DZ1

    Insulin uman regular

    Analog rapid de insulin

    480

    400

    320

    240

    160

    80

    007:00 06:00 h24:0018:0012:00

    N=8 Subieci sntoi

  • 8/11/2019 Diabetul Zaharat -

    142/250

    Analogii rapizi de insulin

  • 8/11/2019 Diabetul Zaharat -

    143/250

    Glulisine

    Analogii de insulin cu aciune lung

  • 8/11/2019 Diabetul Zaharat -

    144/250

    Insulina glargine(lantus)

    Insulina detemir(levemir)

    Preparate de insulin

    C i id ( l i d i li )

  • 8/11/2019 Diabetul Zaharat -

    145/250

    Cu aciune rapid (analogi de insulin):

    -NovoRapid- Humalog- Apidra

    Cu aciune scurt:

    - Actrapid HM- Humulin R- Insuman Rapid

    Cu aciune intermediar:

    - Insulatard HM- Humulin N (NPH)- Insuman Bazal

    Cu aciune lung:

  • 8/11/2019 Diabetul Zaharat -

    146/250

    - Monotard HM

    -Humulin L Analogi de insulin cu aciune lung:- Lantus- Levemir

    Insuline premixate:- Mixtard 1050 HM (Mixtard 30 HM)- Humulin M15 (Humulin M3)- Insuman Comb 25; Insuman Comb 50

    Analogi premixai:- NovoMix 30- Humalog Mix 25, Humalog Mix 50

    Scheme de insulinoterapie

  • 8/11/2019 Diabetul Zaharat -

    147/250

    Convenional

    Intensificat

    Insulinoterapia intensificat

  • 8/11/2019 Diabetul Zaharat -

    148/250

    Insuline prandiale

    Insuline bazale

    Administrarea insulinei

  • 8/11/2019 Diabetul Zaharat -

    149/250

    Cile de administrare

    Dispozitivele de administrare

    Autocontrolul i ajustarea dozelor Pompa de insulin

    Indicaiile insulinoterapiei

    Indicaiile insulinoterapiei

    n diabetul zaharat tip 2

  • 8/11/2019 Diabetul Zaharat -

    150/250

    p

    Meninerea dezechilibrului glicemic n ciuda dozelor maximede ageni orali combinai

    Hiperglicemie cu cetonemie i cetonurie

    Decompensarea generat de evenimente intercurente Managementul perioperator

    Sarcina i lactaia

    Hepatopatii i/sau nefropatii

    Alergia sau alte reacii adverse serioase la ADO

    Hiperglicemii importante n momentul prezentrii

    Efectele secundare ale insulinoterapiei

  • 8/11/2019 Diabetul Zaharat -

    151/250

    Hipoglicemia Lipodistrofia

    Abcesele la locul injeciei

    Alergia la insulin

    Producia de anticorpi la preparatele insulinice

    Creterea n greutate

    Edemul insulinic

    Neuropatia dureroas Scderea acuitii vizuale

    Hiperglicemiile matinale

  • 8/11/2019 Diabetul Zaharat -

    152/250

    Subinsulinizarea

    Fenomenul Somogyi

    Fenomenul de zori (Dawn phenomenon)

    Tratamentul cu antidiabetice oraleTratamentul cu preparate non-insulinice

  • 8/11/2019 Diabetul Zaharat -

    153/250

    Medicamente care cresc secreia pancreatic de insulin- sulfonilureice- reglatori prandiali ai glicemiei

    Medicamente care scad rezistena la insulin- biguanide- tiazolidindione

    Medicamente care scad absorbia intestinal de glucoz- inhibitori de alfa-glucozidaz

    Incretinele

    Medicamente care cresc secreia pancreaticde insulin (secretagoge)

  • 8/11/2019 Diabetul Zaharat -

    154/250

    Canalul KATPcu cele dou componente: receptorul

    sulfonilureic (SUR 1) i canalul rectificator de K (Kir 6.2)

    Ansamblulcanalului

    Componenta SUR Componenta Kir 6.2

  • 8/11/2019 Diabetul Zaharat -

    155/250

    nchiderea canalului KATPprinlegarea unei molecule de ATP la

    unul din cele 4 situsuri de pe SUR 1

    Preparatele sulfonilureice

  • 8/11/2019 Diabetul Zaharat -

    156/250

    Agentul sulfonilureic Preparate comerciale Doza maxim

    Generaia I- tolbutamid

    - clorpropamid

    Tolbutamid; 500 mg

    Diabinese; 250 mg

    3000 mg

    500 mg

    Generaia a II-a

    - glibenclamid

    - glipizid

    - gliclazid

    - gliquidona

    Glibenclamid; 5 mgManinil; 1,75; 3,5 mg

    Glucotrol; 5 i 10 mg

    Diaprel MR; 30 mg

    Glurenorm; 30 mg

    15 mg10,5 mg

    10 mg

    90 mg

    90 mg

    Generaia a III-a

    - glimepiride Amaryl; 1, 2, 3 i 4 mg 6 mg

    Reglatorii prandiali ai glicemiei

  • 8/11/2019 Diabetul Zaharat -

    157/250

    Acelai mecanism de aciune ca al sulfonilureicelor

    Durat scurt de aciune

    Risc hipoglicemic redus

    O mas o doz, nici o mas nici o doz

    Preparate: - Repaglinida (NovoNorm; 0,512 mg)

    - Nateglinida (Starlix)

    Medicamente care scad rezistena la insulin

  • 8/11/2019 Diabetul Zaharat -

    158/250

    Biguanidele

    Mecanism de aciune

    Efecte adverse

    Contraindicaii Preparate:

    - fenformin

    - metformin: Meguan, Siofor, Metfogamma, Metformin

    (1 cp = 500 mg, 850 mg; doza maxim = 2550 mg)- buformin: Silubin Retard

    (1 cp = 100 mg; doza maxim = 300 mg)

  • 8/11/2019 Diabetul Zaharat -

    159/250

  • 8/11/2019 Diabetul Zaharat -

    160/250

    Locurile de aciune ale agenilor

  • 8/11/2019 Diabetul Zaharat -

    161/250

    Sulfonilureice irepaglinidaStimuleazsecreia deinsulin.RepaglinidaSe administreaznspecial la pacienii cuglicemii postprandialecrescute.

    antihiperglicemiani

    Biguanide (metformin)

    Scad rezistena la insulinn esutul muscular.Scad GNG la niv. ficatului.

    Inhibitori de glucozidaz(acarboza)

    ntrzie absorbia intestinala carbohidrailor.

    Tiazolidindione

    Scad rezistena la

    insulin

    n esutul adipos i

    muchi. Scad GNG

    la nivelul ficatului.

  • 8/11/2019 Diabetul Zaharat -

    162/250

    Incretinele

    Secreia de insulin dup administrarea de glucozoral / intravenos

  • 8/11/2019 Diabetul Zaharat -

    163/250

    -30

    -10

    10

    3050

    70

    90

    0 15 30 45 60 75 90

    TIME (min)

    0

    50

    100

    150

    200

    0 15 30 45 60 75 90

    TIME (min)

    McIntyre et al, 1964

    GLUCOZ

    (mg/dl)

    INSULIN

    (mU/L)

    oralintravenos

    Efectul incretinic

  • 8/11/2019 Diabetul Zaharat -

    164/250

    Ingestia de glucozdetermin un rspuns insulinic mai

    pronunatdect glucoza administratintravenos, indicnd

    prezena unor substane secretate de tractul

    gastrointestinal care stimuleaz eliberarea de insulin

    printr-un mecanism glucodependent.

    Creutzfeldt. Diabetologia1985; 28: 565

    Definiia incretinelor

  • 8/11/2019 Diabetul Zaharat -

    165/250

    Gut-derived factors that increase

    glucose-stimulated insulin secretion

    IncretinIntestine Secretion Insulin

    Creutzfeldt. Diabetologia1985; 28: 565

    P t Pacieni c DZ tip 2

    Efectul incretinic la persoanele sntoaseila pacienii cu diabet zaharat tip 2

  • 8/11/2019 Diabetul Zaharat -

    166/250

    OralIV

    Insulin

    (mU/l)

    Insulin

    (mU/l)

    Persoane sntoase Pacieni cu DZ tip 2

    Timp (min) Timp (min)

    OralIV

  • 8/11/2019 Diabetul Zaharat -

    167/250

    GIPGastr ic inhib i tory polypept ide

    Gl di t d i l i t i l t id

  • 8/11/2019 Diabetul Zaharat -

    168/250

    Gluco se-mediated insu l ino tropic polypept ide

    GM: 4984

    Eliberare:duoden, jejun, ileonul proximalAciuni:

    - inhibarea secreiei gastrice acide- stimularea secreiei de insulin

    - aciuni insulin-like asupra metabolismului lipidic

    GLP-1Glucagon -l ike pept ide-1

  • 8/11/2019 Diabetul Zaharat -

    169/250

    GM:aprox. 4000

    Eliberare:intestinul subire distal, colon

    Aciuni:- stimularea secreiei de insulin- inhibarea golirii gastrice

    - aciuni insulin-like extrapancreatice- inhibarea apetitului

    GLP-1

  • 8/11/2019 Diabetul Zaharat -

    170/250

    Celula L

    GLP-1

    Glucoza

    Enterocit

    Pancreas:InsulinaGlucagonul

    Stomac:Motilitatea

    Hipotalamus:

    Apetitul

    Metabolism glucidic normal

  • 8/11/2019 Diabetul Zaharat -

    171/250

    Celula

    Glucide alimentare

    GIP GLP-1+ +

    secreia de insulineuglicemie

    digestie

    absorbie

    Diabet zaharat tip 2

  • 8/11/2019 Diabetul Zaharat -

    172/250

    Celula

    GIP GLP-1

    Glucide alimentare

    Secreie de insulinhiperglicemie

    Efectul administrrii de GLP-1n diabetul zaharat tip 2

  • 8/11/2019 Diabetul Zaharat -

    173/250

    Nauck M et al. Diabetologia1993; 36: 741744

    Glucoz

    Insulin

    Glucagon

    300

    250

    200

    150

    100

    50

    0

    0 60 120 180 240

    16

    12

    8

    4

    0

    GLP-1Placebo p

  • 8/11/2019 Diabetul Zaharat -

    174/250

    IntestinalGLP-1release

    GLP-1inactive

    Meal

    Active

    GLP-1

    DPP-4

    Eliberare deGLP-1

    intestinal

    GLP-1inactiv

    Mas

    GLP-1 activ

    DPP-4

    .Rothenberg P et al. Diabetes2000; 49 (suppl.1): A39

    Soluii farmacologice

  • 8/11/2019 Diabetul Zaharat -

    175/250

    GLP-1 uman recombinantinfuzie s.c. continu

    Agoniti de receptor GLP-1

    - Exenatida (Byetta)

    - Liraglutida

    Inhibitori de DPP-4

    Drucker. Diabetes Care2003; 26: 2929Dungan. Clin Diabetes2005; 23: 56

    Exenatida (Byetta)

  • 8/11/2019 Diabetul Zaharat -

    176/250

    Gila monster (Heloderma

    suspectum)

    Aprobat de FDA (2005) i de

    EMEA (2006) pt. trat. DZ 2

    Capt C-terminal bogat nreziduuri de prolin

    Aciune de 10 ori mai intens

    dect a GLP-1 nativ

    T1/2 mai lung

    GLP-1 iExenatida

  • 8/11/2019 Diabetul Zaharat -

    177/250

    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    Exenatida

    GLP-1

    Eng L et al. J Bio l Chem. 1992; 267: 7402

    Exenatida (Byetta)

  • 8/11/2019 Diabetul Zaharat -

    178/250

    Indicat n tratamentul DZ tip 2 necontrolat prin:- monoterapie cu metformin, sulfonilureice sau TZD

    - terapie oral combinat: metformin + sulfonilureice

    metformin + TZD

    Doza iniial: 5 g x 2/zi

    Adm. sc cu 60 min. naintea meselor principale

    Dup o lun, doza se poate crete la 10 g x 2/zi

    Liraglutida

    Derivat acil al GLP 1

  • 8/11/2019 Diabetul Zaharat -

    179/250

    Derivat acil al GLP-1

    Adugarea unei grupride acizi graiactiveazlegarea de albumineleplasmatice ntrzieeliminarea renal

    T1/2 ~ 12 ore

    Administrare injectabil osingurdatpe zi

    Knudsen L et al. J Med Chem2000; 43: 1664-1669

    Soluii farmacologice

  • 8/11/2019 Diabetul Zaharat -

    180/250

    GLP-1 uman recombinantinfuzie s.c. continu

    Agoniti de receptor GLP-1

    - Exenatida (Byetta, Bydureon)

    - Liraglutida

    Inhibitori de DPP-IV

    Drucker. Diabetes Care2003; 26: 2929Dungan. Clin Diabetes2005; 23: 56

    Meal

    Mas

    GLP-1

  • 8/11/2019 Diabetul Zaharat -

    181/250

    IntestinalGLP-1release

    GLP-1inactive

    Meal

    Active

    GLP-1

    DPP-4

    GLP-1inactiv

    Mas

    GLP-1 activ

    DPP-4

    Rothenberg P et al. Diabetes2000; 49 (suppl. 1): A39

    Inhibitor deDPP-4

    Eliberare deGLP-1

    intestinal

    Inhibitori de DPP-4

  • 8/11/2019 Diabetul Zaharat -

    182/250

    Sitagliptina (Januvia)- inhibitor competitiv, reversibil i nalt selectiv al DPP-4

    - aprobat de FDA (2006) i de ANM (2007) pt. trat. DZ 2

    Vildagliptina (Glavus)

    - se leag de DPP-4 complex inactiv

  • 8/11/2019 Diabetul Zaharat -

    183/250

    Efecte adverse ale incretinelor

  • 8/11/2019 Diabetul Zaharat -

    184/250

    Analogii de GLP-1- greuri i vrsturi (50% dintre pacieni)

    - dependente de doz

    - se amelioreaz pe parcursul tratamentului

    - diaree- hipoglicemii uoare i moderate (cnd se asociaz cu SU)

    Inhibitorii de DPP-4

    - cefalee

    - susceptibilitate pentru infecii de ci aeriene superioare

    Algoritmul de tratament n DZ 2

  • 8/11/2019 Diabetul Zaharat -

    185/250

    Dieta i exerciiul fizic

    Antidiabetice orale

    Asocieri de antidiabetice orale

    Insulin antidiabetice orale

    Preparate combinate de ADO

    Preparate combinate glibenclamid + metformin

  • 8/11/2019 Diabetul Zaharat -

    186/250

    p g

    Glibomet 2,5 mg/400 mg Glucovance 2,5 mg/500 mg5 mg/500 mg

    Preparate combinate TZD + metformin

    Avandamet 1 mg/500 mg Competact 15 mg/850 mg

    2 mg/1000 mg2 mg/500 mg

    4 mg/1000 mg

    Preparate combinate inhibitori DPP-4 + metformin

    Janumet 50 mg/850 mg

    50 mg/1000 mg

  • 8/11/2019 Diabetul Zaharat -

    187/250

  • 8/11/2019 Diabetul Zaharat -

    188/250

  • 8/11/2019 Diabetul Zaharat -

    189/250

    Dislipidemiile

    Definirea termenilor

  • 8/11/2019 Diabetul Zaharat -

    190/250

    Dislipidemii

    Hiperlipidemii

    Valorile normale- colesterol seric total < 190 mg/dl (< 5 mmol/l)- trigliceride serice < 180 mg/dl (< 2 mmol/l)- colesterol - HDL > 40 mg/dl (> 1 mmol/l)- colesterol - LDL < 115 mg/dl (< 3 mmol/l)

    Obiectivele terapeutice

  • 8/11/2019 Diabetul Zaharat -

    191/250

    Lipoproteinele

  • 8/11/2019 Diabetul Zaharat -

    192/250

    Asocieri molecularedintre diferite componente lipidicesanguine (TG, colesterol, fosfolipide, AG) i proteinelecirculante

    Constituite din:-partea transportat: AG esterificai sub form de TG i

    esteri de colesterol-transportorul: apoproteine

    Rolul apoproteinelor:- structural

    - funcional: legarea de receptoriactivarea sau inhibarea unor enzime

    (LPL, LCAT)

    Clase majore lipoproteice

    Chilomicronii 90% TG

  • 8/11/2019 Diabetul Zaharat -

    193/250

    Chilomicronii90% TG

    VLDL60% TG, 12% colesterol

    IDLforme tranzitorii; 30% colesterol, 40% TG

    LDL60% colesterol- fenotip A- fenotip B

    - fenotip intermediar

    HDL

    Clasificarea dislipidemiilor (Frederickson)

  • 8/11/2019 Diabetul Zaharat -

    194/250

    Tipul Ichilomicronemie bazal Tipul IIahiper - LDL

    Tipul IIbhiper - LDL i hiper - VLDL

    Tipul IIIcu IDL n condiii bazale Tipul IVhiper VLDL

    Tipul Vchilomicronemie bazal + hiper - VLDL

    Tipul VIhiper - HDL

  • 8/11/2019 Diabetul Zaharat -

    195/250

    Etiopatogenia dislipidemiilor

    Factori genetici

  • 8/11/2019 Diabetul Zaharat -

    196/250

    Factori genetici

    - defect cromozomial monogenic(ex. HLP tip IIa)-defect cromozomialpoligenic

    Factori ctigai

    - excesele alimentare- abuzul de alcool- fumatul- sedentarismul

    - stress-ul- obezitatea- diverse boli: DZ dezechilibrat, hipotiroidismul, sdr. nefrotic- unele medicamente: corticoizii, contraceptivele orale

    Tablou clinic

  • 8/11/2019 Diabetul Zaharat -

    197/250

    Xantoamede tip eruptiv, tendinos, tuberos, palmar Xantelasma

    Arc cornean

    Lipemia retinalis

    Dureri abdominale, manifestri de pancreatit

    Manifestri ale ATS cerebrale, coronariene i periferice

    Simptome osteo-articulare (rar)

    Investigaii paraclinice

  • 8/11/2019 Diabetul Zaharat -

    198/250

    Aprecierea aspectului plasmei sau serului dup 24 deore de la recoltare i pstrare la frigider (+ 40C)

    Dozarea colesterolului total i a TG

    Dozarea HDL-colesterolului

    Calculul LDL-colesterolului (formula lui Friedwald):LDL-col = colesterol totalHDL-colTG/5 (mg/dl)

    LDL-col = colesterol totalHDL-colTG/2,2 (mmol/l)

    Condiie: TG < 400 mg/dl

    Alte metode (electroforeza, ultracentrifugarea, dozareaapoproteinelor)

  • 8/11/2019 Diabetul Zaharat -

    199/250

    Grupele cu risc crescut la care se recomand

    depistarea dislipidemiilor

  • 8/11/2019 Diabetul Zaharat -

    200/250

    1. Bolnavi cu boli cardio-vasculare aterosclerotice

    2. Persoane cu factori de risc cardiovascular

    3. Persoane cu arc cornean sau xantomatoz

    4. Rudele de gradul I ale persoanelor de la punctele 1 i 2

    Depistarea complet

    - determinarea CT, TG, HDL-col

    - recoltare dimineaa, dup 8-12 ore de post

  • 8/11/2019 Diabetul Zaharat -

    201/250

    , p p

    - recomandat la persoane cu boli cardio - vasculare ATSDZ

    xantomatoz

    Depistarea parial

    - determinarea doar a colesterolului total

    - recoltare n orice moment al zilei

    - recomandat la persoanele care au i ali factori de riscrudele de gradul I ale celor cu BCV ATS

    alte persoane care se prezint la consultaie

    Dislipidemiile aterogene

  • 8/11/2019 Diabetul Zaharat -

    202/250

    Hipercolesterolemie de grani (190-249 mg/dl)

    Hipertrigliceridemie > 180 mg/dl

    Scderea colesterolului HDL < 40 mg/dl la brbai

    < 50 mg/dl la femei

    Modificarea LDL care devin mici i dense

    Dislipidemiile secundare

  • 8/11/2019 Diabetul Zaharat -

    203/250

    Hipercolesterolemiihipotiroidie, colestaz, sindromnefrotic, sarcin, medicaie cu tiazide i progesteron

    HipertrigliceridemieDZ necontrolat, sindrom nefrotic,

    insuficien renal cronic, paraproteinemie

    Hiperlipidemie mixtDZ necontrolat, sindrom nefrotic,medicaie cu tiazide, corticosteroizi, progestageni

    Complicaii i asocieri morbide

  • 8/11/2019 Diabetul Zaharat -

    204/250

    Patologia cardio-vascular aterosclerotic Pancreatita acut

    Diabetul zaharat

    Obezitatea

    Hipertensiunea arterial

    Sindromul X metabolic

    Management-ul dislipidemiilor

  • 8/11/2019 Diabetul Zaharat -

    205/250

    Stabilirea obiectivelor

    Optimizarea stilului de via

    - dieta hipolipidic

    - exerciiul fizic

    Tratamentul medicamentos

    Principiile dietei hipolipidice

    Adaptarea aportului caloric n funcie de necesiti i

  • 8/11/2019 Diabetul Zaharat -

    206/250

    greutatea corporal Reducerea aportului caloric provenit din lipide < 30%

    Scderea lipidelor saturate la 1/3 din totalul lipidelor

    Lipidele mononesaturate i cele polinesaturate (forma cis)

    vor reprezenta baza aportului lipidic (cte 1/3) Scderea aportului de colesterol < 300 mg/zi

    Creterea aportului de glucide complexe (50-55%)

    Fibrele alimentare20-30 g/zi

    Glucidele simple10% din necesarul caloric

    Alcoolul va fi suspendat sau mult limitat

    Evitarea fumatului

  • 8/11/2019 Diabetul Zaharat -

    207/250

    Tratamentul medicamentosFibraii

    Mecanism de aciune

  • 8/11/2019 Diabetul Zaharat -

    208/250

    Mecanism de aciune

    - PPAR exprimarea genei LPLexprimarea genei Apo A I i Apo A II

    diminuarea genei Apo C

    activeaz LPLstimuleaz catabolismul LDL i VLDL

    inhib lipoliza TG din adipocite

    concentraia LDL mici i dense

    HDL de volum crescuthiperlipemia postprandial

    fibrinogenul efect antitrombogen

    Efecte secundare - disconfort abdominal, greuri, erupii,

    mialgii (miopatie), efectul anticoagulantelor

  • 8/11/2019 Diabetul Zaharat -

    209/250

    Contraindicaii - insuficien hepatic, renal, sindrom

    nefrotic, sarcin, alptare

    Monitorizare - teste funcionale hepatice, creatin-kinaza

    Preparate - fenofibrat, bezafibrat, ciprofibrat, gemfibrozil

    Tratamentul medicamentosStatinele

    Mecanism de aciune

  • 8/11/2019 Diabetul Zaharat -

    210/250

    - inhib HMG-CoA reductaza, deci sinteza colesterolului- sinteza receptorilor LDL, deci catabolizarea acestuia

    - procentul de LDL mici i dense

    - oxidabilitatea LDL

    - fibrinogenul, Lp(a), PAI-1 efecte favorabile pesistemul de coagulare-fibrinoliz

    Efecte secundareflatulen, enzimelor hepatice imusculare, erupii

    Contraindicaiiboli hepatice active, sarcin, alptare

  • 8/11/2019 Diabetul Zaharat -

    211/250

    Monitorizare - teste funcionale hepatice, creatin-kinaza

    Preparate - rosuvastatin, atorvastatin, simvastatin,

    pravastatin, lovastatin, fluvastatin

    Indicaii de utilizare a claselor de

    hipolipemiante

    Tipul de hiperlipidemie Prima alegere Alternativ

  • 8/11/2019 Diabetul Zaharat -

    212/250

    Tipul de hiperlipidemie Prima alegere Alternativ

    Hipercolesterolemie Statine Rezine, acidnicotinic, fibrai

    Hipertrigliceridemie Fibrai Acid nicotinic, ulei

    de peteHiperlipidemie mixt Fibrai, statine Acid nicotinic

    Asocieri medicamentoase recomandateColestiramin + statine

    Fibrai+ statine

  • 8/11/2019 Diabetul Zaharat -

    213/250

    Obezitatea

    Definiie -obezitatea este o boal caracterizat princreterea greutii corporale pe seama esutului adipos

  • 8/11/2019 Diabetul Zaharat -

    214/250

    Etimologie - obedo-obedere (lat) = a mnca nexces, a mnca mult i lacom

    Prevalen - n lume > 250 milioane obezi

    - n 2025 > 300 milioane obezi

    Prevalena supraponderii i a obezitii n rileeuropene

  • 8/11/2019 Diabetul Zaharat -

    215/250

    Obezitateaproblem major de sntate public

  • 8/11/2019 Diabetul Zaharat -

    216/250

    Prevalen crescut la nivel populaional

    Costuri directe i indirecte ridicate implicate dengrijirea obezitii

    Complicaii multiple

    Formule de calcul a greutii ideale

  • 8/11/2019 Diabetul Zaharat -

    217/250

    Formula lui Broca: GI = I100

    Formula lui Lorentz: GI = (I100)(I150)/4 (B)

    GI = (I - 100)(I150)/2 (F)

    Formula Societii Asigurrilor Metropolitane din New York:

    GI = 50 + 0,75(I150) + (V20)/4 (B)

    F: GI (B) X 0,9

    Indici de apreciere a obezitii

    Indicele de mas corporal:

  • 8/11/2019 Diabetul Zaharat -

    218/250

    Indicele de mas corporal:

    IMC = G/I2 (n =18,524,9 kg/m2)

    Indicele abdomino-fesier:

    IAF = CA / CF (F: IAF < 0,85; B: IAF < 0,95)

    Indicele abdominal:IA = CA / I (n < 0,5)

    Grosimea paniculului adipos n regiunea tricipital:

    n < 20 mm (B); n < 30 mm (F)

    CA: n < 94 cm (B); n < 80 cm (F)

  • 8/11/2019 Diabetul Zaharat -

    219/250

    Clasificarea obezitii n funcie de distribuia

    esutului adipos

    Tipul obezitii Talia (cm) B Talia (cm) F

  • 8/11/2019 Diabetul Zaharat -

    220/250

    p ( ) ( )

    Abdominal

    Gluteo-femural

    94

    < 94

    80

    < 80

    Riscul cardiovascular n funcie de talie i sex

    Risc sczut Risc probabil Risc cert

    Brbai < 94 94101 102Femei < 80 8087 88

  • 8/11/2019 Diabetul Zaharat -

    221/250

    Clasificarea obezitii

    Criteriul etiopatogenic

  • 8/11/2019 Diabetul Zaharat -

    222/250

    - obezitate primar- obezitate secundar

    Criteriul histologic

    - obezitate hiperplazic- obezitate hipertrofic- obezitate mixt

    Criteriul evolutiv- obezitate dinamic (faza de acumulare)- obezitate static (de regul cnd a atins maximul ponderal)

    Organismul normoponderal adult

    EA = EC (MB + TM + TR + ADS)

  • 8/11/2019 Diabetul Zaharat -

    223/250

    Organismul obez

    EA = EC + ED

    EA = energie de aportEC = energie de consum

    MB = energie consumat pentru nevoile bazale

    TM = travaliu muscular

    TR = energie de termoreglareADS = aciunea dinamic specific a alimentelor

    Principalii factori de risc obezogen (1)

    Factori geneticiistoric familial de obezitate

  • 8/11/2019 Diabetul Zaharat -

    224/250

    Subnutriia mamei gestante, greutate mic la natere aftului

    Stil de via nesntosalimentaie hipercaloric, alcool,

    sedentarism, stress

    Factori psihologici, sociali i culturali- depresia, anxietatea tulburri de comportament alimentar

    - urbanizarea- obiceiuri alimentare nesntoase- lipsa aciunilor de educaie i prevenire la nivel populaional- mentaliti greite

    Principalii factori de risc obezogen (2)

    Tulburri de comportament alimentargustri

  • 8/11/2019 Diabetul Zaharat -

    225/250

    interprandiale de alimente bogate caloric, bulimie, bingeeating, night eating, carbohydrate-craving

    Factori fiziologicisarcin, lactaie, menopauz

    Factori endocrini i hipotalamici

    Medicamente

    Ali factorintreruperea fumatului n absena unei dietecorespunztoare

    Mortalitatea

    2

  • 8/11/2019 Diabetul Zaharat -

    226/250

    Riscul cel mai mic: IMC = 2025 27 Kg/m2

    excesiv la IMC > 30 Kg/m2

    IMC sczutneoplasme

    IMC crescut boli cardio-vasculare

    Durata medie de supravieuire cu 10 ani mai mic

    Efectul fluctuaiilor greutii

    Complicaiile cardio-vasculare ale obezitii

    Boala coronarian

  • 8/11/2019 Diabetul Zaharat -

    227/250

    Boala coronarian

    Insuficienacardiac

    Aritmiile imoartea subit

    Hipertensiunea arterial

    Varicele membrelor inferioare

  • 8/11/2019 Diabetul Zaharat -

    228/250

    Complicaiile digestive ale obezitii

    Litiaza biliar Angiocolecistite

  • 8/11/2019 Diabetul Zaharat -

    229/250

    Herniilehiatal, inghinal, ombilical Steatoza hepatic Hemoroizi

    Tulburri endocrine

    Distrofie ovarian (ovare polichistice) Tulburri ale ciclului menstrual Hiperestrogenism i hiperandrogenism la femei Hipogonadism la brbai

    Cancerele La B: prostat, colorectal La F: endometru, sn, ci biliare, col uterin, ovar

    Complicaiile metabolice ale obezitii

    Diabetul zaharat Hiperlipidemia

  • 8/11/2019 Diabetul Zaharat -

    230/250

    Hiperuricemia

    Complicaiile la nivelul aparatului locomotor Reumatism cronic degenerativ

    Osteoartrite de old i de genunchi Boli periarticularetendinite

    Complicaiile neurologice i psihice

    Cefalee, vertij, astenie fizic Tulburri psihice

    Complicaiile chirurgicale ale obezitii Risc chirurgical i anestezic mai mare Risc de insuficien respiratorie, infecii ale plgilor,

    dehiscena plgilor, tromboflebite postoperatorii

  • 8/11/2019 Diabetul Zaharat -

    231/250

    Complicaiile obstetricale ale obezitii Eclampsie, varice, tromboflebite, infecii urinare, diabet

    gestaional, mortalitate fetal crescut

    Distocii Retracie uterin ntrziat hemoragii, oc; endometrite,

    accidente mamare, pielonefrite

    Complicaiile cutanate Infecii microbiene i fungice (intertrigo inghinal, axilar) Eczeme

    Tratamentul obezitii n funcie de IMC

    IMC (kg/m2) Co-morbiditi Tratament

    > 27 Da sau nu Educaie privind schimbarea

  • 8/11/2019 Diabetul Zaharat -

    232/250

    pstilului de via

    > 30 Nu Educaie i program demodificare a obiceiurilor

    > 30 Da Educaie, program de modificarea obiceiurilor i medicamente

    > 35 Da sau nu Diethipocaloric, medicamente

    > 40 Da Toate cele enumerate anterior imetode chirurgicale

    Principiile tratamentului dietetic n obezitate

  • 8/11/2019 Diabetul Zaharat -

    233/250

    Glucide: 55-58% Proteine: 15-17%

    Lipide: 27-28%

    NaCl: < 6 g Fibre alimentare: 20-30 g

    Colesterol: < 300 mg

    Lichide: > 2 litri

    5 mese pe zi Mic dejun: 20%

    Gustare: 15%

    Prnz: 30% Gustare: 15%

    Cina: 20%

    Tipuri de diete utilizate n obezitate

  • 8/11/2019 Diabetul Zaharat -

    234/250

    Dieta cu deficit de 500 kcal/zi

    Dieta cu deficit de 1000 kcal/zi

    Dieta hipocaloric standard de 1200-1300 kcal/zi

    Reducerea la jumtate din aportul caloric anterior

    Dietele foarte hipocalorice sau restrictivesub 800 kcal/zi

    Rolul efortului fizic n tratamentul obezitii

  • 8/11/2019 Diabetul Zaharat -

    235/250

    Crete sensibilitatea esuturilor la insulin

    Determin scdere n greutate i menine

    greutatea dorit

    Scade riscul cardiovascular

    Scade necesarul de ageni farmacologici

    Crete capacitatea de efort

    Crete calitatea vieii

    Tratamentul medicamentos al obezitii

    Orlistat (Xenical) Inhib selectiv lipaza gastrointestinal absorbia

  • 8/11/2019 Diabetul Zaharat -

    236/250

    grsimilor cu 30% (TG i colesterol)

    Aciuni i efecte

    - reducerea greutii pe seama masei grase

    - reducerea taliei i a IMC

  • 8/11/2019 Diabetul Zaharat -

    237/250

    - reducerea RCV prin reducerea celorlali FR (col total,LDL, TG, ameliorarea toleranei la glucoz, a TA)

    Reacii adverse

    - digestive (n condiiile unui aport lipidic crescut)- nivelului plasmatic al vitaminelor liposolubile

    Contraindicaiisindrom de malabsorbie

    Posologie3 x 120 mg / zi la mesele principale

    Tratamentul chirurgical al obezitii

    Indicaii

  • 8/11/2019 Diabetul Zaharat -

    238/250

    IMC 40 kg/m2

    IMC 35 kg/m2 cu comorbiditi

    Vrsta ntre 18 i 60 ani

    Eecul tratamentului conservator aplicat cel puin un an

    Pacient care va coopera pe termen lung dup operaie

    Tratamentul chirurgical al obezitii

    Contraindicaii

  • 8/11/2019 Diabetul Zaharat -

    239/250

    IMC < 35 kg/m2

    Vrsta sub 18 ani sau peste 60 de ani

    Obezitate de cauz endocrin

    Dependena de droguri sau alcool

    Risc operator inacceptabil

    Boli asociate grave: hepatopatie, cardiopatie, patologiedigestiv

    Tehnici chirurgicale

    Tehnici restrictive

  • 8/11/2019 Diabetul Zaharat -

    240/250

    - gastroplastia orizontal

    - gastroplastia vertical

    - bandingul gastric

    Tehnici de malabsorbie- by-pass-ul jejunoileal

    - by-pass-ul bilio-intestinal

    - by-pass-ul bilio-pancreatic

  • 8/11/2019 Diabetul Zaharat -

    241/250

    Hiperuricemiile

    Definirea termenilor

  • 8/11/2019 Diabetul Zaharat -

    242/250

    Hiperuricemia Artrita acut uric

    Artrita gutoas cronic i tofii gutoi

    (guta cronic tofacee)

    Nefropatia uric

    Litiaza renal uric

    Epidemiologie

    Prevalena hiperuricemiilor - 218%

  • 8/11/2019 Diabetul Zaharat -

    243/250

    -n Romnia 4,2% la aduli

    Prevalena gutei - 0,130,37%

    - 25% din totalul artropatiilor

    Sexotropism masculin

    Vrf de inciden - decada a 5-a de vrst

    Clasificarea hiperuricemiilor

    Primare

  • 8/11/2019 Diabetul Zaharat -

    244/250

    - Idiopatic (> 99%)- Defecte metabolice specifice motenite (

  • 8/11/2019 Diabetul Zaharat -

    245/250

    Tratamentul dietetic n hiperuricemii

    Diet srac n purine

  • 8/11/2019 Diabetul Zaharat -

    246/250

    Tratamentul obezitii Reducerea consumului de alcool

    Diet lacto-fructo-zaharat

    Tratamentul atacului acut de gut

  • 8/11/2019 Diabetul Zaharat -

    247/250

    Colchicina

    AINS

    Glucocorticoizii (po sau intraarticular) NUhipouricemiante

    Profilaxia recurenelor

    Prevenirea formrii depozitelor tisulare de urai

    i diminuarea sau dispariia celor constituite

  • 8/11/2019 Diabetul Zaharat -

    248/250

    Inhibitorii biosintezei acidului uric

    - allopurinol, oxipurinol, tiopurinol

    Medicaia uricoeliminatoare

    - probenecidul

    - benziodarona

    - sulfinpirazona

  • 8/11/2019 Diabetul Zaharat -

    249/250

    Sindromul metabolic

    Definiia sindromului metabolic (IDF, 2005)

    Ob it t bd i l

  • 8/11/2019 Diabetul Zaharat -

    250/250

    Obezitate abdominal(CA 94 cm la B / 80 cm la F)+

    Oricare 2din urmtoarele 4 elemente:

    TG 150 mg/dl

    HDL < 40 mg/dl la B i < 50 mg/dl la F